Advanced Search (OLGA)

Gene: Dlk1 (delta like non-canonical Notch ligand 1) Rattus norvegicus

Analyze

Symbol:

Dlk1

Name:

delta like non-canonical Notch ligand 1

RGD ID:

619931

Description:

Predicted to enable calcium ion binding activity. Involved in cell differentiation. Predicted to be located in external side of plasma membrane and extracellular space. Predicted to be active in membrane. Orthologous to human DLK1 (delta like non-canonical Notch ligand 1); PARTICIPATES IN forkhead class A signaling pathway; Notch signaling pathway; p38 MAPK signaling pathway; INTERACTS WITH 17alpha-ethynylestradiol; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

delta-like 1; delta-like 1 homolog; delta-like 1 homolog (Drosophila); delta-like homolog (Drosophila); DLK-1; preadipocyte factor 1; preadipocyte factor-1; Pref-1; protein delta homolog 1; Zog

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	134,192,491 - 134,199,779 (+)	NCBI		GRCr8
mRatBN7.2	6	128,410,216 - 128,417,518 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	128,410,316 - 128,417,522 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	128,550,763 - 128,557,963 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	128,846,606 - 128,853,806 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	128,207,854 - 128,215,027 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	133,576,513 - 133,583,751 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	133,552,821 - 133,583,751 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	142,742,149 - 142,749,166 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	134,022,016 - 134,043,058 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	134,028,202 - 134,035,262 (+)	NCBI
Celera	6	125,960,411 - 125,967,475 (+)	NCBI		Celera
Cytogenetic Map	6	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dlk1	Rat	biliary atresia		ISO	RGD:732542	1625622		RGD
Dlk1	Rat	Experimental Autoimmune Encephalomyelitis		ISO	RGD:732543	150520045		RGD
Dlk1	Rat	hepatocellular carcinoma		ISO	RGD:732543	11344640	mRNA:increased expression:liver (mouse)	RGD
Dlk1	Rat	high grade glioma		ISO	RGD:732542	1625600		RGD

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dlk1	Rat	central precocious puberty		ISO	RGD:732542	8554872	ClinVar Annotator: match by term: Central precocious puberty	ClinVar
Dlk1	Rat	genetic disease		ISO	RGD:732542	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar
Dlk1	Rat	Kagami-Ogata syndrome		ISO	RGD:732542	8554872	ClinVar Annotator: match by term: Paternal uniparental disomy 14	ClinVar	PMID:18176563
Dlk1	Rat	Silver-Russell Syndrome 1		ISO	RGD:732542	8554872	ClinVar Annotator: match by term: Silver-Russell syndrome 1	ClinVar

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dlk1	Rat	Fetal Growth Retardation		ISO	RGD:732542	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:27776119
Dlk1	Rat	myelodysplastic syndrome		ISO	RGD:732542	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:18575777

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dlk1	Rat	1,2-dimethylhydrazine	increases expression	ISO	RGD:732543	6480464	1,2-Dimethylhydrazine results in increased expression of DLK1 mRNA	CTD	PMID:22206623
Dlk1	Rat	1,4-bis(2-ethylhexyl) sulfosuccinate	decreases expression	ISO	RGD:732543	6480464	Dioctyl Sulfosuccinic Acid results in decreased expression of DLK1 mRNA	CTD	PMID:26135921
Dlk1	Rat	17alpha-ethynylestradiol	decreases expression	EXP		6480464	Ethinyl Estradiol results in decreased expression of DLK1 mRNA	CTD	PMID:17557909
Dlk1	Rat	17beta-estradiol	decreases expression	ISO	RGD:732542	6480464	Estradiol results in decreased expression of DLK1 mRNA	CTD	PMID:23094148
Dlk1	Rat	17beta-estradiol	decreases expression	EXP		6480464	Estradiol results in decreased expression of DLK1 mRNA	CTD	PMID:32145629
Dlk1	Rat	17beta-estradiol	multiple interactions	ISO	RGD:732542	6480464	IGF1R mutant form inhibits the reaction [Estradiol results in decreased expression of DLK1 mRNA]	CTD	PMID:23094148
Dlk1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:732543	6480464	Tetrachlorodibenzodioxin results in increased expression of DLK1 mRNA	CTD	PMID:19933214
Dlk1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of DLK1 mRNA	CTD	PMID:34747641
Dlk1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of DLK1 mRNA	CTD	PMID:32109520
Dlk1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects methylation	ISO	RGD:732542	6480464	Tetrachlorodibenzodioxin affects the methylation of DLK1 5' UTR; Tetrachlorodibenzodioxin affects the methylation of DLK1 exon	CTD	PMID:28011154
Dlk1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:732543	6480464	Tetrachlorodibenzodioxin affects the expression of DLK1 mRNA	CTD	PMID:26377647
Dlk1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:732543	6480464	[Tetrachlorodibenzodioxin co-treated with Carbon Tetrachloride] results in increased expression of DLK1 mRNA	CTD	PMID:27693115
Dlk1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:732542	6480464	Tetrachlorodibenzodioxin results in decreased expression of DLK1 mRNA	CTD	PMID:20106945\|PMID:21632981
Dlk1	Rat	2-acetamidofluorene	increases expression	EXP		6480464	2-Acetylaminofluorene results in increased expression of DLK1 mRNA; 2-Acetylaminofluorene results in increased expression of DLK1 more ...	CTD	PMID:15567716\|PMID:17187413\|PMID:17538966
Dlk1	Rat	2-amino-2-deoxy-D-glucopyranose 6-phosphate	decreases expression	ISO	RGD:732543	6480464	glucosamine 6-phosphate results in decreased expression of DLK1 mRNA	CTD	PMID:19427183
Dlk1	Rat	2-methylcholine	affects expression	ISO	RGD:732542	6480464	beta-methylcholine affects the expression of DLK1 mRNA	CTD	PMID:21179406
Dlk1	Rat	3,3',4,4',5-pentachlorobiphenyl	decreases expression	EXP		6480464	3,4,5,3',4'-pentachlorobiphenyl results in decreased expression of DLK1 mRNA	CTD	PMID:23196670
Dlk1	Rat	3,3',5,5'-tetrabromobisphenol A	decreases expression	ISO	RGD:732543	6480464	tetrabromobisphenol A results in decreased expression of DLK1 mRNA	CTD	PMID:30496566
Dlk1	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	RGD:732543	6480464	[1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of DLK1 mRNA; more ...	CTD	PMID:25559859
Dlk1	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:732543	6480464	bisphenol S results in increased expression of DLK1 mRNA	CTD	PMID:30951980
Dlk1	Rat	4,4'-sulfonyldiphenol	affects methylation	ISO	RGD:732543	6480464	bisphenol S affects the methylation of DLK1 gene	CTD	PMID:31683443
Dlk1	Rat	5-aza-2'-deoxycytidine	decreases methylation	ISO	RGD:732542	6480464	Decitabine results in decreased methylation of DLK1 promoter	CTD	PMID:19194470
Dlk1	Rat	5-aza-2'-deoxycytidine	affects expression	ISO	RGD:732542	6480464	Decitabine affects the expression of DLK1 mRNA	CTD	PMID:23300844
Dlk1	Rat	5-aza-2'-deoxycytidine	increases expression	ISO	RGD:732542	6480464	Decitabine results in increased expression of DLK1 mRNA	CTD	PMID:19194470
Dlk1	Rat	5-azacytidine	decreases methylation	ISO	RGD:732542	6480464	Azacitidine results in decreased methylation of DLK1 promoter	CTD	PMID:19194470
Dlk1	Rat	5-fluorouracil	multiple interactions	ISO	RGD:732542	6480464	TP53 protein affects the reaction [Fluorouracil results in decreased expression of DLK1 mRNA]	CTD	PMID:15016801
Dlk1	Rat	5-fluorouracil	increases expression	ISO	RGD:732542	6480464	Fluorouracil results in increased expression of DLK1 mRNA	CTD	PMID:24737281
Dlk1	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of DLK1 mRNA	CTD	PMID:30047161
Dlk1	Rat	aflatoxin B1	increases expression	ISO	RGD:732543	6480464	Aflatoxin B1 results in increased expression of DLK1 mRNA	CTD	PMID:19770486
Dlk1	Rat	aldehydo-D-glucosamine 6-phosphate	decreases expression	ISO	RGD:732543	6480464	glucosamine 6-phosphate results in decreased expression of DLK1 mRNA	CTD	PMID:19427183
Dlk1	Rat	aldehydo-D-glucose	multiple interactions	ISO	RGD:732543	6480464	[lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ...	CTD	PMID:37567420
Dlk1	Rat	all-trans-retinoic acid	increases expression	ISO	RGD:732543	6480464	Tretinoin results in increased expression of DLK1 mRNA	CTD	PMID:16604517
Dlk1	Rat	all-trans-retinoic acid	multiple interactions	ISO	RGD:732543	6480464	[bisphenol F co-treated with Tretinoin] results in decreased expression of DLK1 mRNA	CTD	PMID:30951980
Dlk1	Rat	all-trans-retinoic acid	decreases expression	ISO	RGD:732542	6480464	Tretinoin results in decreased expression of DLK1 mRNA	CTD	PMID:16012519\|PMID:21934132\|PMID:23724009
Dlk1	Rat	amitrole	decreases expression	EXP		6480464	Amitrole results in decreased expression of DLK1 mRNA	CTD	PMID:30047161
Dlk1	Rat	arsane	affects expression	ISO	RGD:732542	6480464	Arsenic affects the expression of DLK1 protein	CTD	PMID:24675094
Dlk1	Rat	arsane	affects methylation	ISO	RGD:732542	6480464	Arsenic affects the methylation of DLK1 gene	CTD	PMID:25304211
Dlk1	Rat	arsenic atom	affects expression	ISO	RGD:732542	6480464	Arsenic affects the expression of DLK1 protein	CTD	PMID:24675094
Dlk1	Rat	arsenic atom	affects methylation	ISO	RGD:732542	6480464	Arsenic affects the methylation of DLK1 gene	CTD	PMID:25304211
Dlk1	Rat	arsenous acid	affects response to substance	ISO	RGD:732542	6480464	DLK1 protein affects the susceptibility to Arsenic Trioxide	CTD	PMID:18575777
Dlk1	Rat	atrazine	increases expression	ISO	RGD:732542	6480464	Atrazine results in increased expression of DLK1 mRNA	CTD	PMID:22378314
Dlk1	Rat	Azoxymethane	multiple interactions	ISO	RGD:732543	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of DLK1 more ...	CTD	PMID:29950665
Dlk1	Rat	baicalein	increases expression	ISO	RGD:732543	6480464	baicalein results in increased expression of DLK1 mRNA	CTD	PMID:24560969
Dlk1	Rat	benzalkonium chloride	decreases expression	ISO	RGD:732543	6480464	Benzalkonium Compounds results in decreased expression of DLK1 mRNA	CTD	PMID:31199489
Dlk1	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:732543	6480464	Benzo(a)pyrene results in decreased expression of DLK1 mRNA	CTD	PMID:20127859\|PMID:22228805
Dlk1	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:732542	6480464	Benzo(a)pyrene affects the methylation of DLK1 promoter	CTD	PMID:27901495
Dlk1	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:732542	6480464	Benzo(a)pyrene results in decreased expression of DLK1 mRNA	CTD	PMID:20106945\|PMID:21632981
Dlk1	Rat	benzo[e]pyrene	increases methylation	ISO	RGD:732542	6480464	benzo(e)pyrene results in increased methylation of DLK1 polyA tail	CTD	PMID:30157460
Dlk1	Rat	bezafibrate	increases expression	EXP		6480464	Bezafibrate results in increased expression of DLK1 mRNA	CTD	PMID:11473052
Dlk1	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	RGD:732543	6480464	Diethylhexyl Phthalate results in increased expression of DLK1 mRNA	CTD	PMID:28085963
Dlk1	Rat	bisphenol A	decreases expression	ISO	RGD:732543	6480464	bisphenol A results in decreased expression of DLK1 mRNA	CTD	PMID:26063408
Dlk1	Rat	bisphenol A	decreases methylation	ISO	RGD:732542	6480464	bisphenol A results in decreased methylation of DLK1 gene	CTD	PMID:31601247
Dlk1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of DLK1 mRNA	CTD	PMID:30816183\|PMID:32528016\|PMID:34973380
Dlk1	Rat	bisphenol A	affects expression	ISO	RGD:732542	6480464	bisphenol A affects the expression of DLK1 mRNA	CTD	PMID:30903817
Dlk1	Rat	bisphenol A	increases expression	ISO	RGD:732543	6480464	bisphenol A results in increased expression of DLK1 mRNA	CTD	PMID:30951980\|PMID:32156529\|PMID:34585602\|PMID:35598803\|PMID:37105096
Dlk1	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of DLK1 mRNA	CTD	PMID:25181051\|PMID:32145629
Dlk1	Rat	Bisphenol A diglycidyl ether	decreases expression	ISO	RGD:732542	6480464	bisphenol A diglycidyl ether results in decreased expression of DLK1 mRNA	CTD	PMID:22763116
Dlk1	Rat	Bisphenol A diglycidyl ether	decreases expression	ISO	RGD:732543	6480464	bisphenol A diglycidyl ether results in decreased expression of DLK1 mRNA	CTD	PMID:22763116
Dlk1	Rat	bisphenol F	multiple interactions	ISO	RGD:732543	6480464	[bisphenol F co-treated with Tretinoin] results in decreased expression of DLK1 mRNA	CTD	PMID:30951980
Dlk1	Rat	bisphenol F	increases expression	ISO	RGD:732543	6480464	bisphenol F results in increased expression of DLK1 mRNA	CTD	PMID:30951980
Dlk1	Rat	bleomycin A2	increases expression	ISO	RGD:732543	6480464	Bleomycin results in increased expression of DLK1 protein	CTD	PMID:29175452
Dlk1	Rat	carbamazepine	affects expression	ISO	RGD:732542	6480464	Carbamazepine affects the expression of DLK1 mRNA	CTD	PMID:25979313
Dlk1	Rat	chlorpyrifos	increases expression	ISO	RGD:732543	6480464	Chlorpyrifos results in increased expression of DLK1 mRNA	CTD	PMID:37019170
Dlk1	Rat	cisplatin	affects expression	ISO	RGD:732542	6480464	Cisplatin affects the expression of DLK1 mRNA	CTD	PMID:23300844
Dlk1	Rat	cobalt atom	increases expression	ISO	RGD:732543	6480464	Cobalt results in increased expression of DLK1 mRNA	CTD	PMID:34468815
Dlk1	Rat	copper atom	increases expression	EXP		6480464	Copper deficiency results in increased expression of DLK1 mRNA	CTD	PMID:26033743
Dlk1	Rat	copper(0)	increases expression	EXP		6480464	Copper deficiency results in increased expression of DLK1 mRNA	CTD	PMID:26033743
Dlk1	Rat	copper(II) sulfate	decreases expression	ISO	RGD:732542	6480464	Copper Sulfate results in decreased expression of DLK1 mRNA	CTD	PMID:19549813
Dlk1	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of DLK1 mRNA	CTD	PMID:26577399
Dlk1	Rat	cyclosporin A	decreases expression	ISO	RGD:732542	6480464	Cyclosporine results in decreased expression of DLK1 mRNA	CTD	PMID:25562108
Dlk1	Rat	D-glucose	multiple interactions	ISO	RGD:732543	6480464	[lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ...	CTD	PMID:37567420
Dlk1	Rat	dexamethasone	increases expression	EXP		6480464	Dexamethasone results in increased expression of DLK1 mRNA	CTD	PMID:23166830
Dlk1	Rat	dexamethasone	decreases expression	ISO	RGD:732543	6480464	Dexamethasone results in decreased expression of DLK1 mRNA	CTD	PMID:25851902
Dlk1	Rat	dexamethasone	multiple interactions	ISO	RGD:732543	6480464	[1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased expression of DLK1 mRNA; more ...	CTD	PMID:25559859
Dlk1	Rat	dextran sulfate	multiple interactions	ISO	RGD:732543	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of DLK1 more ...	CTD	PMID:29950665
Dlk1	Rat	diarsenic trioxide	affects response to substance	ISO	RGD:732542	6480464	DLK1 protein affects the susceptibility to Arsenic Trioxide	CTD	PMID:18575777
Dlk1	Rat	diethylstilbestrol	decreases expression	EXP		6480464	Diethylstilbestrol results in decreased expression of DLK1 mRNA	CTD	PMID:36653537\|PMID:37077353
Dlk1	Rat	dorsomorphin	multiple interactions	ISO	RGD:732542	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
Dlk1	Rat	doxorubicin	decreases expression	ISO	RGD:732542	6480464	Doxorubicin results in decreased expression of DLK1 mRNA	CTD	PMID:30031762
Dlk1	Rat	entinostat	multiple interactions	ISO	RGD:732542	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
Dlk1	Rat	entinostat	decreases expression	ISO	RGD:732542	6480464	entinostat results in decreased expression of DLK1 mRNA	CTD	PMID:26272509
Dlk1	Rat	ethanol	increases expression	ISO	RGD:732543	6480464	Ethanol results in increased expression of DLK1 mRNA	CTD	PMID:30319688
Dlk1	Rat	ethanol	affects expression	ISO	RGD:732543	6480464	Ethanol affects the expression of DLK1 mRNA	CTD	PMID:30319688
Dlk1	Rat	fipronil	increases expression	EXP		6480464	fipronil results in increased expression of DLK1 mRNA	CTD	PMID:23962444
Dlk1	Rat	flavonoids	increases expression	EXP		6480464	Flavonoids results in increased expression of DLK1 mRNA	CTD	PMID:18035473
Dlk1	Rat	folic acid	multiple interactions	ISO	RGD:732543	6480464	[Folic Acid co-treated with sodium arsenite] results in decreased methylation of DLK1 mRNA	CTD	PMID:22959928
Dlk1	Rat	fructose	multiple interactions	ISO	RGD:732543	6480464	[lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ...	CTD	PMID:37567420
Dlk1	Rat	genistein	increases expression	ISO	RGD:732543	6480464	Genistein results in increased expression of DLK1 mRNA	CTD	PMID:18359623\|PMID:32186404
Dlk1	Rat	glucose	multiple interactions	ISO	RGD:732543	6480464	[lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ...	CTD	PMID:37567420
Dlk1	Rat	glycidol	increases expression	EXP		6480464	glycidol results in increased expression of DLK1 mRNA	CTD	PMID:24915197
Dlk1	Rat	glyphosate	increases expression	ISO	RGD:732543	6480464	Glyphosate results in increased expression of DLK1 mRNA	CTD	PMID:35897073
Dlk1	Rat	herbicide	multiple interactions	ISO	RGD:732543	6480464	[lard co-treated with Cholesterol, Dietary co-treated with Dietary Sucrose co-treated with Fructose co-treated with Glucose more ...	CTD	PMID:37567420
Dlk1	Rat	hydrogen peroxide	increases expression	ISO	RGD:732542	6480464	Hydrogen Peroxide results in increased expression of DLK1 mRNA	CTD	PMID:32949572
Dlk1	Rat	indometacin	increases expression	ISO	RGD:732542	6480464	Indomethacin results in increased expression of DLK1 mRNA	CTD	PMID:24737281
Dlk1	Rat	inulin	multiple interactions	ISO	RGD:732543	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of DLK1 mRNA	CTD	PMID:36331819
Dlk1	Rat	ketoconazole	decreases expression	EXP		6480464	Ketoconazole results in decreased expression of DLK1 mRNA	CTD	PMID:37077353
Dlk1	Rat	lead(0)	decreases expression	ISO	RGD:732542	6480464	Lead results in decreased expression of DLK1 mRNA	CTD	PMID:37467947
Dlk1	Rat	lipopolysaccharide	decreases expression	ISO	RGD:732543	6480464	Lipopolysaccharides results in decreased expression of DLK1 mRNA	CTD	PMID:12057914
Dlk1	Rat	manganese(II) chloride	increases methylation	ISO	RGD:732542	6480464	manganese chloride results in increased methylation of DLK1 gene	CTD	PMID:27913844
Dlk1	Rat	manganese(II) chloride	decreases expression	ISO	RGD:732542	6480464	manganese chloride results in decreased expression of DLK1 mRNA	CTD	PMID:27913844
Dlk1	Rat	methapyrilene	increases methylation	ISO	RGD:732542	6480464	Methapyrilene results in increased methylation of DLK1 polyA tail	CTD	PMID:30157460
Dlk1	Rat	methylmercury chloride	increases expression	ISO	RGD:732542	6480464	methylmercuric chloride results in increased expression of DLK1 mRNA	CTD	PMID:34089799
Dlk1	Rat	monosodium L-glutamate	decreases expression	EXP		6480464	Sodium Glutamate results in decreased expression of DLK1 mRNA	CTD	PMID:28954212
Dlk1	Rat	N-methyl-4-phenylpyridinium	increases expression	ISO	RGD:732542	6480464	1-Methyl-4-phenylpyridinium results in increased expression of DLK1 mRNA	CTD	PMID:24810058
Dlk1	Rat	panobinostat	decreases expression	ISO	RGD:732542	6480464	panobinostat results in decreased expression of DLK1 mRNA	CTD	PMID:26272509
Dlk1	Rat	panobinostat	multiple interactions	ISO	RGD:732542	6480464	[NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
Dlk1	Rat	paraquat	decreases expression	EXP		6480464	Paraquat results in decreased expression of DLK1 mRNA	CTD	PMID:32680482
Dlk1	Rat	pentanal	increases expression	ISO	RGD:732542	6480464	pentanal results in increased expression of DLK1 mRNA	CTD	PMID:26079696
Dlk1	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:732543	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of DLK1 mRNA	CTD	PMID:36331819
Dlk1	Rat	phenylmercury acetate	decreases expression	ISO	RGD:732542	6480464	Phenylmercuric Acetate results in decreased expression of DLK1 mRNA	CTD	PMID:26272509
Dlk1	Rat	phenylmercury acetate	multiple interactions	ISO	RGD:732542	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Dlk1	Rat	phorbol 13-acetate 12-myristate	affects response to substance	ISO	RGD:732542	6480464	DLK1 protein affects the susceptibility to Tetradecanoylphorbol Acetate	CTD	PMID:18575777
Dlk1	Rat	prednisone	decreases expression	ISO	RGD:732543	6480464	Prednisone results in decreased expression of DLK1 mRNA	CTD	PMID:38439560
Dlk1	Rat	pregnenolone 16alpha-carbonitrile	decreases expression	EXP		6480464	Pregnenolone Carbonitrile results in decreased expression of DLK1 mRNA	CTD	PMID:30047161
Dlk1	Rat	resveratrol	multiple interactions	ISO	RGD:732542	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of DLK1 mRNA	CTD	PMID:23557933
Dlk1	Rat	rotenone	increases expression	ISO	RGD:732542	6480464	Rotenone results in increased expression of DLK1 mRNA	CTD	PMID:29955902
Dlk1	Rat	sarin	decreases expression	ISO	RGD:732542	6480464	Sarin results in decreased expression of DLK1 mRNA	CTD	PMID:19522546
Dlk1	Rat	SB 431542	multiple interactions	ISO	RGD:732542	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
Dlk1	Rat	silibinin	multiple interactions	ISO	RGD:732543	6480464	Silybin inhibits the reaction [[1-Methyl-3-isobutylxanthine co-treated with Dexamethasone co-treated with INS1 protein] results in decreased more ...	CTD	PMID:25559859
Dlk1	Rat	silicon dioxide	increases expression	ISO	RGD:732542	6480464	Silicon Dioxide analog results in increased expression of DLK1 mRNA; Silicon Dioxide results in increased more ...	CTD	PMID:25895662\|PMID:34973136
Dlk1	Rat	silicon dioxide	decreases expression	EXP		6480464	Silicon Dioxide results in decreased expression of DLK1 mRNA	CTD	PMID:22431001
Dlk1	Rat	sodium arsenite	multiple interactions	ISO	RGD:732543	6480464	[Folic Acid co-treated with sodium arsenite] results in decreased methylation of DLK1 mRNA	CTD	PMID:22959928
Dlk1	Rat	sodium arsenite	affects expression	ISO	RGD:732543	6480464	sodium arsenite affects the expression of DLK1 mRNA	CTD	PMID:28206643
Dlk1	Rat	sunitinib	decreases expression	ISO	RGD:732542	6480464	Sunitinib results in decreased expression of DLK1 mRNA	CTD	PMID:31533062
Dlk1	Rat	tetrachloromethane	multiple interactions	ISO	RGD:732543	6480464	[Tetrachlorodibenzodioxin co-treated with Carbon Tetrachloride] results in increased expression of DLK1 mRNA	CTD	PMID:27693115
Dlk1	Rat	thalidomide	decreases expression	ISO	RGD:732543	6480464	Thalidomide results in decreased expression of DLK1 mRNA	CTD	PMID:26217789
Dlk1	Rat	thapsigargin	decreases expression	ISO	RGD:732542	6480464	Thapsigargin results in decreased expression of DLK1 mRNA	CTD	PMID:22378314
Dlk1	Rat	titanium dioxide	decreases expression	EXP		6480464	titanium dioxide results in decreased expression of DLK1 mRNA	CTD	PMID:30012374
Dlk1	Rat	titanium dioxide	increases methylation	ISO	RGD:732543	6480464	titanium dioxide results in increased methylation of DLK1 gene	CTD	PMID:35295148
Dlk1	Rat	titanium dioxide	decreases methylation	ISO	RGD:732543	6480464	titanium dioxide results in decreased methylation of DLK1 gene; titanium dioxide results in decreased methylation more ...	CTD	PMID:35295148
Dlk1	Rat	titanium dioxide	multiple interactions	ISO	RGD:732543	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of DLK1 more ...	CTD	PMID:29950665
Dlk1	Rat	tributylstannane	decreases expression	ISO	RGD:732543	6480464	tributyltin results in decreased expression of DLK1 mRNA	CTD	PMID:23322813\|PMID:24513447
Dlk1	Rat	trichostatin A	decreases expression	ISO	RGD:732542	6480464	trichostatin A results in decreased expression of DLK1 mRNA	CTD	PMID:24935251\|PMID:26272509
Dlk1	Rat	trichostatin A	multiple interactions	ISO	RGD:732542	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Dlk1	Rat	triflumizole	decreases expression	ISO	RGD:732543	6480464	triflumizol results in decreased expression of DLK1 mRNA	CTD	PMID:23086663
Dlk1	Rat	tunicamycin	decreases expression	ISO	RGD:732542	6480464	Tunicamycin results in decreased expression of DLK1 mRNA	CTD	PMID:22378314
Dlk1	Rat	valproic acid	affects expression	ISO	RGD:732542	6480464	Valproic Acid affects the expression of DLK1 mRNA	CTD	PMID:25979313
Dlk1	Rat	valproic acid	increases methylation	ISO	RGD:732542	6480464	Valproic Acid results in increased methylation of DLK1 gene	CTD	PMID:29154799
Dlk1	Rat	valproic acid	increases expression	ISO	RGD:732543	6480464	Valproic Acid results in increased expression of DLK1 mRNA	CTD	PMID:24896083
Dlk1	Rat	valproic acid	decreases expression	ISO	RGD:732542	6480464	Valproic Acid results in decreased expression of DLK1 mRNA	CTD	PMID:23179753\|PMID:24383497\|PMID:24935251\|PMID:26272509\|PMID:28001369
Dlk1	Rat	valproic acid	multiple interactions	ISO	RGD:732542	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased more ...	CTD	PMID:27188386
Dlk1	Rat	vorinostat	multiple interactions	ISO	RGD:732542	6480464	[NOG protein co-treated with Vorinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in decreased expression more ...	CTD	PMID:27188386
Dlk1	Rat	vorinostat	decreases expression	ISO	RGD:732542	6480464	vorinostat results in decreased expression of DLK1 mRNA	CTD	PMID:26272509

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dlk1	Rat	bone mineralization	acts_upstream_of_or_within	ISO	RGD:732543	1624291	MGI:3526402 PMID:21308776	RGD	PMID:21308776
Dlk1	Rat	cell differentiation		IDA		632565		RGD
Dlk1	Rat	embryonic skeletal system development	acts_upstream_of_or_within	ISO	RGD:732543	1624291	PMID:19247431	RGD	PMID:19247431
Dlk1	Rat	multicellular organism growth	acts_upstream_of_or_within	ISO	RGD:732543	1624291	MGI:3526402 PMID:21308776	RGD	PMID:21308776
Dlk1	Rat	negative regulation of fat cell differentiation	involved_in	ISO	RGD:732543	1624291	PMID:8500166	RGD	PMID:8500166
Dlk1	Rat	negative regulation of Notch signaling pathway	involved_in	ISO	RGD:732542	1624291	PMID:25093684	RGD	PMID:25093684
Dlk1	Rat	negative regulation of Notch signaling pathway	acts_upstream_of_or_within	ISO	RGD:732543	1624291	MGI:97363 PMID:21419176	RGD	PMID:21419176
Dlk1	Rat	negative regulation of Notch signaling pathway	involved_in	IBA	MGI:94900\|PANTHER:PTN000710016\|UniProtKB:P80370	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Dlk1	Rat	negative regulation of Notch signaling pathway	involved_in	IEA	UniProtKB:P80370\|ensembl:ENSP00000340292	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dlk1	Rat	negative regulation of vascular endothelial cell proliferation	involved_in	ISO	RGD:732543	1624291	PMID:24584117	RGD	PMID:24584117
Dlk1	Rat	ossification	acts_upstream_of_or_within	ISO	RGD:732543	1624291	MGI:3526402 PMID:21308776	RGD	PMID:21308776
Dlk1	Rat	osteoblast differentiation	acts_upstream_of_or_within	ISO	RGD:732543	1624291	MGI:3526402 PMID:21308776	RGD	PMID:21308776
Dlk1	Rat	positive regulation of bone resorption	acts_upstream_of_or_within	ISO	RGD:732543	1624291	MGI:3526402 PMID:21308776	RGD	PMID:21308776
Dlk1	Rat	positive regulation of cytokine production	acts_upstream_of_or_within	ISO	RGD:732543	1624291	PMID:21308776	RGD	PMID:21308776
Dlk1	Rat	post-embryonic development	acts_upstream_of_or_within	ISO	RGD:732543	1624291	PMID:19247431	RGD	PMID:19247431
Dlk1	Rat	regulation of gene expression	acts_upstream_of_or_within	ISO	RGD:732543	1624291	PMID:19515692	RGD	PMID:19515692

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dlk1	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Dlk1	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dlk1	Rat	external side of plasma membrane	located_in	ISO	RGD:732543	1624291	PMID:18988804	RGD	PMID:18988804
Dlk1	Rat	extracellular space	located_in	ISO	RGD:732542	1624291	PMID:25093684, PMID:7925474	RGD	PMID:25093684\|PMID:7925474
Dlk1	Rat	extracellular space	located_in	IEA	UniProtKB:P80370\|ensembl:ENSP00000340292	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Dlk1	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Dlk1	Rat	membrane	located_in	IEA	UniProtKB-SubCell:SL-0162	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Dlk1	Rat	membrane	is_active_in	IBA	MGI:1920432\|MGI:94900\|PANTHER:PTN004653888	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dlk1	Rat	calcium ion binding	enables	IEA	InterPro:IPR001881	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Dlk1	Rat	protein binding	enables	ISO	RGD:732542	1624291	UniProtKB:P28799-2\|UniProtKB:Q7Z699 PMID:32814053	RGD	PMID:32814053
Dlk1	Rat	protein binding	enables	ISO	RGD:732543	1624291	PR:Q6PHU5 PMID:24928897	RGD	PMID:24928897
Dlk1	Rat	protein binding	enables	IPI	UniProtKB:Q498M5	13673844	PMID:22128169	UniProt

Molecular Pathway Annotations Click to see Annotation Detail View

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dlk1	Rat	p38 MAPK signaling pathway		ISO	RGD:732542	7240533		RGD

Imported Annotations - PID (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Dlk1	Rat	forkhead class A signaling pathway		ISO	RGD:732542	6484113		PID	PID:200087
Dlk1	Rat	Notch signaling pathway		ISO	RGD:732542	6484113		PID	PID:200015

Disease Annotations Click to see Annotation Detail View

biliary atresia (ISO)

central precocious puberty (ISO)

Experimental Autoimmune Encephalomyelitis (ISO)

Fetal Growth Retardation (ISO)

genetic disease (ISO)

hepatocellular carcinoma (ISO)

high grade glioma (ISO)

Kagami-Ogata syndrome (ISO)

myelodysplastic syndrome (ISO)

Silver-Russell Syndrome 1 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1,4-bis(2-ethylhexyl) sulfosuccinate (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-acetamidofluorene (EXP)

2-amino-2-deoxy-D-glucopyranose 6-phosphate (ISO)

2-methylcholine (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

5-azacytidine (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

aldehydo-D-glucosamine 6-phosphate (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenous acid (ISO)

atrazine (ISO)

Azoxymethane (ISO)

baicalein (ISO)

benzalkonium chloride (ISO)

benzo[a]pyrene (ISO)

benzo[e]pyrene (ISO)

bezafibrate (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Bisphenol A diglycidyl ether (ISO)

bisphenol F (ISO)

bleomycin A2 (ISO)

carbamazepine (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

cobalt atom (ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

D-glucose (ISO)

dexamethasone (EXP,ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

diethylstilbestrol (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

ethanol (ISO)

fipronil (EXP)

flavonoids (EXP)

folic acid (ISO)

fructose (ISO)

genistein (ISO)

glucose (ISO)

glycidol (EXP)

glyphosate (ISO)

herbicide (ISO)

hydrogen peroxide (ISO)

indometacin (ISO)

inulin (ISO)

ketoconazole (EXP)

lead(0) (ISO)

lipopolysaccharide (ISO)

manganese(II) chloride (ISO)

methapyrilene (ISO)

methylmercury chloride (ISO)

monosodium L-glutamate (EXP)

N-methyl-4-phenylpyridinium (ISO)

panobinostat (ISO)

paraquat (EXP)

pentanal (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenylmercury acetate (ISO)

phorbol 13-acetate 12-myristate (ISO)

prednisone (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

resveratrol (ISO)

rotenone (ISO)

sarin (ISO)

SB 431542 (ISO)

silibinin (ISO)

silicon dioxide (EXP,ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tetrachloromethane (ISO)

thalidomide (ISO)

thapsigargin (ISO)

titanium dioxide (EXP,ISO)

tributylstannane (ISO)

trichostatin A (ISO)

triflumizole (ISO)

tunicamycin (ISO)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

bone mineralization (ISO)

cell differentiation (IDA)

embryonic skeletal system development (ISO)

multicellular organism growth (ISO)

negative regulation of fat cell differentiation (ISO)

negative regulation of Notch signaling pathway (IBA,IEA,ISO)

negative regulation of vascular endothelial cell proliferation (ISO)

ossification (ISO)

osteoblast differentiation (ISO)

positive regulation of bone resorption (ISO)

positive regulation of cytokine production (ISO)

post-embryonic development (ISO)

regulation of gene expression (ISO)

Cellular Component

cytoplasm (IEA)

external side of plasma membrane (ISO)

extracellular space (IEA,ISO)

membrane (IBA,IEA)

Molecular Function

calcium ion binding (IEA)

protein binding (IPI,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

forkhead class A signaling pathway (ISO)

Notch signaling pathway (ISO)

p38 MAPK signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Growth hormone and prolactin stimulate the expression of rat preadipocyte factor-1/delta-like protein in pancreatic islets: molecular cloning and expression pattern during development and growth of the endocrine pancreas.	Carlsson C, etal., Endocrinology 1997 Sep;138(9):3940-8.
2.	Mechanisms and functions of p38 MAPK signalling.	Cuadrado A and Nebreda AR, Biochem J. 2010 Aug 1;429(3):403-17. doi: 10.1042/BJ20100323.
3.	Hepatocyte-Specific Arid1a Deficiency Initiates Mouse Steatohepatitis and Hepatocellular Carcinoma.	Fang JZ, etal., PLoS One. 2015 Nov 16;10(11):e0143042. doi: 10.1371/journal.pone.0143042. eCollection 2015.
4.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
5.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
6.	Cloning of a membrane-spanning protein with epidermal growth factor-like repeat motifs from adrenal glomerulosa cells.	Halder SK, etal., Endocrinology 1998 Jul;139(7):3316-28.
7.	The human Delta-like 1 homologue is implicated in the progression of liver fibrosis in biliary atresia.	Huang CC, etal., J Pathol. 2004 Feb;202(2):172-9.
8.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
9.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
11.	GOA pipeline	RGD automated data pipeline
12.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Comprehensive gene review and curation	RGD comprehensive gene curation
15.	Parent-of-origin effects implicate epigenetic regulation of experimental autoimmune encephalomyelitis and identify imprinted Dlk1 as a novel risk gene.	Stridh P, etal., PLoS Genet. 2014 Mar 27;10(3):e1004265. doi: 10.1371/journal.pgen.1004265. eCollection 2014 Mar.
16.	Sh3rf2/POSHER protein promotes cell survival by ring-mediated proteasomal degradation of the c-Jun N-terminal kinase scaffold POSH (Plenty of SH3s) protein.	Wilhelm M, etal., J Biol Chem. 2012 Jan 13;287(3):2247-56. doi: 10.1074/jbc.M111.269431. Epub 2011 Nov 28.
17.	DLK1: increased expression in gliomas and associated with oncogenic activities.	Yin D, etal., Oncogene. 2006 Mar 23;25(13):1852-61.

Additional References at PubMed

PMID:7925474	PMID:8500166	PMID:12477932	PMID:12655782	PMID:18751720	PMID:18988804	PMID:19084046	PMID:19247431	PMID:19515692	PMID:19661059	PMID:21308776	PMID:21419176
PMID:22298767	PMID:23387476	PMID:24584117	PMID:24913911	PMID:25093684	PMID:25268256	PMID:25342302	PMID:25723595	PMID:27044861	PMID:29453913	PMID:30145985	PMID:31091532
PMID:33472171	PMID:35050550

Genomics

Comparative Map Data

Dlk1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	134,192,491 - 134,199,779 (+)	NCBI		GRCr8
mRatBN7.2	6	128,410,216 - 128,417,518 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	128,410,316 - 128,417,522 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	128,550,763 - 128,557,963 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	6	128,846,606 - 128,853,806 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	6	128,207,854 - 128,215,027 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	6	133,576,513 - 133,583,751 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	133,552,821 - 133,583,751 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	142,742,149 - 142,749,166 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	6	134,022,016 - 134,043,058 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	6	134,028,202 - 134,035,262 (+)	NCBI
Celera	6	125,960,411 - 125,967,475 (+)	NCBI		Celera
Cytogenetic Map	6	q32	NCBI

DLK1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	100,726,892 - 100,738,224 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	100,725,705 - 100,738,224 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	101,193,229 - 101,204,561 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	100,263,006 - 100,271,213 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	100,263,005 - 100,271,210	NCBI
Celera	14	81,247,286 - 81,255,551 (+)	NCBI		Celera
Cytogenetic Map	14	q32.2	NCBI
HuRef	14	81,373,717 - 81,381,968 (+)	NCBI		HuRef
CHM1_1	14	101,130,974 - 101,139,248 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	94,961,805 - 94,973,139 (+)	NCBI		T2T-CHM13v2.0

Dlk1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	109,418,411 - 109,429,262 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	109,418,749 - 109,429,262 (+)	Ensembl		GRCm39 Ensembl
GRCm38	12	109,452,485 - 109,463,336 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	109,452,823 - 109,463,336 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	110,691,033 - 110,701,546 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	109,901,030 - 109,908,498 (+)	NCBI		MGSCv36	mm8
Celera	12	110,648,411 - 110,658,915 (+)	NCBI		Celera
Cytogenetic Map	12	F1	NCBI
cM Map	12	60.17	NCBI

Dlk1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955627	38,128 - 43,728 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955627	37,886 - 43,730 (-)	NCBI	ChiLan1.0	ChiLan1.0

DLK1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	101,879,300 - 101,887,554 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	101,095,796 - 101,104,047 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	81,348,380 - 81,356,607 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	100,654,965 - 100,668,020 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	100,654,965 - 100,668,019 (+)	Ensembl	panpan1.1		panPan2

DLK1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	68,961,975 - 68,970,106 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	68,961,744 - 68,972,761 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	68,479,790 - 68,487,872 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	69,245,619 - 69,253,709 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	69,245,491 - 69,256,384 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	68,906,950 - 68,915,034 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	68,973,041 - 68,981,107 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	69,370,948 - 69,379,035 (+)	NCBI		UU_Cfam_GSD_1.0

Dlk1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	5,567,786 - 5,578,803 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936604	4,504,503 - 4,511,910 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936604	4,504,519 - 4,511,897 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DLK1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	121,565,854 - 121,576,654 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	121,565,844 - 121,577,493 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	132,339,547 - 132,345,907 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DLK1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	78,687,542 - 78,695,782 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	78,687,668 - 78,695,607 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666053	65,824,853 - 65,833,295 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Dlk1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624734	3,363,001 - 3,372,694 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624734	3,363,084 - 3,372,790 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Dlk1
18 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	81
Count of miRNA genes:	59
Interacting mature miRNAs:	63
Transcripts:	ENSRNOT00000006339
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12801411	Schws8	Schwannoma susceptibility QTL 8			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	94968928	139968928	Rat
1331797	Bp213	Blood pressure QTL 213	3.291		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	104085867	128713626	Rat
1331799	Bp211	Blood pressure QTL 211	3.66407		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	72202632	130919985	Rat
71111	Iddm8	Insulin dependent diabetes mellitus QTL 8	1.9	0.002	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	6	105156861	140994061	Rat
1358355	Srcrt4	Stress Responsive Cort QTL 4	6.39		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	100364669	140994061	Rat
61329	Eae9	Experimental allergic encephalomyelitis QTL 9	3.7		body mass (VT:0001259)	change in body weight (CMO:0002045)	6	122549046	140994061	Rat
2312560	Pur20	Proteinuria QTL 20	2.1	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	125628133	137801795	Rat
2313399	Anxrr28	Anxiety related response QTL 28			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	6	100671796	132340886	Rat
1331725	Bp212	Blood pressure QTL 212	3.52475		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	6	93701310	128713626	Rat
8552796	Vie3	Viral induced encephalitis QTL 3	2.6		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	6	96833997	140994061	Rat
4145118	Mcs26	Mammary carcinoma susceptibility QTL 26		0.0001	mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	6	106752656	132339866	Rat
1581563	Uae33	Urinary albumin excretion QTL 33			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	72227641	130729205	Rat
10054138	Gmadr3	Adrenal mass QTL 3	3.68	0.00045	adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	6	85140138	130140138	Rat
1641917	Colcr5	Colorectal carcinoma resistance QTL 5	3.18	0.0009	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	6	122549046	137801795	Rat
61414	Pia3	Pristane induced arthritis QTL 3	4.5		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	6	94968928	137848904	Rat
724513	Uae14	Urinary albumin excretion QTL 14	6.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	85311061	133478515	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	88047916	133047916	Rat
731173	Uae22	Urinary albumin excretion QTL 22	10.1		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
10054123	Srcrt6	Stress Responsive Cort QTL 6	2.5	0.0043	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	85140138	130140138	Rat
724536	Uae7	Urinary albumin excretion QTL 7	3.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	72202632	130729475	Rat
737976	Pia24	Pristane induced arthritis QTL 24			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	6	112636280	140994061	Rat
1298087	Iddm18	Insulin dependent diabetes mellitus QTL 18		0.0001	urine glucose amount (VT:0001758)	percentage of study population developing diabetes mellitus during a period of time (CMO:0001114)	6	116506292	130245370	Rat
1581550	Pur8	Proteinuria QTL 8			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	72227641	130729205	Rat
738034	Anxrr5	Anxiety related response QTL 5	5.9		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	6	84130881	129130881	Rat
2290393	Uae37	Urinary albumin excretion QTL 37		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
1300076	Glom8	Glomerulus QTL 8	7	9e-09	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	6	86894788	131894788	Rat
2293085	Iddm29	Insulin dependent diabetes mellitus QTL 29	7.66		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	6	122549046	140286318	Rat

Markers in Region

BE115497

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	128,417,114 - 128,417,264 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	133,583,346 - 133,583,495	NCBI	Rnor6.0
Rnor_5.0	6	142,748,927 - 142,749,076	UniSTS	Rnor5.0
RGSC_v3.4	6	134,028,833 - 134,028,982	UniSTS	RGSC3.4
Celera	6	125,967,189 - 125,967,338	UniSTS
RH 3.4 Map	6	791.5	UniSTS
Cytogenetic Map	6	q32	UniSTS

UniSTS:259449

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	128,416,706 - 128,417,270 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	133,582,938 - 133,583,501	NCBI	Rnor6.0
Rnor_5.0	6	142,748,519 - 142,749,082	UniSTS	Rnor5.0
RGSC_v3.4	6	134,028,425 - 134,028,988	UniSTS	RGSC3.4
Celera	6	125,966,781 - 125,967,344	UniSTS
Cytogenetic Map	6	q32	UniSTS

Dlk1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	128,416,794 - 128,417,010 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	133,583,026 - 133,583,241	NCBI	Rnor6.0
Rnor_5.0	6	142,748,607 - 142,748,822	UniSTS	Rnor5.0
RGSC_v3.4	6	134,028,513 - 134,028,728	UniSTS	RGSC3.4
Celera	6	125,966,869 - 125,967,084	UniSTS
Cytogenetic Map	6	q32	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	48	113	85	84	53	24	53	6	204	95	93	39	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053744	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008764917	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063261397	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB046763	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC167752	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D84336	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U25680	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000006339 ⟹ ENSRNOP00000006339

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	128,410,969 - 128,417,522 (+)	Ensembl
Rnor_6.0 Ensembl	6	133,552,821 - 133,583,498 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000085933 ⟹ ENSRNOP00000069391

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	128,410,316 - 128,417,522 (+)	Ensembl
Rnor_6.0 Ensembl	6	133,576,568 - 133,583,751 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000107076 ⟹ ENSRNOP00000086145

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	128,410,316 - 128,417,267 (+)	Ensembl

RefSeq Acc Id:

NM_053744 ⟹ NP_446196

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	134,192,597 - 134,199,779 (+)	NCBI
mRatBN7.2	6	128,410,335 - 128,417,518 (+)	NCBI
Rnor_6.0	6	133,576,568 - 133,583,751 (+)	NCBI
Rnor_5.0	6	142,742,149 - 142,749,166 (+)	NCBI
RGSC_v3.4	6	134,022,016 - 134,043,058 (+)	RGD
Celera	6	125,960,411 - 125,967,475 (+)	NCBI

Sequence:

show sequence

CCCGGTGCAACCCTGGCTTTCTTTCCGCTGGACACCCGTGCCCCCTTCGTGGTCCGCAACCAGA
AGCCCAGCGCAGCCCCGGAGCAGCCCCTGCACCGCCACCGCTACCCGGACCACGACCCAGGCCG
CCCCGAGATGATCGCGACCGGAGCCCTCCTGCGCGTCCTCTTGCTCCTGCTGGCTTTCGGCCAC
AGCACCTATGGGGCTGAGTGCGACCCGGCCTGTGACCCTCAGCATGGATTCTGTGAGGCTGACA
ATGTCTGCAGGTGTGAGCCTGGCTGGGAGGGCCCCCTGTGTGAGAAGTGCGTAACCTCCCCTGG
CTGTGTTAATGGACTCTGTGAAGAACCATGGCAGTGTGTCTGCAAGGAAGGCTGGGACGGGAAA
TTCTGCGAAATAGATATTCGGGCTTGCACCTCTACCCCCTGCGCCAACAATGGGACTTGCGTGG
ACCTCGAGAAAGGCCAGTACGAATGCTCCTGCACCCCTGGATTCTCTGGAAAGGACTGTCAGCA
CAAGGCTGGGCCCTGCGTGATCAATGGTTCTCCCTGCCAGCACGGAGGCGCCTGCGTGGATGAT
GAGGGCCGGGCCTCGCATGCTTCCTGCCTGTGCCCCCCTGGCTTCTCGGGCAACTTCTGTGAGA
TCGTGACCAACAGCTGTACCCCTAACCCATGCGAGAACGATGGCGTCTGCACCGACATCGGGGG
CGACTTCCGTTGCCGCTGCCCAGCTGGATTCGTCGACAAGACCTGCAGCCGTCCGGTGAGCAAC
TGCGCCAGTGGCCCGTGCCTGAACGGGGGCACCTGCCTCCAGCACACCCAGGTGAGCTTCGAGT
GTCTGTGCAAGCCCCCGTTCATGGGTCCCACATGCGCGAAGAAGCGCGGGACCAGCCCCGTGCA
GGTCACCCACCTACCCAGCGGCTACGGGCTCACCTACCGCCTGACCCCCGGGGTGCACGAGCTA
CCTGTCCAGCAGCCCGAGCACCACATCCTGAAGGTGTCCATGAAAGAGCTCAACAAGAGTGCCC
CTCTCCTCACCGAGGGACAGGCCATCTGCTTCACCATCCTGGGCGTGCTCACCAGCCTGGTTGT
GCTGGGCACCGTGGCCATCGTCTTTCTCAACAAGTGCGAGGCCTGGGTGTCCAACCTGCGCTAC
AACCACATGCTTCGCAAGAAGAAGAACCTGCTGTTGCAGTACAACAGCGGCGAGGAGCTGGCGG
TCAATATCATCTTCCCGGAGAAGATCGACATGACCACCTTCAACAAGGAGGCTGGTGATGAGGA
TATCTAAGCAGCGTGTCCCCTCCCCCTCCCCCAGGCCCTTCTACATTATCGGGGTTCCTCACAG
CTCCCTCTATGCGCTCTATGCTTCTTTGTGGTGGAGTTCGCTCTTGTGTGGAATCTAGTGAACG
CTACGCTTACATTTATTTTCTCGTGTTGCTGTGTGACAAGCTGCCGCTAAGAACCCCTCCCTCC
CTCCCTCCCTCCCTCCCTATTAATGCATGATATAATGAATAATAATAAGAATTTCATCTCTAAA
TG

hide sequence

RefSeq Acc Id:

XM_008764917 ⟹ XP_008763139

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	134,192,491 - 134,199,777 (+)	NCBI
mRatBN7.2	6	128,410,216 - 128,417,397 (+)	NCBI
Rnor_6.0	6	133,576,513 - 133,583,742 (+)	NCBI

Sequence:

show sequence

GCGGCGCGCGGGCCGCAGCGGCAGCTCCTCGGCAGCCGCACTTAGTAGCGTGCGCCCCGGTGCA
ACCCTGGCTTTCTTTCCGCTGGACACCCGTGCCCCCTTCGTGGTCCGCAACCAGAAGCCCAGCG
CAGCCCCCGGAGCAGCCCCTGCACCGCCACCGCTACCCGGACCACGACCCAGGCCGCCCCGAGA
TGATCGCGACCGGAGCCCTCCTGCGCGTCCTCTTGCTCCTGCTGGCTTTCGGCCACAGCACCTA
TGGGGCTGAGTGCGACCCGGCCTGTGACCCTCAGCATGGATTCTGTGAGGCTGACAATGTCTGC
AGGTGTGAGCCTGGCTGGGAGGGCCCCCTGTGTGAGAAGTGCGTAACCTCCCCTGGCTGTGTTA
ATGGACTCTGTGAAGAACCATGGCAGTGTGTCTGCAAGGAAGGCTGGGACGGGAAATTCTGCGA
AATAGATATTCGGGCTTGCACCTCTACCCCCTGCGCCAACAATGGGACTTGCGTGGACCTCGAG
AAAGGCCAGTACGAATGCTCCTGCACCCCTGGATTCTCTGGAAAGGACTGTCAGCACAAGGCTG
GGCCCTGCGTGATCAATGGTTCTCCCTGCCAGCACGGAGGCGCCTGCGTGGATGATGAGGGCCG
GGCCTCGCATGCTTCCTGCCTGTGCCCCCCTGGCTTCTCGGGCAACTTCTGTGAGATCGTGACC
AACAGCTGTACCCCTAACCCATGCGAGAACGATGGCGTCTGCACCGACATCGGGGGCGACTTCC
GTTGCCGCTGCCCAGCTGGATTCGTCGACAAGACCTGCAGCCGTCCGGTGAGCAACTGCGCCAG
TGGCCCGTGCCTGAACGGGGGCACCTGCCTCCAGCACACCCAGCCCGAGCACCACATCCTGAAG
GTGTCCATGAAAGAGCTCAACAAGAGTGCCCCTCTCCTCACCGAGGGACAGGCCATCTGCTTCA
CCATCCTGGGCGTGCTCACCAGCCTGGTTGTGCTGGGCACCGTGGCCATCGTCTTTCTCAACAA
GTGCGAGGCCTGGGTGTCCAACCTGCGCTACAACCACATGCTTCGCAAGAAGAAGAACCTGCTG
TTGCAGTACAACAGCGGCGAGGAGCTGGCGGTCAATATCATCTTCCCGGAGAAGATCGACATGA
CCACCTTCAACAAGGAGGCTGGTGATGAGGATATCTAAGCAGCGTGTCCCCTCCCCCTCCCCCA
GGCCCTTCTACATTATCGGGGTTCCTCACAGCTCCCTCTATGCGCTCTATGCTTCTTTGTGGGT
GGATTCGCTCATTGTGTGGATCTAGTGAACGCTAGCTTACATTTATTGTCTCGTGTTGCTGTGT
GACAAGCTTGCCGCTAAGAACCCCTCCGCCTCCCTCCCTCCCTCCTCCTATTAATCGCATAGAT
ATTAATGGAATAATAATAAGATTTCA

hide sequence

RefSeq Acc Id:

XM_063261397 ⟹ XP_063117467

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	134,192,503 - 134,199,777 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_446196	(Get FASTA)	NCBI Sequence Viewer
	XP_008763139	(Get FASTA)	NCBI Sequence Viewer
	XP_063117467	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB87095	(Get FASTA)	NCBI Sequence Viewer
	AAI67752	(Get FASTA)	NCBI Sequence Viewer
	BAA25881	(Get FASTA)	NCBI Sequence Viewer
	BAB12399	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000006339
	ENSRNOP00000069391.1
	ENSRNOP00000086145
GenBank Protein	O70534	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_446196 ⟸ NM_053744
- Peptide Label:	precursor
- UniProtKB:	Q62779 (UniProtKB/Swiss-Prot), O70534 (UniProtKB/TrEMBL), A6KBJ4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MIATGALLRVLLLLLAFGHSTYGAECDPACDPQHGFCEADNVCRCEPGWEGPLCEKCVTSPGCV NGLCEEPWQCVCKEGWDGKFCEIDIRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKA GPCVINGSPCQHGGACVDDEGRASHASCLCPPGFSGNFCEIVTNSCTPNPCENDGVCTDIGGDF RCRCPAGFVDKTCSRPVSNCASGPCLNGGTCLQHTQVSFECLCKPPFMGPTCAKKRGTSPVQVT HLPSGYGLTYRLTPGVHELPVQQPEHHILKVSMKELNKSAPLLTEGQAICFTILGVLTSLVVLG TVAIVFLNKCEAWVSNLRYNHMLRKKKNLLLQYNSGEELAVNIIFPEKIDMTTFNKEAGDEDI hide sequence

RefSeq Acc Id:	XP_008763139 ⟸ XM_008764917
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6GDQ5 (UniProtKB/TrEMBL), A6KBJ4 (UniProtKB/TrEMBL)
- Sequence:	show sequence MIATGALLRVLLLLLAFGHSTYGAECDPACDPQHGFCEADNVCRCEPGWEGPLCEKCVTSPGCV NGLCEEPWQCVCKEGWDGKFCEIDIRACTSTPCANNGTCVDLEKGQYECSCTPGFSGKDCQHKA GPCVINGSPCQHGGACVDDEGRASHASCLCPPGFSGNFCEIVTNSCTPNPCENDGVCTDIGGDF RCRCPAGFVDKTCSRPVSNCASGPCLNGGTCLQHTQPEHHILKVSMKELNKSAPLLTEGQAICF TILGVLTSLVVLGTVAIVFLNKCEAWVSNLRYNHMLRKKKNLLLQYNSGEELAVNIIFPEKIDM TTFNKEAGDEDI hide sequence

Ensembl Acc Id:

ENSRNOP00000006339 ⟸ ENSRNOT00000006339

Ensembl Acc Id:

ENSRNOP00000069391 ⟸ ENSRNOT00000085933

Ensembl Acc Id:

ENSRNOP00000086145 ⟸ ENSRNOT00000107076

RefSeq Acc Id:	XP_063117467 ⟸ XM_063261397
- Peptide Label:	isoform X2
- UniProtKB:	A6KBJ4 (UniProtKB/TrEMBL)

Protein Domains

EGF-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O70534-F1-model_v2	AlphaFold	O70534	1-383	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694825

Promoter ID:

EPDNEW_R5349

Type:

single initiation site

Name:

Dlk1_1

Description:

delta like non-canonical Notch ligand 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	133,576,535 - 133,576,595	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619931	AgrOrtholog
BioCyc Gene	G2FUF-36264	BioCyc
Ensembl Genes	ENSRNOG00000019584	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000006339	ENTREZGENE
	ENSRNOT00000085933.2	UniProtKB/Swiss-Prot
	ENSRNOT00000107076	ENTREZGENE
Gene3D-CATH	Laminin	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:8365650	IMAGE-MGC_LOAD
InterPro	EGF-like_Ca-bd_dom	UniProtKB/Swiss-Prot
	EGF-like_CS	UniProtKB/Swiss-Prot
	EGF-like_dom	UniProtKB/Swiss-Prot
	EGF-type_Asp/Asn_hydroxyl_site	UniProtKB/Swiss-Prot
	Notch_Cell-Fate_Det	UniProtKB/Swiss-Prot
KEGG Report	rno:114587	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:187346	IMAGE-MGC_LOAD
NCBI Gene	114587	ENTREZGENE
PANTHER	CRUMBS FAMILY MEMBER	UniProtKB/Swiss-Prot
	DELTA LIKE NON-CANONICAL NOTCH LIGAND 1	UniProtKB/Swiss-Prot
Pfam	DL-JAG_EGF-like	UniProtKB/Swiss-Prot
	EGF	UniProtKB/Swiss-Prot
	hEGF	UniProtKB/Swiss-Prot
PhenoGen	Dlk1	PhenoGen
PRINTS	EGFBLOOD	UniProtKB/Swiss-Prot
PROSITE	ASX_HYDROXYL	UniProtKB/Swiss-Prot
	EGF_1	UniProtKB/Swiss-Prot
	EGF_2	UniProtKB/Swiss-Prot
	EGF_3	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000019584	RatGTEx
SMART	EGF	UniProtKB/Swiss-Prot
	EGF_CA	UniProtKB/Swiss-Prot
Superfamily-SCOP	EGF/Laminin	UniProtKB/Swiss-Prot
UniProt	A0A8I6GDQ5	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2Q3B5_RAT	UniProtKB/TrEMBL
	A6KBJ4	ENTREZGENE, UniProtKB/TrEMBL
	DLK1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q62779	ENTREZGENE
UniProt Secondary	Q62779	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-05-20	Dlk1	delta like non-canonical Notch ligand 1	Dlk1	delta-like 1 homolog (Drosophila)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Dlk1	delta-like 1 homolog (Drosophila)		delta-like homolog (Drosophila)	Name updated	1299863	APPROVED
2002-08-07	Dlk1	delta-like homolog (Drosophila)			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_process	involved in both differentiation and growth of beta-cells	632566

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - PID (archival)