Ppt1 (palmitoyl-protein thioesterase 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Ppt1 (palmitoyl-protein thioesterase 1) Rattus norvegicus

Analyze

Symbol:

Ppt1

Name:

palmitoyl-protein thioesterase 1

RGD ID:

61994

Description:

Predicted to enable lysophosphatidic acid binding activity; sulfatide binding activity; and thiolester hydrolase activity. Predicted to be involved in several processes, including lysosomal lumen acidification; positive regulation of endocytosis; and protein depalmitoylation. Predicted to act upstream of or within several processes, including grooming behavior; pinocytosis; and regulation of phospholipase A2 activity. Located in neuronal cell body and synaptic vesicle. Human ortholog(s) of this gene implicated in neuronal ceroid lipofuscinosis 1. Orthologous to human PPT1 (palmitoyl-protein thioesterase 1); PARTICIPATES IN fatty acid elongation pathway; INTERACTS WITH 3H-1,2-dithiole-3-thione; ammonium chloride; bexarotene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

palmitoyl-protein hydrolase 1; palmitoyl-protein thioesterase; Ppt; PPT-1

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PPT1 (palmitoyl-protein thioesterase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):	Ppt1 (palmitoyl-protein thioesterase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ppt1 (palmitoyl-protein thioesterase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PPT1 (palmitoyl-protein thioesterase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PPT1 (palmitoyl-protein thioesterase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ppt1 (palmitoyl-protein thioesterase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PPT1 (palmitoyl-protein thioesterase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PPT1 (palmitoyl-protein thioesterase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ppt1 (palmitoyl-protein thioesterase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	KIF11 (kinesin family member 11)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	PPT1 (palmitoyl-protein thioesterase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ppt1 (palmitoyl-protein thioesterase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ppt1 (palmitoyl-protein thioesterase 1 (ceroid-lipofuscinosis, neuronal 1, infantile))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ppt-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ppt1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	ppt1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	135,121,176 - 135,141,076 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	135,121,163 - 135,142,048 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	137,827,992 - 137,847,852 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	139,598,471 - 139,618,368 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	139,605,087 - 139,624,952 (+)	NCBI	Rnor_WKY
Rnor_6.0	5	140,538,260 - 140,558,163 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	140,538,260 - 140,558,162 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	144,329,263 - 144,349,162 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	142,153,498 - 142,173,401 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	142,158,725 - 142,179,598 (+)	NCBI
Celera	5	133,659,813 - 133,679,711 (+)	NCBI		Celera
RH 3.4 Map	5	890.0	RGD
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

central core disease (ISO)

Charcot-Marie-Tooth disease dominant intermediate C (ISO)

COVID-19 (ISO)

Developmental Disabilities (ISO)

disease of cellular proliferation (ISO)

epilepsy (ISO)

genetic disease (ISO)

intellectual disability (ISO)

Nervous System Malformations (ISO)

neuronal ceroid lipofuscinosis (ISO)

neuronal ceroid lipofuscinosis 1 (ISO)

neuronal ceroid lipofuscinosis 3 (ISS)

progressive myoclonus epilepsy (ISO)

retinitis pigmentosa (ISO)

spastic ataxia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17alpha-ethynylestradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4,6-tribromophenol (ISO)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (ISO)

acrolein (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

ammonium chloride (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

beauvericin (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bexarotene (EXP)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

chloroquine (ISO)

choline (ISO)

cobalt dichloride (ISO)

cyclosporin A (ISO)

cypermethrin (ISO)

decabromodiphenyl ether (ISO)

dibutyl phthalate (EXP,ISO)

doxorubicin (ISO)

enniatin (ISO)

finasteride (EXP)

folic acid (ISO)

furan (EXP)

gallic acid (ISO)

genistein (ISO)

glafenine (EXP)

glyphosate (EXP)

hydroxychloroquine (ISO)

ivermectin (ISO)

L-methionine (ISO)

methapyrilene (ISO)

N-methyl-4-phenylpyridinium (ISO)

NAD zwitterion (ISO)

NAD(+) (ISO)

orlistat (ISO)

ozone (ISO)

paclitaxel (ISO)

paracetamol (ISO)

pentachlorophenol (ISO)

resveratrol (ISO)

sarin (ISO)

silicon dioxide (EXP)

sodium arsenite (ISO)

sodium azide (ISO)

sodium fluoride (ISO)

sulindac (EXP)

sulindac sulfide (ISO)

tamoxifen (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

triptonide (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adult locomotory behavior (ISO)

associative learning (ISO)

brain development (ISO,ISS)

grooming behavior (ISO)

lipid catabolic process (ISO,ISS)

lysosomal lumen acidification (ISO,ISS)

lysosome organization (ISO)

macromolecule catabolic process (ISO)

macromolecule depalmitoylation (IEA)

membrane raft organization (ISO,ISS)

negative regulation of apoptotic process (ISO,ISS)

negative regulation of cell growth (ISO,ISS)

negative regulation of neuron apoptotic process (ISO,ISS)

nervous system development (IBA,ISO,ISS)

neurotransmitter secretion (ISO)

pinocytosis (ISO)

positive regulation of pinocytosis (ISO,ISS)

positive regulation of receptor-mediated endocytosis (ISO,ISS)

protein catabolic process (ISO)

protein depalmitoylation (IBA,ISO,ISS)

protein transport (ISO,ISS)

receptor-mediated endocytosis (IBA,ISO)

regulation of phospholipase A2 activity (ISO)

regulation of synaptic plasticity (TAS)

visual perception (ISO)

Cellular Component

axon (ISO,ISS)

cytosol (ISS)

dendrite (ISO)

extracellular region (ISO,ISS)

extracellular space (ISO)

Golgi apparatus (ISO,ISS)

intracellular membrane-bounded organelle (ISO)

lysosome (IBA,ISO,ISS)

membrane raft (ISO,ISS)

neuronal cell body (IDA,ISO)

nucleus (ISO,ISS)

synaptic vesicle (IDA,ISO,ISS)

Molecular Function

lysophosphatidic acid binding (ISO)

palmitoyl hydrolase activity (IEA)

palmitoyl-(protein) hydrolase activity (IBA,ISO,ISS)

palmitoyl-CoA hydrolase activity (ISO,ISS)

protein binding (ISO)

sulfatide binding (ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

fatty acid elongation pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Molecular cloning and expression of palmitoyl-protein thioesterase.	Camp LA, etal., J Biol Chem 1994 Sep 16;269(37):23212-9.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Disruption of PPT1 or PPT2 causes neuronal ceroid lipofuscinosis in knockout mice.	Gupta P, etal., Proc Natl Acad Sci U S A 2001 Nov 20;98(24):13566-71.
5.	Human palmitoyl protein thioesterase: evidence for lysosomal targeting of the enzyme and disturbed cellular routing in infantile neuronal ceroid lipofuscinosis.	Hellsten E, etal., EMBO J. 1996 Oct 1;15(19):5240-5.
6.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
10.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
11.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
12.	GOA pipeline	RGD automated data pipeline
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Status epilepticus induces changes in the expression and localization of endogenous palmitoyl-protein thioesterase 1.	Suopanki J, etal., Neurobiol Dis 2002 Aug;10(3):247-57.
16.	Palmitoyl-protein thioesterase, an enzyme implicated in neurodegeneration, is localized in neurons and is developmentally regulated in rat brain.	Suopanki J, etal., Neurosci Lett. 1999 Apr 9;265(1):53-6.
17.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:7637805	PMID:7901201	PMID:8816748	PMID:9685319	PMID:10611498	PMID:10658183	PMID:10737604	PMID:10992246	PMID:11020216	PMID:11722572	PMID:12477932	PMID:12483688
PMID:15647513	PMID:15649713	PMID:15885820	PMID:15929065	PMID:16242638	PMID:16368712	PMID:16542649	PMID:17341491	PMID:18317235	PMID:19941651	PMID:19946888	PMID:23376485
PMID:23533145	PMID:24302477

Genomics

Comparative Map Data

Ppt1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	135,121,176 - 135,141,076 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	135,121,163 - 135,142,048 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	137,827,992 - 137,847,852 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	139,598,471 - 139,618,368 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	139,605,087 - 139,624,952 (+)	NCBI	Rnor_WKY
Rnor_6.0	5	140,538,260 - 140,558,163 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	140,538,260 - 140,558,162 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	144,329,263 - 144,349,162 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	142,153,498 - 142,173,401 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	142,158,725 - 142,179,598 (+)	NCBI
Celera	5	133,659,813 - 133,679,711 (+)	NCBI		Celera
RH 3.4 Map	5	890.0	RGD
Cytogenetic Map	5	q36	NCBI

PPT1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	40,071,461 - 40,097,252 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	1	40,072,710 - 40,097,260 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	40,537,133 - 40,562,924 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	40,310,969 - 40,335,555 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	40,207,476 - 40,232,061	NCBI
Celera	1	38,820,669 - 38,845,442 (-)	NCBI		Celera
Cytogenetic Map	1	p34.2	NCBI
HuRef	1	38,656,433 - 38,681,192 (-)	NCBI		HuRef
CHM1_1	1	40,653,983 - 40,678,773 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	39,940,889 - 39,966,711 (-)	NCBI		T2T-CHM13v2.0

Ppt1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	122,729,879 - 122,752,968 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	122,730,035 - 122,752,968 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	122,836,077 - 122,859,175 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	122,836,242 - 122,859,175 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	122,513,485 - 122,536,418 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	122,338,558 - 122,360,685 (+)	NCBI		MGSCv36	mm8
Celera	4	121,166,717 - 121,189,624 (+)	NCBI		Celera
Cytogenetic Map	4	D2.2	NCBI
cM Map	4	57.27	NCBI

Ppt1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955452	17,529,115 - 17,549,664 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955452	17,518,345 - 17,549,112 (-)	NCBI	ChiLan1.0	ChiLan1.0

PPT1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	1	185,866,794 - 185,891,455 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	39,358,424 - 39,383,087 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	40,683,841 - 40,708,609 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	40,683,841 - 40,708,609 (-)	Ensembl	panpan1.1		panPan2

PPT1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	15	2,815,428 - 2,886,474 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	15	2,859,979 - 2,894,425 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	15	3,117,325 - 3,143,210 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	15	2,902,313 - 2,973,313 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	15	2,946,653 - 2,981,365 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	15	2,854,181 - 2,880,060 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	15	2,914,086 - 2,939,964 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	15	2,930,482 - 2,956,365 (+)	NCBI		UU_Cfam_GSD_1.0

Ppt1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	56,056,908 - 56,081,782 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	21,881,712 - 21,906,569 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936474	21,881,692 - 21,906,564 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PPT1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	95,840,908 - 95,860,858 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	95,840,906 - 95,860,858 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	89,280,518 - 89,300,475 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PPT1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	92,809,373 - 92,833,048 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	92,809,552 - 92,833,244 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	24,006,277 - 24,030,955 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Ppt1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	22,543,857 - 22,577,121 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624764	22,542,892 - 22,577,077 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ppt1
189 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	161
Count of miRNA genes:	115
Interacting mature miRNAs:	144
Transcripts:	ENSRNOT00000017998
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
631527	Tls1	T-lymphoma susceptibility QTL 1	0	0.001	thymus integrity trait (VT:0010555)	post-insult time to onset of T-cell lymphoma (CMO:0001907)	5	90450144	135450144	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	94858972	143070159	Rat
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	97059760	147465714	Rat
2317753	Glom24	Glomerulus QTL 24	3.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	5	97570330	136479578	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	99216724	148607142	Rat
1578673	Bmd13	Bone mineral density QTL 13	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	5	103689353	148689353	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	105999803	150999803	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	120740824	143608494	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	120740824	151018848	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
1300122	Wbc1	White blood cell count QTL 1	2.75		leukocyte quantity (VT:0000217)	total white blood cell count (CMO:0000365)	5	125392826	139989768	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
1331803	Rf32	Renal function QTL 32	2.798		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	129132428	143070159	Rat
70156	Niddm30	Non-insulin dependent diabetes mellitus QTL 30	3.98		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	5	129132447	151006154	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	132717196	165560427	Rat
7411722	Strs6	Sensitivity to stroke QTL 6	3.9		cerebrum integrity trait (VT:0010549)	percentage of study population developing cerebrovascular lesions during a period of time (CMO:0000932)	5	134972980	138113556	Rat

Markers in Region

Ppt

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	135,141,351 - 135,141,556 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	140,558,439 - 140,558,643	NCBI	Rnor6.0
Rnor_5.0	5	144,349,438 - 144,349,642	UniSTS	Rnor5.0
RGSC_v3.4	5	142,173,677 - 142,173,881	UniSTS	RGSC3.4
Celera	5	133,679,987 - 133,680,191	UniSTS
Cytogenetic Map	5	q36	UniSTS

RH142418

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	135,141,673 - 135,141,856 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	140,558,761 - 140,558,943	NCBI	Rnor6.0
Rnor_5.0	5	144,349,760 - 144,349,942	UniSTS	Rnor5.0
RGSC_v3.4	5	142,173,999 - 142,174,181	UniSTS	RGSC3.4
Celera	5	133,680,309 - 133,680,491	UniSTS
RH 3.4 Map	5	890.0	UniSTS
Cytogenetic Map	5	q36	UniSTS

RH127550

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	135,141,796 - 135,142,005 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	140,558,884 - 140,559,092	NCBI	Rnor6.0
Rnor_5.0	5	144,349,883 - 144,350,091	UniSTS	Rnor5.0
RGSC_v3.4	5	142,174,122 - 142,174,330	UniSTS	RGSC3.4
Celera	5	133,680,432 - 133,680,640	UniSTS
RH 3.4 Map	5	876.9	UniSTS
Cytogenetic Map	5	q36	UniSTS

AA851880

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	135,142,185 - 135,142,377 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	140,559,273 - 140,559,463	NCBI	Rnor6.0
Rnor_5.0	5	144,350,272 - 144,350,462	UniSTS	Rnor5.0
RGSC_v3.4	5	142,174,511 - 142,174,701	UniSTS	RGSC3.4
Celera	5	133,680,821 - 133,681,011	UniSTS
RH 3.4 Map	5	900.7	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022502	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC124205	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC126089	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213474	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213911	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L34262	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000017998 ⟹ ENSRNOP00000017998

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	135,121,173 - 135,141,080 (+)	Ensembl
Rnor_6.0 Ensembl	5	140,538,260 - 140,558,162 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000109802 ⟹ ENSRNOP00000084196

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	135,126,095 - 135,142,048 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000111724 ⟹ ENSRNOP00000093361

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	135,121,163 - 135,132,782 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000112154 ⟹ ENSRNOP00000091845

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	135,121,163 - 135,142,048 (+)	Ensembl

RefSeq Acc Id:

NM_022502 ⟹ NP_071947

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	135,121,176 - 135,141,076 (+)	NCBI
Rnor_6.0	5	140,538,260 - 140,558,163 (+)	NCBI
Rnor_5.0	5	144,329,263 - 144,349,162 (+)	NCBI
RGSC_v3.4	5	142,153,498 - 142,173,401 (+)	RGD
Celera	5	133,659,813 - 133,679,711 (+)	RGD

Sequence:

show sequence

AGATGGCGTCGCCCGGTTACCGGAGGCTGCTAGCTGCGGCTCTGCTTCCTTGGTGTTGCGCCGC
CTGGGCCCTGGGACATCTGGACCCACCTTCTCCACCACCGCTGGTGATCTGGCATGGGATGGGG
GACAGCTGCTGTAACCCCATGAGCATGGGTAGCATTAAAAAGATGGTTGAAAAGGAAATACCAG
GGATTTACGTCCTGTCTCTGGAGATTGGGAAGAACATGGTGGAGGATGTGGAGAACAGCTTCTT
CTTGAATGTCAACCTCCAAGTCGGAATGGCATGTCAGATTCTGGAAAAGGATCCTAAGTTGCAA
CACGGATACAATGCTATTGGCTTCTCCCAGGGAGGCCAGTTCCTGAGGGCAGTGGCTCAGAGAT
GCCCAACACCTCCCATGATGACCCTGATCTCAGTTGGGGGACAACATCAAGGTGTCTTTGGACT
CCCTCGATGCCCAGGAGAGAGTTCTCATATCTGTGACTTCATCAGGAAGTCACTTAACGCTGGT
GCTTACTCCAAAGTTGTGCAAGAACGCCTGGTGCAAGCACAGTACTGGCATGACCCCATCAAGG
AGGAAGTGTACCGAAACTGCAGCATCTTCTTGGCAGACATAAATCAAGAGAGGCATATCAATGA
GTCCTACAAGGAGAACCTGATGGCCCTCAAGAAGTTTGTGATGGTGAAATTCTTTAACGATTCC
ATCGTGGACCCTGTAGACTCTGAGTGGTTTGGATTTTACAGAAGTGGCCAAGCTAAGGAAACCA
TTCCCCTCCAGGAGACCACTCTCTACACAGAGGACCGCCTGGGGCTAAAGAAAATGGACAAAGC
AGGAAAGCTAGTGTTTCTGGCTAAGGAAGGAGACCACCTTCAAATATCTAAAGAGTGGTTTACA
GCCCACATCATACCTTTTCTTAAGTGAAGCCCTTGCACTTTGCAGCAGAGTTTATGACACCACA
GCTCTTCCAAACTCCAGTTTGCAACCAGTCCTTCTCTCGTGTTATCATCTAACATGCCCTGCTT
GGAAAGATCTAAGATCTGAATCTTATCCTTTGCCGCCTGCTATCACCATATGGTGTTGAATTCA
AGTTTAATTAGCTAGTAACCGTGCAGACTGCTTTACAACCATGTGATATGGTCAAGCTCTCTTT
TACGGAAGGGGAGTCTGCTATTGCAGATCAGCAATTGTGCCTAAGTGAAGTGAAGTGAAGCAGA
GAGACAAGCTCTGAGGGTAAAACCCATACAAATTTGGAGCAAATAAAAGCCTCATGGTATCCAA
AAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_071947	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA59358	(Get FASTA)	NCBI Sequence Viewer
	AAI26090	(Get FASTA)	NCBI Sequence Viewer
	EDL80359	(Get FASTA)	NCBI Sequence Viewer
	EDL80360	(Get FASTA)	NCBI Sequence Viewer
	P45479	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_071947 ⟸ NM_022502
- Peptide Label:	precursor
- UniProtKB:	A0JN20 (UniProtKB/Swiss-Prot), P45479 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MASPGYRRLLAAALLPWCCAAWALGHLDPPSPPPLVIWHGMGDSCCNPMSMGSIKKMVEKEIPG IYVLSLEIGKNMVEDVENSFFLNVNLQVGMACQILEKDPKLQHGYNAIGFSQGGQFLRAVAQRC PTPPMMTLISVGGQHQGVFGLPRCPGESSHICDFIRKSLNAGAYSKVVQERLVQAQYWHDPIKE EVYRNCSIFLADINQERHINESYKENLMALKKFVMVKFFNDSIVDPVDSEWFGFYRSGQAKETI PLQETTLYTEDRLGLKKMDKAGKLVFLAKEGDHLQISKEWFTAHIIPFLK hide sequence

RefSeq Acc Id:

ENSRNOP00000017998 ⟸ ENSRNOT00000017998

RefSeq Acc Id:

ENSRNOP00000093361 ⟸ ENSRNOT00000111724

RefSeq Acc Id:

ENSRNOP00000091845 ⟸ ENSRNOT00000112154

RefSeq Acc Id:

ENSRNOP00000084196 ⟸ ENSRNOT00000109802

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P45479-F1-model_v2	AlphaFold	P45479	1-306	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693998

Promoter ID:

EPDNEW_R4523

Type:

multiple initiation site

Name:

Ppt1_1

Description:

palmitoyl-protein thioesterase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	140,538,248 - 140,538,308	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:61994	AgrOrtholog
BioCyc Gene	G2FUF-40031	BioCyc
Ensembl Genes	ENSRNOG00000012616	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000017998.4	UniProtKB/TrEMBL
	ENSRNOP00000084196.1	UniProtKB/TrEMBL
	ENSRNOP00000091845	ENTREZGENE
	ENSRNOP00000091845.1	UniProtKB/Swiss-Prot
	ENSRNOP00000093361.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000017998.6	UniProtKB/TrEMBL
	ENSRNOT00000109802.1	UniProtKB/TrEMBL
	ENSRNOT00000111724.1	UniProtKB/TrEMBL
	ENSRNOT00000112154	ENTREZGENE
	ENSRNOT00000112154.1	UniProtKB/Swiss-Prot
Gene3D-CATH	3.40.50.1820	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:8361877	IMAGE-MGC_LOAD
InterPro	AB_hydrolase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Palm_thioest	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:29411	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:156647	IMAGE-MGC_LOAD
NCBI Gene	29411	ENTREZGENE
PANTHER	PALMITOYL-PROTEIN THIOESTERASE/DOLICHYLDIPHOSPHATASE 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11247:SF8	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Palm_thioest	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ppt1	PhenoGen
PRINTS	PPTHIESTRASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF53474	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC217109
UniProt	A0A8I6A0R6_RAT	UniProtKB/TrEMBL
	A0A8I6AJP6_RAT	UniProtKB/TrEMBL
	A0A8L2Q8Z6_RAT	UniProtKB/TrEMBL
	A0JN20	ENTREZGENE
	P45479	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	A0JN20	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Ppt1	palmitoyl-protein thioesterase 1	Ppt	palmitoyl-protein thioesterase	Name updated	1299863	APPROVED
2002-06-10	Ppt	palmitoyl-protein thioesterase			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_regulation	induced by epileptic seizures	633701

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)