Advanced Search (OLGA)

Gene: Pex11a (peroxisomal biogenesis factor 11 alpha) Rattus norvegicus

Analyze

Symbol:

Pex11a

Name:

peroxisomal biogenesis factor 11 alpha

RGD ID:

619842

Description:

Predicted to enable protein homodimerization activity. Involved in peroxisome membrane biogenesis. Located in peroxisomal membrane. Orthologous to human PEX11A (peroxisomal biogenesis factor 11 alpha); INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

28 kDa peroxisomal integral membrane protein; peroxin-11A; peroxisomal biogenesis factor 11A; peroxisomal coatomer receptor; peroxisomal membrane protein 11A; peroxisomal membrane protein 26; peroxisomal membrane protein Pmp26p (Peroxin-11); PEX11-alpha; PEX11alpha; pex11palpha; Pmp26p; PMP28; protein PEX11 homolog alpha; rnPEX11p

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PEX11A (peroxisomal biogenesis factor 11 alpha)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Pex11a (peroxisomal biogenesis factor 11 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pex11a (peroxisomal biogenesis factor 11 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PEX11A (peroxisomal biogenesis factor 11 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PEX11A (peroxisomal biogenesis factor 11 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pex11a (peroxisomal biogenesis factor 11 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PEX11A (peroxisomal biogenesis factor 11 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PEX11A (peroxisomal biogenesis factor 11 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pex11a (peroxisomal biogenesis factor 11 alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ELOB (elongin B)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Pex11a (peroxisomal biogenesis factor 11 alpha)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PEX11A (peroxisomal biogenesis factor 11 alpha)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pex11a (peroxisomal biogenesis factor 11 alpha)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PEX11	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Pex11	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pex11a	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	143,089,410 - 143,096,491 (-)	NCBI		GRCr8
mRatBN7.2	1	133,680,091 - 133,687,172 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	133,680,091 - 133,687,172 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	141,589,549 - 141,596,507 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	148,758,938 - 148,765,910 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	141,676,644 - 141,683,616 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	141,474,189 - 141,481,270 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	141,474,180 - 141,481,315 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	142,435,410 - 142,442,491 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	135,513,735 - 135,520,816 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	135,593,304 - 135,685,129 (-)	NCBI
Celera	1	125,743,709 - 125,750,790 (-)	NCBI		Celera
Cytogenetic Map	1	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pex11a	Rat	Bloom syndrome		ISO	RGD:1348303	8554872	ClinVar Annotator: match by term: Bloom syndrome	ClinVar	PMID:17407155\|PMID:28492532
Pex11a	Rat	colorectal cancer		ISO	RGD:1348303	8554872	ClinVar Annotator: match by term: Familial colorectal cancer	ClinVar	PMID:28492532
Pex11a	Rat	D-2-hydroxyglutaric aciduria 2		ISO	RGD:1348303	8554872	ClinVar Annotator: match by term: D-2-hydroxyglutaric aciduria 2	ClinVar	PMID:17407155\|PMID:28492532

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pex11a	Rat	Chemical and Drug Induced Liver Injury		ISO	RGD:1348303	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:25226513
Pex11a	Rat	Dyslipidemias		ISO	RGD:1348303	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:30585412
Pex11a	Rat	obesity		ISO	RGD:1348303	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:30585412

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pex11a	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	RGD:731523	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PEX11A mRNA	CTD	PMID:36331819
Pex11a	Rat	1,2-dichloroethane	decreases expression	ISO	RGD:731523	6480464	ethylene dichloride results in decreased expression of PEX11A mRNA	CTD	PMID:28960355
Pex11a	Rat	1-naphthyl isothiocyanate	decreases expression	EXP		6480464	1-Naphthylisothiocyanate results in decreased expression of PEX11A mRNA	CTD	PMID:30723492
Pex11a	Rat	17beta-estradiol	multiple interactions	ISO	RGD:1348303	6480464	EGF protein inhibits the reaction [Estradiol results in increased expression of PEX11A mRNA]	CTD	PMID:24758408
Pex11a	Rat	17beta-estradiol	decreases expression	EXP		6480464	Estradiol results in decreased expression of PEX11A mRNA	CTD	PMID:35192832
Pex11a	Rat	17beta-estradiol	decreases expression	ISO	RGD:731523	6480464	Estradiol results in decreased expression of PEX11A mRNA	CTD	PMID:39298647
Pex11a	Rat	17beta-estradiol	increases expression	ISO	RGD:1348303	6480464	Estradiol results in increased expression of PEX11A mRNA	CTD	PMID:24758408
Pex11a	Rat	2,2',4,4'-Tetrabromodiphenyl ether	affects expression	ISO	RGD:731523	6480464	2,2',4,4'-tetrabromodiphenyl ether affects the expression of PEX11A mRNA	CTD	PMID:30294300
Pex11a	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:731523	6480464	Tetrachlorodibenzodioxin results in increased expression of PEX11A mRNA	CTD	PMID:17949056
Pex11a	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:731523	6480464	Tetrachlorodibenzodioxin affects the expression of PEX11A mRNA	CTD	PMID:21570461\|PMID:24680724
Pex11a	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	EXP		6480464	Tetrachlorodibenzodioxin results in increased expression of PEX11A mRNA	CTD	PMID:22808131
Pex11a	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of PEX11A mRNA	CTD	PMID:21215274\|PMID:33387578
Pex11a	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of PEX11A mRNA	CTD	PMID:22298810
Pex11a	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	EXP		6480464	AHR protein alternative form affects the reaction [Tetrachlorodibenzodioxin results in decreased expression of PEX11A mRNA]	CTD	PMID:21215274
Pex11a	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:1348303	6480464	Tetrachlorodibenzodioxin results in decreased expression of PEX11A mRNA	CTD	PMID:21296121
Pex11a	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:731523	6480464	Tetrachlorodibenzodioxin promotes the reaction [AHR protein binds to PEX11A promoter]	CTD	PMID:19654925
Pex11a	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	RGD:731523	6480464	2,2',4,4',5-brominated diphenyl ether affects the expression of PEX11A mRNA	CTD	PMID:38648751
Pex11a	Rat	2,4-dinitrotoluene	affects expression	EXP		6480464	2,4-dinitrotoluene affects the expression of PEX11A mRNA	CTD	PMID:21346803
Pex11a	Rat	3,3',4,4'-tetrachlorobiphenyl	multiple interactions	ISO	RGD:731523	6480464	3,4,3',4'-tetrachlorobiphenyl inhibits the reaction [Dietary Fats results in increased expression of PEX11A mRNA]	CTD	PMID:19467301
Pex11a	Rat	3,4-methylenedioxymethamphetamine	decreases expression	ISO	RGD:731523	6480464	N-Methyl-3,4-methylenedioxyamphetamine results in decreased expression of PEX11A mRNA	CTD	PMID:26251327
Pex11a	Rat	3,4-methylenedioxymethamphetamine	increases methylation	ISO	RGD:731523	6480464	N-Methyl-3,4-methylenedioxyamphetamine results in increased methylation of PEX11A promoter	CTD	PMID:26251327
Pex11a	Rat	3-chloropropane-1,2-diol	decreases expression	EXP		6480464	alpha-Chlorohydrin results in decreased expression of PEX11A protein	CTD	PMID:34915118
Pex11a	Rat	3-isobutyl-1-methyl-7H-xanthine	multiple interactions	ISO	RGD:1348303	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
Pex11a	Rat	4,4'-sulfonyldiphenol	decreases expression	ISO	RGD:731523	6480464	bisphenol S results in decreased expression of PEX11A mRNA	CTD	PMID:33297965\|PMID:39298647
Pex11a	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of PEX11A mRNA	CTD	PMID:24780913
Pex11a	Rat	aflatoxin B1	decreases expression	ISO	RGD:1348303	6480464	Aflatoxin B1 results in decreased expression of PEX11A mRNA	CTD	PMID:22100608
Pex11a	Rat	aflatoxin B1	increases methylation	ISO	RGD:1348303	6480464	Aflatoxin B1 results in increased methylation of PEX11A gene	CTD	PMID:27153756
Pex11a	Rat	amiodarone	increases expression	ISO	RGD:731523	6480464	Amiodarone results in increased expression of PEX11A mRNA	CTD	PMID:24489787
Pex11a	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of PEX11A mRNA	CTD	PMID:16483693
Pex11a	Rat	aspartame	multiple interactions	ISO	RGD:731523	6480464	[Fats, Unsaturated co-treated with Aspartame] affects the expression of PEX11A mRNA; [Fats, Unsaturated co-treated with more ...	CTD	PMID:23783067
Pex11a	Rat	atrazine	decreases expression	ISO	RGD:1348303	6480464	Atrazine results in decreased expression of PEX11A mRNA	CTD	PMID:22378314
Pex11a	Rat	benzo[a]pyrene	increases expression	ISO	RGD:731523	6480464	Benzo(a)pyrene results in increased expression of PEX11A mRNA	CTD	PMID:21569818
Pex11a	Rat	beta-naphthoflavone	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of PEX11A mRNA	CTD	PMID:18164116
Pex11a	Rat	bexarotene	multiple interactions	EXP		6480464	[bexarotene co-treated with Tamoxifen] results in increased expression of PEX11A mRNA	CTD	PMID:17630414
Pex11a	Rat	bis(2-ethylhexyl) phthalate	multiple interactions	ISO	RGD:731523	6480464	PPARA protein promotes the reaction [Diethylhexyl Phthalate results in increased expression of PEX11A mRNA]	CTD	PMID:19850644
Pex11a	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	RGD:731523	6480464	Diethylhexyl Phthalate results in increased expression of PEX11A mRNA	CTD	PMID:19245819\|PMID:19850644
Pex11a	Rat	bisphenol A	decreases expression	ISO	RGD:1348303	6480464	bisphenol A results in decreased expression of PEX11A mRNA	CTD	PMID:22576693
Pex11a	Rat	bisphenol A	multiple interactions	ISO	RGD:1348303	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
Pex11a	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of PEX11A mRNA	CTD	PMID:25181051\|PMID:32145629\|PMID:34947998\|PMID:35192832
Pex11a	Rat	bisphenol A	increases methylation	ISO	RGD:1348303	6480464	bisphenol A results in increased methylation of PEX11A gene	CTD	PMID:22576693
Pex11a	Rat	bromobenzene	increases expression	EXP		6480464	bromobenzene results in increased expression of PEX11A mRNA	CTD	PMID:32479839
Pex11a	Rat	buspirone	increases expression	EXP		6480464	Buspirone results in increased expression of PEX11A mRNA	CTD	PMID:24136188
Pex11a	Rat	buta-1,3-diene	increases expression	ISO	RGD:731523	6480464	1,3-butadiene results in increased expression of PEX11A mRNA	CTD	PMID:29038090
Pex11a	Rat	carbon nanotube	increases expression	ISO	RGD:731523	6480464	Nanotubes, Carbon analog results in increased expression of PEX11A mRNA; Nanotubes, Carbon results in increased more ...	CTD	PMID:25620056
Pex11a	Rat	chloroprene	increases expression	ISO	RGD:731523	6480464	Chloroprene results in increased expression of PEX11A mRNA	CTD	PMID:23125180
Pex11a	Rat	ciguatoxin CTX1B	affects expression	ISO	RGD:731523	6480464	Ciguatoxins affects the expression of PEX11A mRNA	CTD	PMID:18353800
Pex11a	Rat	ciprofibrate	increases expression	ISO	RGD:731523	6480464	ciprofibrate results in increased expression of PEX11A mRNA	CTD	PMID:12771043
Pex11a	Rat	clofibrate	increases expression	EXP		6480464	Clofibrate results in increased expression of PEX11A mRNA	CTD	PMID:18246545\|PMID:27665778\|PMID:32741897
Pex11a	Rat	clofibrate	increases expression	ISO	RGD:731523	6480464	Clofibrate results in increased expression of PEX11A mRNA	CTD	PMID:17585979\|PMID:25270620\|PMID:30629241
Pex11a	Rat	clofibrate	multiple interactions	ISO	RGD:731523	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of PEX11A mRNA; PPARA affects the reaction [[Clofibrate more ...	CTD	PMID:17585979
Pex11a	Rat	clofibric acid	affects expression	EXP		6480464	Clofibric Acid affects the expression of PEX11A mRNA	CTD	PMID:17602206
Pex11a	Rat	cobalt dichloride	decreases expression	EXP		6480464	cobaltous chloride results in decreased expression of PEX11A mRNA	CTD	PMID:24386269
Pex11a	Rat	copper(II) chloride	decreases expression	ISO	RGD:1348303	6480464	cupric chloride results in decreased expression of PEX11A mRNA	CTD	PMID:38568856
Pex11a	Rat	copper(II) sulfate	decreases expression	ISO	RGD:1348303	6480464	Copper Sulfate results in decreased expression of PEX11A mRNA	CTD	PMID:19549813
Pex11a	Rat	cyclosporin A	decreases expression	ISO	RGD:731523	6480464	Cyclosporine results in decreased expression of PEX11A mRNA	CTD	PMID:19770486
Pex11a	Rat	cyclosporin A	decreases expression	ISO	RGD:1348303	6480464	Cyclosporine results in decreased expression of PEX11A mRNA	CTD	PMID:20106945\|PMID:25562108
Pex11a	Rat	decabromodiphenyl ether	increases expression	EXP		6480464	decabromobiphenyl ether results in increased expression of PEX11A mRNA	CTD	PMID:23640034
Pex11a	Rat	dexamethasone	multiple interactions	ISO	RGD:1348303	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
Pex11a	Rat	Dibutyl phosphate	affects expression	ISO	RGD:1348303	6480464	di-n-butylphosphoric acid affects the expression of PEX11A mRNA	CTD	PMID:37042841
Pex11a	Rat	dibutyl phthalate	decreases expression	ISO	RGD:731523	6480464	Dibutyl Phthalate results in decreased expression of PEX11A mRNA	CTD	PMID:21266533
Pex11a	Rat	dichloroacetic acid	increases expression	ISO	RGD:731523	6480464	Dichloroacetic Acid results in increased expression of PEX11A mRNA	CTD	PMID:28962523
Pex11a	Rat	dicrotophos	decreases expression	ISO	RGD:1348303	6480464	dicrotophos results in decreased expression of PEX11A mRNA	CTD	PMID:28302478
Pex11a	Rat	diisononyl phthalate	increases expression	ISO	RGD:731523	6480464	diisononyl phthalate results in increased expression of PEX11A mRNA	CTD	PMID:31546122
Pex11a	Rat	dioxygen	decreases metabolic processing	ISO	RGD:731523	6480464	PEX11A gene mutant form results in decreased metabolism of Oxygen	CTD	PMID:30585412
Pex11a	Rat	diuron	increases expression	EXP		6480464	Diuron results in increased expression of PEX11A mRNA	CTD	PMID:21551480
Pex11a	Rat	epoxiconazole	decreases expression	ISO	RGD:731523	6480464	epoxiconazole results in decreased expression of PEX11A mRNA	CTD	PMID:35436446
Pex11a	Rat	ethanol	multiple interactions	EXP		6480464	[Fish Oils co-treated with Ethanol] results in increased expression of PEX11A mRNA	CTD	PMID:17347304
Pex11a	Rat	fenofibrate	affects expression	EXP		6480464	Fenofibrate affects the expression of PEX11A mRNA	CTD	PMID:20801182
Pex11a	Rat	fenofibrate	increases expression	EXP		6480464	Fenofibrate results in increased expression of PEX11A mRNA	CTD	PMID:27665778\|PMID:32741897
Pex11a	Rat	fenofibrate	increases expression	ISO	RGD:1348303	6480464	Fenofibrate results in increased expression of PEX11A mRNA	CTD	PMID:25572481
Pex11a	Rat	fenvalerate	increases expression	EXP		6480464	fenvalerate results in increased expression of PEX11A mRNA	CTD	PMID:30307764
Pex11a	Rat	finasteride	increases expression	EXP		6480464	Finasteride results in increased expression of PEX11A mRNA	CTD	PMID:24136188
Pex11a	Rat	flavonoids	decreases expression	EXP		6480464	Flavonoids results in decreased expression of PEX11A mRNA	CTD	PMID:18035473
Pex11a	Rat	gemfibrozil	increases expression	EXP		6480464	Gemfibrozil results in increased expression of PEX11A mRNA	CTD	PMID:27665778
Pex11a	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of PEX11A mRNA	CTD	PMID:33387578
Pex11a	Rat	glafenine	decreases expression	EXP		6480464	Glafenine results in decreased expression of PEX11A mRNA	CTD	PMID:24136188
Pex11a	Rat	hexadecanoic acid	increases abundance	ISO	RGD:731523	6480464	PEX11A gene mutant form results in increased abundance of Palmitic Acid	CTD	PMID:30585412
Pex11a	Rat	indole-3-methanol	multiple interactions	EXP		6480464	[indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of PEX11A mRNA; [indole-3-carbinol more ...	CTD	PMID:22129741
Pex11a	Rat	indometacin	multiple interactions	ISO	RGD:1348303	6480464	[INS protein co-treated with Dexamethasone co-treated with 1-Methyl-3-isobutylxanthine co-treated with Indomethacin co-treated with bisphenol A] more ...	CTD	PMID:28628672
Pex11a	Rat	inulin	multiple interactions	ISO	RGD:731523	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in increased expression of PEX11A mRNA	CTD	PMID:36331819
Pex11a	Rat	iron dichloride	decreases expression	ISO	RGD:1348303	6480464	ferrous chloride results in decreased expression of PEX11A mRNA	CTD	PMID:35984750
Pex11a	Rat	isotretinoin	decreases expression	ISO	RGD:1348303	6480464	Isotretinoin results in decreased expression of PEX11A mRNA	CTD	PMID:20436886
Pex11a	Rat	leflunomide	increases expression	EXP		6480464	leflunomide results in increased expression of PEX11A mRNA	CTD	PMID:24136188
Pex11a	Rat	leflunomide	decreases expression	ISO	RGD:1348303	6480464	leflunomide results in decreased expression of PEX11A mRNA	CTD	PMID:28988120
Pex11a	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:1348303	6480464	S-(1,2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in decreased expression of PEX11A mRNA]	CTD	PMID:35811015
Pex11a	Rat	lipopolysaccharide	decreases expression	ISO	RGD:1348303	6480464	Lipopolysaccharides results in decreased expression of PEX11A mRNA	CTD	PMID:35811015
Pex11a	Rat	methidathion	increases expression	ISO	RGD:731523	6480464	methidathion results in increased expression of PEX11A mRNA	CTD	PMID:34813904
Pex11a	Rat	methotrexate	affects response to substance	ISO	RGD:1348303	6480464	PEX11A protein affects the susceptibility to Methotrexate	CTD	PMID:16217747
Pex11a	Rat	Methylazoxymethanol acetate	increases expression	EXP		6480464	Methylazoxymethanol Acetate results in increased expression of PEX11A mRNA	CTD	PMID:28349193
Pex11a	Rat	methylmercury chloride	decreases expression	ISO	RGD:1348303	6480464	methylmercuric chloride results in decreased expression of PEX11A mRNA	CTD	PMID:28001369
Pex11a	Rat	monosodium L-glutamate	multiple interactions	ISO	RGD:731523	6480464	[Fats, Unsaturated co-treated with Sodium Glutamate co-treated with Aspartame] affects the expression of PEX11A mRNA; more ...	CTD	PMID:23783067
Pex11a	Rat	Muraglitazar	increases expression	EXP		6480464	muraglitazar results in increased expression of PEX11A mRNA	CTD	PMID:21515302
Pex11a	Rat	N-acetyl-L-cysteine	multiple interactions	EXP		6480464	[indole-3-carbinol co-treated with Diethylnitrosamine co-treated with Acetylcysteine] results in decreased expression of PEX11A mRNA; Acetylcysteine more ...	CTD	PMID:22129741
Pex11a	Rat	N-nitrosodiethylamine	multiple interactions	EXP		6480464	[Diethylnitrosamine co-treated with beta-Naphthoflavone] results in decreased expression of PEX11A mRNA; [indole-3-carbinol co-treated with Diethylnitrosamine more ...	CTD	PMID:18164116\|PMID:22129741
Pex11a	Rat	N-nitrosodiethylamine	increases expression	ISO	RGD:731523	6480464	Diethylnitrosamine results in increased expression of PEX11A mRNA	CTD	PMID:12771043
Pex11a	Rat	nefazodone	increases expression	EXP		6480464	nefazodone results in increased expression of PEX11A mRNA	CTD	PMID:24136188
Pex11a	Rat	nickel atom	decreases expression	ISO	RGD:1348303	6480464	Nickel results in decreased expression of PEX11A mRNA	CTD	PMID:24768652\|PMID:25583101
Pex11a	Rat	nimesulide	increases expression	EXP		6480464	nimesulide results in increased expression of PEX11A mRNA	CTD	PMID:24136188
Pex11a	Rat	ozone	increases expression	EXP		6480464	Ozone results in increased expression of PEX11A mRNA	CTD	PMID:28623178\|PMID:31397875\|PMID:35737395
Pex11a	Rat	paracetamol	multiple interactions	ISO	RGD:731523	6480464	[Clofibrate co-treated with Acetaminophen] affects the expression of PEX11A mRNA; PPARA affects the reaction [[Clofibrate more ...	CTD	PMID:17585979
Pex11a	Rat	paracetamol	decreases expression	ISO	RGD:1348303	6480464	Acetaminophen results in decreased expression of PEX11A mRNA	CTD	PMID:29067470
Pex11a	Rat	paracetamol	affects expression	ISO	RGD:731523	6480464	Acetaminophen affects the expression of PEX11A mRNA	CTD	PMID:17562736
Pex11a	Rat	paricalcitol	multiple interactions	ISO	RGD:1348303	6480464	[Phosphorus co-treated with paricalcitol] affects the expression of PEX11A mRNA	CTD	PMID:17715259
Pex11a	Rat	pentachlorophenol	increases expression	ISO	RGD:731523	6480464	Pentachlorophenol results in increased expression of PEX11A mRNA	CTD	PMID:23892564
Pex11a	Rat	perfluorohexanesulfonic acid	increases expression	ISO	RGD:1348303	6480464	perfluorohexanesulfonic acid results in increased expression of PEX11A mRNA	CTD	PMID:23567314
Pex11a	Rat	perfluorononanoic acid	increases expression	ISO	RGD:731523	6480464	perfluoro-n-nonanoic acid results in increased expression of PEX11A mRNA	CTD	PMID:25543169
Pex11a	Rat	perfluorooctane-1-sulfonic acid	increases expression	EXP		6480464	perfluorooctane sulfonic acid results in increased expression of PEX11A mRNA	CTD	PMID:19162173
Pex11a	Rat	perfluorooctane-1-sulfonic acid	affects expression	ISO	RGD:1348303	6480464	perfluorooctane sulfonic acid affects the expression of PEX11A mRNA	CTD	PMID:36864359
Pex11a	Rat	perfluorooctane-1-sulfonic acid	increases expression	ISO	RGD:731523	6480464	perfluorooctane sulfonic acid results in increased expression of PEX11A mRNA	CTD	PMID:19429403\|PMID:20936131
Pex11a	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:731523	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PEX11A mRNA; [perfluorooctane sulfonic more ...	CTD	PMID:20936131\|PMID:36331819
Pex11a	Rat	perfluorooctanoic acid	increases expression	EXP		6480464	perfluorooctanoic acid results in increased expression of PEX11A mRNA; perfluorooctanoic acid results in increased expression more ...	CTD	PMID:16221955\|PMID:19162173\|PMID:28511854\|PMID:34958885
Pex11a	Rat	perfluorooctanoic acid	increases expression	ISO	RGD:1348303	6480464	perfluorooctanoic acid results in increased expression of PEX11A mRNA	CTD	PMID:23567314\|PMID:32588087
Pex11a	Rat	perfluorooctanoic acid	multiple interactions	ISO	RGD:731523	6480464	PPARA protein promotes the reaction [perfluorooctanoic acid results in increased expression of PEX11A mRNA]	CTD	PMID:18467677\|PMID:20936131
Pex11a	Rat	perfluorooctanoic acid	increases expression	ISO	RGD:731523	6480464	perfluorooctanoic acid results in increased expression of PEX11A mRNA	CTD	PMID:18467677\|PMID:19429403\|PMID:20936131
Pex11a	Rat	permethrin	increases expression	ISO	RGD:731523	6480464	Permethrin results in increased expression of PEX11A mRNA	CTD	PMID:30629241
Pex11a	Rat	phenformin	increases expression	EXP		6480464	Phenformin results in increased expression of PEX11A mRNA	CTD	PMID:31324951
Pex11a	Rat	phenobarbital	increases expression	EXP		6480464	Phenobarbital results in increased expression of PEX11A mRNA	CTD	PMID:19162173
Pex11a	Rat	phenobarbital	affects expression	ISO	RGD:731523	6480464	Phenobarbital affects the expression of PEX11A mRNA	CTD	PMID:23091169
Pex11a	Rat	phenylephrine	decreases expression	EXP		6480464	Phenylephrine results in decreased expression of PEX11A mRNA	CTD	PMID:18158353
Pex11a	Rat	phosphorus atom	multiple interactions	ISO	RGD:1348303	6480464	[Phosphorus co-treated with paricalcitol] affects the expression of PEX11A mRNA	CTD	PMID:17715259
Pex11a	Rat	phosphorus(.)	multiple interactions	ISO	RGD:1348303	6480464	[Phosphorus co-treated with paricalcitol] affects the expression of PEX11A mRNA	CTD	PMID:17715259
Pex11a	Rat	piperonyl butoxide	increases expression	EXP		6480464	Piperonyl Butoxide results in increased expression of PEX11A mRNA	CTD	PMID:22484513
Pex11a	Rat	pirinixic acid	multiple interactions	ISO	RGD:731523	6480464	PPARA protein promotes the reaction [pirinixic acid results in increased expression of PEX11A mRNA]	CTD	PMID:20059764
Pex11a	Rat	pirinixic acid	increases expression	ISO	RGD:731523	6480464	pirinixic acid results in increased expression of PEX11A mRNA	CTD	PMID:15375163\|PMID:17426115\|PMID:18301758\|PMID:18445702\|PMID:20059764\|PMID:20813756\|PMID:23811191
Pex11a	Rat	pirinixic acid	increases expression	EXP		6480464	pirinixic acid results in increased expression of PEX11A mRNA	CTD	PMID:19162173\|PMID:22484513\|PMID:27665778\|PMID:32741897
Pex11a	Rat	pirinixic acid	decreases expression	ISO	RGD:731523	6480464	pirinixic acid results in decreased expression of PEX11A mRNA	CTD	PMID:25270620
Pex11a	Rat	pravastatin	decreases expression	EXP		6480464	Pravastatin results in decreased expression of PEX11A mRNA	CTD	PMID:27225895
Pex11a	Rat	pravastatin	decreases expression	ISO	RGD:731523	6480464	Pravastatin results in decreased expression of PEX11A mRNA	CTD	PMID:27225895
Pex11a	Rat	propiconazole	decreases expression	ISO	RGD:731523	6480464	propiconazole results in decreased expression of PEX11A mRNA	CTD	PMID:21278054
Pex11a	Rat	resveratrol	multiple interactions	ISO	RGD:1348303	6480464	[Plant Extracts co-treated with Resveratrol] results in decreased expression of PEX11A mRNA	CTD	PMID:23557933
Pex11a	Rat	rotenone	increases expression	EXP		6480464	Rotenone results in increased expression of PEX11A mRNA	CTD	PMID:19013527\|PMID:28374803
Pex11a	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	RGD:1348303	6480464	S-(1,2-dichlorovinyl)cysteine inhibits the reaction [Lipopolysaccharides results in decreased expression of PEX11A mRNA]	CTD	PMID:35811015
Pex11a	Rat	sodium arsenite	increases expression	ISO	RGD:1348303	6480464	sodium arsenite results in increased expression of PEX11A mRNA	CTD	PMID:25879800
Pex11a	Rat	sodium arsenite	decreases expression	ISO	RGD:1348303	6480464	sodium arsenite results in decreased expression of PEX11A mRNA	CTD	PMID:25879800
Pex11a	Rat	sunitinib	decreases expression	ISO	RGD:1348303	6480464	Sunitinib results in decreased expression of PEX11A mRNA	CTD	PMID:31533062
Pex11a	Rat	tamoxifen	multiple interactions	EXP		6480464	[bexarotene co-treated with Tamoxifen] results in increased expression of PEX11A mRNA	CTD	PMID:17630414
Pex11a	Rat	temozolomide	decreases expression	ISO	RGD:1348303	6480464	Temozolomide results in decreased expression of PEX11A mRNA	CTD	PMID:31758290
Pex11a	Rat	Tesaglitazar	increases expression	EXP		6480464	tesaglitazar results in increased expression of PEX11A mRNA	CTD	PMID:21515302
Pex11a	Rat	tetrachloroethene	increases expression	ISO	RGD:731523	6480464	Tetrachloroethylene results in increased expression of PEX11A mRNA	CTD	PMID:28973375
Pex11a	Rat	tetrachloromethane	increases expression	EXP		6480464	Carbon Tetrachloride results in increased expression of PEX11A mRNA	CTD	PMID:31150632
Pex11a	Rat	tetrachloromethane	decreases expression	ISO	RGD:731523	6480464	Carbon Tetrachloride results in decreased expression of PEX11A mRNA	CTD	PMID:31919559
Pex11a	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of PEX11A mRNA	CTD	PMID:34492290
Pex11a	Rat	thiram	decreases expression	ISO	RGD:1348303	6480464	Thiram results in decreased expression of PEX11A mRNA	CTD	PMID:38568856
Pex11a	Rat	trichloroethene	increases expression	EXP		6480464	Trichloroethylene results in increased expression of PEX11A mRNA	CTD	PMID:19448997
Pex11a	Rat	trichloroethene	increases expression	ISO	RGD:731523	6480464	Trichloroethylene results in increased expression of PEX11A mRNA	CTD	PMID:19448997\|PMID:25549359
Pex11a	Rat	trichostatin A	increases expression	ISO	RGD:1348303	6480464	trichostatin A results in increased expression of PEX11A mRNA	CTD	PMID:24935251
Pex11a	Rat	triphenyl phosphate	decreases expression	EXP		6480464	triphenyl phosphate results in decreased expression of PEX11A mRNA	CTD	PMID:30589522
Pex11a	Rat	triphenyl phosphate	affects expression	ISO	RGD:1348303	6480464	triphenyl phosphate affects the expression of PEX11A mRNA	CTD	PMID:37042841
Pex11a	Rat	troglitazone	increases expression	EXP		6480464	troglitazone results in increased expression of PEX11A mRNA	CTD	PMID:21515302
Pex11a	Rat	valproic acid	affects expression	ISO	RGD:731523	6480464	Valproic Acid affects the expression of PEX11A mRNA	CTD	PMID:17292431
Pex11a	Rat	valproic acid	decreases expression	EXP		6480464	Valproic Acid results in decreased expression of PEX11A mRNA	CTD	PMID:29427782
Pex11a	Rat	valproic acid	increases expression	ISO	RGD:1348303	6480464	Valproic Acid results in increased expression of PEX11A mRNA	CTD	PMID:24935251
Pex11a	Rat	valproic acid	decreases expression	ISO	RGD:1348303	6480464	Valproic Acid results in decreased expression of PEX11A mRNA	CTD	PMID:23179753
Pex11a	Rat	zaragozic acid A	increases expression	EXP		6480464	squalestatin 1 results in increased expression of PEX11A mRNA	CTD	PMID:27225895
Pex11a	Rat	zaragozic acid A	affects expression	ISO	RGD:731523	6480464	squalestatin 1 affects the expression of PEX11A mRNA	CTD	PMID:27225895

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pex11a	Rat	brown fat cell differentiation	acts_upstream_of_or_within	ISO	RGD:731523	1624291	PMID:18492766	RGD	PMID:18492766
Pex11a	Rat	brown fat cell differentiation	acts_upstream_of_or_within	IEA	UniProtKB:Q9Z211\|ensembl:ENSMUSP00000032761	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pex11a	Rat	peroxisome fission	involved_in	ISO	RGD:1348303	1624291	PMID:20826455	RGD	PMID:20826455
Pex11a	Rat	peroxisome fission	involved_in	IEA	UniProtKB:O75192\|ensembl:ENSP00000300056	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pex11a	Rat	peroxisome fission	involved_in	IEA	InterPro:IPR008733	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Pex11a	Rat	peroxisome fission	involved_in	IBA	PANTHER:PTN000291586\|SGD:S000005507\|TAIR:locus:2050694\|TAIR:locus:2099590\|TAIR:locus:2101012\|TAIR:locus:2198150\|TAIR:locus:2202430\|UniProtKB:O75192\|UniProtKB:O96011	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pex11a	Rat	peroxisome membrane biogenesis		IDA		633614		RGD
Pex11a	Rat	peroxisome organization	involved_in	ISS	UniProtKB:O75192	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Pex11a	Rat	peroxisome organization	involved_in	IEA	UniProtKB-KW:KW-0962	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pex11a	Rat	peroxisome organization	involved_in	IEA	UniProtKB:O75192\|ensembl:ENSP00000300056	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pex11a	Rat	peroxisome organization	involved_in	ISO	RGD:1348303	1624291	PMID:9792670	RGD	PMID:9792670
Pex11a	Rat	regulation of peroxisome size	involved_in	ISO	RGD:1348303	1624291	PMID:20826455	RGD	PMID:20826455
Pex11a	Rat	regulation of peroxisome size	involved_in	IEA	UniProtKB:O75192\|ensembl:ENSP00000300056	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pex11a	Rat	signal transduction	involved_in	ISO	RGD:1348303	1624291	PMID:9792670	RGD	PMID:9792670
Pex11a	Rat	signal transduction	involved_in	IEA	UniProtKB:O75192\|ensembl:ENSP00000300056	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pex11a	Rat	signal transduction	involved_in	ISS	UniProtKB:O75192	1600115	GO_REF:0000024	UniProt	GO_REF:0000024

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pex11a	Rat	membrane	located_in	IEA	UniProtKB-KW:KW-0472	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pex11a	Rat	peroxisomal membrane		IDA		633614		RGD
Pex11a	Rat	peroxisomal membrane	located_in	IEA	InterPro:IPR008733	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Pex11a	Rat	peroxisomal membrane	located_in	IEA	UniProtKB:O75192\|ensembl:ENSP00000300056	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pex11a	Rat	peroxisomal membrane	is_active_in	IBA	PANTHER:PTN000291586\|RGD:1310353\|RGD:619842\|SGD:S000005507\|TAIR:locus:2050694\|TAIR:locus:2099590\|TAIR:locus:2101012\|TAIR:locus:2198150\|TAIR:locus:2202430\|UniProtKB:O75192\|UniProtKB:O96011	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pex11a	Rat	peroxisomal membrane	located_in	IEA	UniProtKB-SubCell:SL-0203	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Pex11a	Rat	peroxisomal membrane	located_in	ISO	RGD:1348303	1624291	PMID:9714566, PMID:9792670	RGD	PMID:9714566\|PMID:9792670
Pex11a	Rat	peroxisomal membrane	located_in	ISS	UniProtKB:O75192	1600115	GO_REF:0000024	UniProt	GO_REF:0000024
Pex11a	Rat	peroxisomal membrane	located_in	IDA		1580664	PMID:14561759	HGNC-UCL
Pex11a	Rat	peroxisomal membrane		IDA		1580664		RGD
Pex11a	Rat	peroxisome	located_in	ISO	RGD:1348303	1624291	PMID:18782765, PMID:19114594, PMID:20826455, PMID:9922452	RGD	PMID:18782765\|PMID:19114594\|PMID:20826455\|PMID:9922452
Pex11a	Rat	peroxisome	located_in	IEA	UniProtKB-KW:KW-0576	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pex11a	Rat	peroxisome	located_in	IEA	UniProtKB:O75192\|ensembl:ENSP00000300056	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pex11a	Rat	protein-containing complex	part_of	ISO	RGD:1348303	1624291	PMID:20826455	RGD	PMID:20826455
Pex11a	Rat	protein-containing complex	part_of	IEA	UniProtKB:O75192\|ensembl:ENSP00000300056	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pex11a	Rat	protein binding	enables	ISO	RGD:1348303	1624291	UniProtKB:Q96HA9\|UniProtKB:Q9Y3D6 PMID:20826455	RGD	PMID:20826455
Pex11a	Rat	protein homodimerization activity	enables	ISO	RGD:1348303	1624291	PMID:20826455	RGD	PMID:20826455
Pex11a	Rat	protein homodimerization activity	enables	IEA	UniProtKB:O75192\|ensembl:ENSP00000300056	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107

Disease Annotations Click to see Annotation Detail View

Bloom syndrome (ISO)

Chemical and Drug Induced Liver Injury (ISO)

colorectal cancer (ISO)

D-2-hydroxyglutaric aciduria 2 (ISO)

Dyslipidemias (ISO)

obesity (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,4-dinitrotoluene (EXP)

3,3',4,4'-tetrachlorobiphenyl (ISO)

3,4-methylenedioxymethamphetamine (ISO)

3-chloropropane-1,2-diol (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

amiodarone (ISO)

ammonium chloride (EXP)

aspartame (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (EXP)

bexarotene (EXP)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bromobenzene (EXP)

buspirone (EXP)

buta-1,3-diene (ISO)

carbon nanotube (ISO)

chloroprene (ISO)

ciguatoxin CTX1B (ISO)

ciprofibrate (ISO)

clofibrate (EXP,ISO)

clofibric acid (EXP)

cobalt dichloride (EXP)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

decabromodiphenyl ether (EXP)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

dichloroacetic acid (ISO)

dicrotophos (ISO)

diisononyl phthalate (ISO)

dioxygen (ISO)

diuron (EXP)

epoxiconazole (ISO)

ethanol (EXP)

fenofibrate (EXP,ISO)

fenvalerate (EXP)

finasteride (EXP)

flavonoids (EXP)

gemfibrozil (EXP)

gentamycin (EXP)

glafenine (EXP)

hexadecanoic acid (ISO)

indole-3-methanol (EXP)

indometacin (ISO)

inulin (ISO)

iron dichloride (ISO)

isotretinoin (ISO)

leflunomide (EXP,ISO)

lipopolysaccharide (ISO)

methidathion (ISO)

methotrexate (ISO)

Methylazoxymethanol acetate (EXP)

methylmercury chloride (ISO)

monosodium L-glutamate (ISO)

Muraglitazar (EXP)

N-acetyl-L-cysteine (EXP)

N-nitrosodiethylamine (EXP,ISO)

nefazodone (EXP)

nickel atom (ISO)

nimesulide (EXP)

ozone (EXP)

paracetamol (ISO)

paricalcitol (ISO)

pentachlorophenol (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (EXP,ISO)

perfluorooctanoic acid (EXP,ISO)

permethrin (ISO)

phenformin (EXP)

phenobarbital (EXP,ISO)

phenylephrine (EXP)

phosphorus atom (ISO)

phosphorus(.) (ISO)

piperonyl butoxide (EXP)

pirinixic acid (EXP,ISO)

pravastatin (EXP,ISO)

propiconazole (ISO)

resveratrol (ISO)

rotenone (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

tamoxifen (EXP)

temozolomide (ISO)

Tesaglitazar (EXP)

tetrachloroethene (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

thiram (ISO)

trichloroethene (EXP,ISO)

trichostatin A (ISO)

triphenyl phosphate (EXP,ISO)

troglitazone (EXP)

valproic acid (EXP,ISO)

zaragozic acid A (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

brown fat cell differentiation (IEA,ISO)

peroxisome fission (IBA,IEA,ISO)

peroxisome membrane biogenesis (IDA)

peroxisome organization (IEA,ISO,ISS)

regulation of peroxisome size (IEA,ISO)

signal transduction (IEA,ISO,ISS)

Cellular Component

membrane (IEA)

peroxisomal membrane (IBA,IDA,IEA,ISO,ISS)

peroxisome (IEA,ISO)

protein-containing complex (IEA,ISO)

Molecular Function

protein binding (ISO)

protein homodimerization activity (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Proteomic analysis of rat liver peroxisome: presence of peroxisome-specific isozyme of Lon protease.	Kikuchi M, etal., J Biol Chem. 2004 Jan 2;279(1):421-8. Epub 2003 Oct 15.
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	Peroxisome biogenesis: involvement of ARF and coatomer.	Passreiter M, etal., J Cell Biol 1998 Apr 20;141(2):373-83.
6.	GOA pipeline	RGD automated data pipeline
7.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
9.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:8889548	PMID:9714566	PMID:9792670	PMID:9922452	PMID:15489334	PMID:18492766	PMID:18782765	PMID:19114594	PMID:20826455

Genomics

Comparative Map Data

Pex11a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	1	143,089,410 - 143,096,491 (-)	NCBI		GRCr8
mRatBN7.2	1	133,680,091 - 133,687,172 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	133,680,091 - 133,687,172 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	141,589,549 - 141,596,507 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	148,758,938 - 148,765,910 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	141,676,644 - 141,683,616 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	141,474,189 - 141,481,270 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	141,474,180 - 141,481,315 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	142,435,410 - 142,442,491 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	135,513,735 - 135,520,816 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	135,593,304 - 135,685,129 (-)	NCBI
Celera	1	125,743,709 - 125,750,790 (-)	NCBI		Celera
Cytogenetic Map	1	q31	NCBI

PEX11A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	89,681,535 - 89,690,754 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	89,677,764 - 89,690,783 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	90,224,766 - 90,233,985 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	88,027,288 - 88,034,962 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	15	88,027,292 - 88,034,962	NCBI
Celera	15	66,629,060 - 66,636,731 (-)	NCBI		Celera
Cytogenetic Map	15	q26.1	NCBI
HuRef	15	66,337,719 - 66,346,969 (-)	NCBI		HuRef
CHM1_1	15	90,065,595 - 90,074,847 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	87,437,417 - 87,446,633 (-)	NCBI		T2T-CHM13v2.0

Pex11a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	7	79,385,705 - 79,392,879 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	7	79,385,705 - 79,392,879 (-)	Ensembl		GRCm39 Ensembl
GRCm38	7	79,735,957 - 79,743,131 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	7	79,735,957 - 79,743,131 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	7	86,882,150 - 86,887,911 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	7	79,610,777 - 79,616,538 (-)	NCBI		MGSCv36	mm8
Celera	7	77,136,478 - 77,142,240 (-)	NCBI		Celera
Cytogenetic Map	7	D2	NCBI
cM Map	7	45.12	NCBI

Pex11a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955416	15,527,941 - 15,534,424 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955416	15,527,925 - 15,537,497 (+)	NCBI	ChiLan1.0	ChiLan1.0

PEX11A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	79,231,159 - 79,240,431 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	82,936,655 - 82,945,276 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	68,375,201 - 68,384,440 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	87,581,581 - 87,590,684 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	87,581,564 - 87,590,684 (-)	Ensembl	panpan1.1		panPan2

PEX11A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	52,674,363 - 52,684,776 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	52,674,348 - 52,684,660 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	55,308,322 - 55,318,739 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	53,090,753 - 53,101,172 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	53,090,755 - 53,101,151 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	52,612,919 - 52,623,332 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	52,824,121 - 52,833,237 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	53,163,246 - 53,173,666 (-)	NCBI		UU_Cfam_GSD_1.0

Pex11a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	130,853,950 - 130,861,573 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936483	15,472,949 - 15,480,648 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936483	15,474,484 - 15,480,527 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PEX11A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	55,256,220 - 55,264,247 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	55,256,239 - 55,264,253 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	60,145,337 - 60,153,336 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PEX11A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	29	8,220,082 - 8,229,448 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	29	8,221,920 - 8,229,243 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666059	38,584,059 - 38,593,190 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pex11a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624768	16,751,366 - 16,760,326 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624768	16,751,366 - 16,759,829 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pex11a
96 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	237
Count of miRNA genes:	158
Interacting mature miRNAs:	191
Transcripts:	ENSRNOT00000020229
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61442	Strs1	Sensitivity to stroke QTL 1	7.4		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	1	121767634	166767634	Rat
1578780	Cm52	Cardiac mass QTL 52	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	1	81591954	219808434	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
1598866	Bp287	Blood pressure QTL 287	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121006655	166006655	Rat
1578770	Stresp23	Stress response QTL 23			kidney sympathetic nerve activity (VT:0004050)	stimulated renal sympathetic nerve activity to basal renal sympathetic nerve activity ratio (CMO:0001786)	1	123350408	182418476	Rat
9590300	Scort16	Serum corticosterone level QTL 16	4.39	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	1	103111621	148111621	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
7794788	Mcs32	Mammary carcinoma susceptibility QTL 32	2.61		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	1	115540693	238914717	Rat
631199	Cm23	Cardiac mass QTL 23	4.6	0.0004	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	115585465	172949803	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
1598850	Bp297	Blood pressure QTL 297	2.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121006655	166006655	Rat
631570	Bp94	Blood pressure QTL 94		0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123479780	142990467	Rat
152025235	Bw194	Body weight QTL 194	4.86		body mass (VT:0001259)		1	123556856	242907031	Rat
152025232	Bw192	Body weight QTL 192	3.93		body mass (VT:0001259)		1	117917486	196963478	Rat
724521	Uae1	Urinary albumin excretion QTL 1	3.8	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	1	90508614	173018436	Rat
1358902	Bw47	Body weight QTL 47	1.67		body mass (VT:0001259)	body weight (CMO:0000012)	1	90508614	180359386	Rat
61346	Rf2	Renal disease susceptibility QTL 2	3.7		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	1	99267916	144267916	Rat
8655649	Arrd1	Age-related retinal degeneration QTL 1	4.89		retinal layer morphology trait (VT:0003727)	percentage of study population developing retinopathy during a period of time (CMO:0002453)	1	100357752	183970443	Rat
1300153	Bp171	Blood pressure QTL 171	3.37		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	90664883	143200202	Rat
2317833	Alcrsp19	Alcohol response QTL 19	12.4	0.001	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	1	100979852	145979852	Rat
731168	Bp154	Blood pressure QTL 154	3.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94642644	214537671	Rat
631202	Gluco13	Glucose level QTL 13		0.0001	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	1	131763437	159756369	Rat
631205	Bp196	Blood pressure QTL 196	4	0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118944897	199050459	Rat
1300158	Bp173	Blood pressure QTL 173	3.48		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	1	115540693	185145286	Rat
1641897	Alcrsp1	Alcohol response QTL 1			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	1	100979852	145979852	Rat
1331749	Hrtrt11	Heart rate QTL 11	2.973		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	94494440	198211706	Rat
1331751	Bp199	Blood pressure QTL 199	3.60022		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	94494440	181830018	Rat
2293142	Bp314	Blood pressure QTL 314			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	92184926	137184926	Rat
9685799	Bp375	Blood pressure QTL 375			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	170611501	Rat
2293140	Bp313	Blood pressure QTL 313			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	121833674	166833674	Rat
9685802	Bp376	Blood pressure QTL 376			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	126540680	171540680	Rat
724529	Cm16	Cardiac mass QTL 16	2.7		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	1	87580395	150700247	Rat
61370	Mcs3	Mammary carcinoma susceptibility QTL 3	2.15		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	102268556	147268556	Rat
1641895	Bp298	Blood pressure QTL 298			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	123350408	182418476	Rat
70209	Niddm23	Non-insulin dependent diabetes mellitus QTL 23	2.82		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	94494440	198324465	Rat
631496	Bp97	Blood pressure QTL 97	3.08		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	106047847	151047847	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
2303591	Gluco41	Glucose level QTL 41	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	102168504	147168504	Rat
1331793	Bp200	Blood pressure QTL 200	3.71601		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	94494440	172949803	Rat
2313060	Bss71	Bone structure and strength QTL 71	2.6	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	1	118944747	163944747	Rat
6893347	Bw98	Body weight QTL 98	0.2	0.53	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
1354591	Cm36	Cardiac mass QTL 36	4.1		heart left ventricle mass (VT:0007031)	calculated heart weight (CMO:0000073)	1	102813953	201278233	Rat
7421630	Bp362	Blood pressure QTL 362		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	118608292	241799120	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
61399	Tcat1	Tongue tumor resistance QTL 1	3.3		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 5 mm (CMO:0001879)	1	99267916	144267916	Rat
6893361	Bw104	Body weight QTL 104	0.59	0.27	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
724567	Tcas6	Tongue tumor susceptibility QTL 6	6.85		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	1	92948896	144267916	Rat
738006	Anxrr14	Anxiety related response QTL 14	4	0.00035	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	130636910	175636910	Rat
1558645	Bw55	Body weight QTL 55	3.2	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	1	133680936	178680936	Rat
1354615	Cm32	Cardiac mass QTL 32	5.2		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	1	102813953	201278233	Rat
634348	Bp138	Blood pressure QTL 138			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	168883176	Rat
8694370	Bw154	Body weight QTL 154	8.91	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	1	103111621	148111621	Rat
738028	Anxrr12	Anxiety related response QTL 12	4.9	0.00001	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	130636910	175636910	Rat
1354623	Rf46	Renal function QTL 46	3.8		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	1	102813953	151162766	Rat
631654	Bp107	Blood pressure QTL 107			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	125611501	170611501	Rat
631544	Bp84	Blood pressure QTL 84	5.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350408	181759564	Rat
152025212	Bw190	Body weight QTL 190	5.7		body mass (VT:0001259)		1	123556856	196963478	Rat
631549	Bp89	Blood pressure QTL 89	5.7		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	123350581	201284552	Rat
1358189	Cstrr1	Cold stress response QTL 1		0.0001	catecholamine amount (VT:0010543)	urine norepinephrine level (CMO:0001629)	1	123350408	182418476	Rat
1354606	Bp246	Blood pressure QTL 246	3.6		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	1	102813953	218753816	Rat

Markers in Region

RH132789

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	133,680,235 - 133,680,420 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	141,474,334 - 141,474,518	NCBI	Rnor6.0
Rnor_5.0	1	142,435,555 - 142,435,739	UniSTS	Rnor5.0
RGSC_v3.4	1	135,513,880 - 135,514,064	UniSTS	RGSC3.4
Celera	1	125,743,854 - 125,744,038	UniSTS
RH 3.4 Map	1	1062.9	UniSTS
Cytogenetic Map	1	q31	UniSTS

PMC321432P2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	133,682,769 - 133,682,983 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	141,476,868 - 141,477,081	NCBI	Rnor6.0
Rnor_5.0	1	142,438,089 - 142,438,302	UniSTS	Rnor5.0
RGSC_v3.4	1	135,516,414 - 135,516,627	UniSTS	RGSC3.4
Celera	1	125,746,388 - 125,746,601	UniSTS
Cytogenetic Map	1	q31	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053487	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008759560	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039092913	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC096024	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AJ224120	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061835	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BQ192308	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473980	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000020229 ⟹ ENSRNOP00000020229

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	133,680,091 - 133,687,172 (-)	Ensembl
Rnor_6.0 Ensembl	1	141,474,180 - 141,481,315 (-)	Ensembl

RefSeq Acc Id:

NM_053487 ⟹ NP_445939

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	143,089,410 - 143,096,491 (-)	NCBI
mRatBN7.2	1	133,680,091 - 133,687,172 (-)	NCBI
Rnor_6.0	1	141,474,189 - 141,481,270 (-)	NCBI
Rnor_5.0	1	142,435,410 - 142,442,491 (-)	NCBI
RGSC_v3.4	1	135,513,735 - 135,520,816 (-)	RGD
Celera	1	125,743,709 - 125,750,790 (-)	RGD

Sequence:

show sequence

CCCACCCACCCGGCGACTAATCTGATCCCGGCTGTCCCCCGGGACCAGCGAGGTCCCAGAAGAC
CCACGAGGGAGCGGGCGTAACGCGTGGCTGCGGGTGGGAGCCATGGACGCCTTCATCCGAGTCG
CCAACCAAAGCCAAGGTCGGGACCGACTTTTCAGAGCCACTCAACACGCATGCATGTTGCTTAG
ATATTTGTTAGAGTCTAAGGCTGGCAAAGAGGCGGTGGTAACGAAGCTCAAGAATCTGGAGACT
AGTGTGAGCACTGGCCGTAAATGGTTCAGACTAGGCAACGTGCTCCATGCCATCCAGGCCACTG
AGCAGAGCATCCAAGCCACTGACCTTGTGCCCCGCCTATGCCTAACATTAGCCAACCTGAACCG
CGTGGTTTATTACATCTGTGACACTGTCCTCTGGGCGAAGAGTGTGGGTCTGACATCTGGAATC
AACAGAGAGAAGTGGCAAATGCGGGCGGCCCGCCACTACTACTATTTCCTCTTGCTGAGCCTGG
TCCGGGATCTGTATGAGGTCTTGCTGCATATGGGACAAGTTGCACGTGACAGAGCAAAGAGAGA
GAAGTCCTCCGGGGACCCTCCTAAGTACAGCGTCGCTAATGAAGAAAGTGAATGGCTCCAGTCC
TTCCTCCTCCTCCTCTTCCAGTCTCTAAAGCGAAATCCGCCCTTATTCCTGGACACCGTGAAGA
ACTTCTGTGACATCCTGATCCCTTTGAACCAGCTCGGGATCTACAAGTCCAACCTTGGCGTGGT
AGGATTTGGAGGTCTCGTGTCCTCTGTGGCTGGCCTCATCACTGTGGTGTATCCTCAGTTGAAA
CTGAAGGCCCGCTAGGGTGTTTGGAAAATTTAAGACTGACGTTCAGTGGAGCAAACATTTGCTT
TTGTCATGATGTCTACTGTACTTAATTTTTTTTAATCATGTGAGCATCTTACCAACCGGTGATG
TGAGCAGAGGTAGGACCCACAACGGAGCCTGAAGACTGATGACGTTTTTGTAAACACGGCAGTA
ACTTCTGCACATTTCCCCTTCAGTGAACATTGCTGAGCATCTTTTCTGTACATAGTAAGAGCTC
AGTATATGCTGAACAAATAAAGATAGAAAGGAACGAAGTCATCGAAAACCCAAGGAAACTAGAA
TTACAGATCGGGTCGCATGGGTTTTGATTTCACACAAGCACATCAGGGCCCGGCACAGCACTCC
TGGCTCTGGTTAAGGCTTCCCTTTTCTCCCATCTGTGGTTGTTATCCCCCAGCCCCACAGATGT
CAGTAGTGGGATGGAGGGGAGCTGTGCTCAGAGCCTGGTAACCTGTTGGCCCTGGTCATTGCTG
TAGTTGTGTCCTGACCATGTTCAGAAGTAGACTCAGAAAAACATCAGTACCTTTGTGCCGGAAG
CGGTGTCCACAGGTAATGCTGTGAGTAAGCAAGAAAACAGCAGGAGGGACCAGAGGTGAAAGTA
GGTGGGAGGTCACCACTGCCCATTACATAATCCATCACAGATAAGGAAATTGACAATACAAAAC
AAAGCCACTAGCACACAGGTTTATTCTGATTCTTCCCAAGATGATTCCCGTGATCTCATGACCC
TCAGCAGCATTTCCAGGCTCAAAGCCCTTAGTCCCTTAACATGCCCCTCCCCCTGCTGGCCTGG
AACGTCCATCCACGGTCTCTGTTCTAGTCTATAAAGTGCAAAACAATGTAGACTCACCCAGGCT
GGTTTTATTTAAAGCTACATAACAGTTTGGGCAATTCCACAGTATTTTTCATCAAAATAAGAGA
ATTAAAATTCTTCTGCCTATGAATGTAGGAATGTCAGTTTTCTGTGACAAATCTGATTTTTCTC
AGGACAACTGGGAGGGGCGGGAAAGAGCTATCGGGCCAGTGGAGAGGGTGTGGGGACGCTCTTC
ACGGCTCAGCCTTCCTGTCTTGAGCTTGGTTTAGGTGTGTGAAGTGGGAGACACTGGCCAGCAG
GTGGGCCAGTGTCTCAGCACCGATAAAGCCGTGTACAGTTAAGTGGAAATGAGAACTCTGCACT
AAGTAACTGCTTTCCGTGAATGTGAAGAAGATTCTTGCAAAGTGGACTCAGGACCTTGGCACTG
TATTTGTAAAATGATAATGTGCTTTGAGAAAACCTTAGGGGGAGGGGGGATGAAAGAAATTAAA
GTGGTAAAACAAGACAAATATGAGTAAATGCCTATTTTTACTGTAACATTAATTATGTCTAATA
AATTTCTAGATAAAATTGA

hide sequence

RefSeq Acc Id:

XM_039092913 ⟹ XP_038948841

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	1	143,089,410 - 143,096,487 (-)	NCBI
mRatBN7.2	1	133,680,091 - 133,687,150 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_445939	(Get FASTA)	NCBI Sequence Viewer
	XP_038948841	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	CAA11838	(Get FASTA)	NCBI Sequence Viewer
	EDM08596	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000020229
	ENSRNOP00000020229.4
GenBank Protein	O70597	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_445939 ⟸ NM_053487

- UniProtKB:

Q6P749 (UniProtKB/Swiss-Prot), O70597 (UniProtKB/Swiss-Prot), A6JC69 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MDAFIRVANQSQGRDRLFRATQHACMLLRYLLESKAGKEAVVTKLKNLETSVSTGRKWFRLGNV
LHAIQATEQSIQATDLVPRLCLTLANLNRVVYYICDTVLWAKSVGLTSGINREKWQMRAARHYY
YFLLLSLVRDLYEVLLHMGQVARDRAKREKSSGDPPKYSVANEESEWLQSFLLLLFQSLKRNPP
LFLDTVKNFCDILIPLNQLGIYKSNLGVVGFGGLVSSVAGLITVVYPQLKLKAR

hide sequence

Ensembl Acc Id:

ENSRNOP00000020229 ⟸ ENSRNOT00000020229

RefSeq Acc Id:	XP_038948841 ⟸ XM_039092913
- Peptide Label:	isoform X1

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O70597-F1-model_v2	AlphaFold	O70597	1-246	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13690130

Promoter ID:

EPDNEW_R655

Type:

initiation region

Name:

Pex11a_1

Description:

peroxisomal biogenesis factor 11 alpha

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	141,481,252 - 141,481,312	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619842	AgrOrtholog
BioCyc Gene	G2FUF-58776	BioCyc
Ensembl Genes	ENSRNOG00000015003	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000020229	ENTREZGENE
	ENSRNOT00000020229.7	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:5600015	IMAGE-MGC_LOAD
InterPro	PEX11	UniProtKB/Swiss-Prot
KEGG Report	rno:85249	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72359	IMAGE-MGC_LOAD
NCBI Gene	85249	ENTREZGENE
PANTHER	PEROXISOMAL BIOGENESIS FACTOR 11	UniProtKB/Swiss-Prot
	PEROXISOMAL MEMBRANE PROTEIN 11A	UniProtKB/Swiss-Prot
Pfam	PEX11	UniProtKB/Swiss-Prot
PhenoGen	Pex11a	PhenoGen
RatGTEx	ENSRNOG00000015003	RatGTEx
UniProt	A6JC69	ENTREZGENE, UniProtKB/TrEMBL
	O70597	ENTREZGENE, UniProtKB/Swiss-Prot
	Q6P749	ENTREZGENE
UniProt Secondary	Q6P749	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-09-03	Pex11a	peroxisomal biogenesis factor 11 alpha	Pex11a	peroxisomal biogenesis factor 11A	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Pex11a	peroxisomal biogenesis factor 11A		peroxisomal membrane protein Pmp26p (Peroxin-11)	Name updated	1299863	APPROVED
2002-08-07	Pex11a	peroxisomal membrane protein Pmp26p (Peroxin-11)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD