Advanced Search (OLGA)

Gene: Rpl4 (ribosomal protein L4) Rattus norvegicus

Analyze

Symbol:

Rpl4

Name:

ribosomal protein L4

RGD ID:

619824

Description:

Enables 5S rRNA binding activity. Involved in brainstem development; cell differentiation; and positive regulation of axon extension. Located in A band. Part of cytosolic large ribosomal subunit. Is active in postsynaptic density. Orthologous to human RPL4 (ribosomal protein L4); PARTICIPATES IN ribosome biogenesis pathway; translation pathway; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 5-azacytidine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

60S ribosomal protein L1; 60S ribosomal protein L4; L1; large ribosomal subunit protein uL4

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RPL4 (ribosomal protein L4)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Rpl4 (ribosomal protein L4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Rpl4 (ribosomal protein L4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RPL4 (ribosomal protein L4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RPL4 (ribosomal protein L4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rpl4 (ribosomal protein L4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RPL4 (ribosomal protein L4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RPL4 (ribosomal protein L4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rpl4 (ribosomal protein L4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	LAMTOR1 (late endosomal/lysosomal adaptor, MAPK and MTOR activator 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	RPL4 (ribosomal protein L4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	RPL4 (ribosomal protein L4)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rpl4 (ribosomal protein L4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rpl4 (ribosomal protein L4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rpl-4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RPL4A	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RPL4B	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	RpL4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Related Pseudogenes:

Rpl4-ps1 Rpl4-ps8

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	73,566,477 - 73,571,600 (+)	NCBI		GRCr8
GRCr8 Ensembl	8	73,566,466 - 73,571,788 (+)	Ensembl		GRCr8 Ensembl
mRatBN7.2	8	64,671,177 - 64,676,301 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	64,671,160 - 64,676,306 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	70,186,011 - 70,191,135 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	68,458,602 - 68,463,726 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	66,328,589 - 66,333,713 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	69,121,682 - 69,126,805 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	69,121,682 - 69,126,805 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	68,827,918 - 68,833,041 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	68,366,802 - 68,371,925 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	8	64,077,918 - 64,083,041 (+)	NCBI		Celera
RGSC_v3.1	8	68,385,855 - 68,390,979 (+)	NCBI
Cytogenetic Map	8	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

bladder exstrophy-epispadias-cloacal exstrophy complex (ISO)

Bloom syndrome (ISO)

colorectal cancer (ISO)

High Myopia (ISO)

neuronal ceroid lipofuscinosis (ISO)

Sepsis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-tribromophenol (ISO)

2,6-dimethoxyphenol (ISO)

2-hydroxypropanoic acid (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

5-aza-2'-deoxycytidine (ISO)

5-azacytidine (EXP)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (ISO)

amiodarone (EXP)

ammonium chloride (EXP)

Aroclor 1254 (ISO)

arsenite(3-) (ISO)

azoxystrobin (ISO)

benzbromarone (EXP)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

bleomycin A2 (EXP)

Brodifacoum (EXP)

cadmium atom (ISO)

caffeine (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloropicrin (ISO)

chromium(6+) (ISO)

clofibrate (EXP)

corosolic acid (ISO)

cyclosporin A (ISO)

cylindrospermopsin (ISO)

DDT (ISO)

decabromodiphenyl ether (ISO)

deguelin (ISO)

deoxynivalenol (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

dihydroartemisinin (ISO)

dioxygen (ISO)

disodium selenite (ISO)

doxorubicin (ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

flavonoids (EXP)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

fulvestrant (ISO)

furfural (ISO)

gentamycin (EXP)

irinotecan (ISO)

ivermectin (ISO)

L-ethionine (EXP)

lead(0) (ISO)

Mesaconitine (EXP)

nickel atom (ISO)

omeprazole (EXP)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP,ISO)

picoxystrobin (ISO)

pirinixic acid (EXP)

propiconazole (ISO)

rac-lactic acid (ISO)

rotenone (EXP,ISO)

SB 431542 (ISO)

sodium arsenite (EXP,ISO)

sodium chloride (ISO)

sodium fluoride (ISO)

tetrachloromethane (EXP,ISO)

thioacetamide (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

brainstem development (IEP)

cell differentiation (IEP)

positive regulation of axon extension (IMP)

positive regulation of axonogenesis (IMP)

translation (IEA)

Cellular Component

A band (IDA)

cytoplasm (IEA,ISO)

cytosol (ISO)

cytosolic large ribosomal subunit (IBA,IDA,IEA,ISO)

cytosolic ribosome (ISO)

endoplasmic reticulum (ISO)

large ribosomal subunit (IDA)

nuclear body (ISO)

nucleolus (ISO)

nucleus (ISO)

postsynaptic density (EXP,IDA)

ribonucleoprotein complex (IEA,ISO)

ribosome (IEA)

rough endoplasmic reticulum (ISO)

Molecular Function

5S rRNA binding (IDA)

protein binding (IPI,ISO)

RNA binding (IBA)

structural constituent of ribosome (IBA,IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

ribosome biogenesis pathway (ISO)

translation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Structures of the human and Drosophila 80S ribosome.	Anger AM, etal., Nature. 2013 May 2;497(7447):80-5. doi: 10.1038/nature12104.
2.	The primary structures of rat ribosomal proteins L4 and L41.	Chan YL, etal., Biochem Biophys Res Commun 1995 Sep 25;214(3):810-8.
3.	Relative and absolute quantification of postsynaptic density proteome isolated from rat forebrain and cerebellum.	Cheng D, etal., Mol Cell Proteomics. 2006 Jun;5(6):1158-70. doi: 10.1074/mcp.D500009-MCP200. Epub 2006 Feb 28.
4.	Cold stress-induced protein Rbm3 binds 60S ribosomal subunits, alters microRNA levels, and enhances global protein synthesis.	Dresios J, etal., Proc Natl Acad Sci U S A. 2005 Feb 8;102(6):1865-70. Epub 2005 Jan 31.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	Immunological localization of ribosomes in striated rat muscle. Evidence for myofibrillar association and ontological changes in the subsarcolemmal:myofibrillar distribution.	Horne Z and Hesketh J, Biochem J. 1990 May 15;268(1):231-6.
8.	Selective high-efficiency cross-linking of mammalian ribosomal proteins with cleavable thiol-directed heterobifunctional reagents: identification and binding directions of major protein complexes.	Hultin T Biochim Biophys Acta. 1986 Aug 15;872(3):226-35.
9.	Increased expression of rat ribosomal protein L4 mRNA in 5-azacytidine-treated PC12 cells prior to apoptosis.	Kajikawa S, etal., Biochem Biophys Res Commun. 1998 Nov 9;252(1):220-4.
10.	Studies on interaction of 5 S RNA with ribosomal proteins.	Kargel HJ, etal., FEBS Lett. 1987 Aug 10;220(1):126-8.
11.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
12.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
13.	GOA pipeline	RGD automated data pipeline
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
16.	Translational control of ribosomal protein L4 mRNA is required for rapid neurite regeneration.	Twiss JL, etal., Neurobiol Dis. 2000 Aug;7(4):416-28.
17.	Expression of ribosomal protein L4 (rpL4) during neurogenesis and 5-azacytidine (5AzC)-induced apoptotic process in the rat.	Ueno M, etal., Histol Histopathol. 2002;17(3):789-98.

Additional References at PubMed

PMID:12962325	PMID:16791210	PMID:16854843	PMID:18809582	PMID:19946888	PMID:20458337	PMID:21423176	PMID:21630459	PMID:22658674	PMID:22681889	PMID:22720776	PMID:22871113
PMID:24454821	PMID:25763846	PMID:29476059	PMID:30053369	PMID:35352799

Genomics

Comparative Map Data

Rpl4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	73,566,477 - 73,571,600 (+)	NCBI		GRCr8
GRCr8 Ensembl	8	73,566,466 - 73,571,788 (+)	Ensembl		GRCr8 Ensembl
mRatBN7.2	8	64,671,177 - 64,676,301 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	64,671,160 - 64,676,306 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	70,186,011 - 70,191,135 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	68,458,602 - 68,463,726 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	66,328,589 - 66,333,713 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	69,121,682 - 69,126,805 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	69,121,682 - 69,126,805 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	68,827,918 - 68,833,041 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	68,366,802 - 68,371,925 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	8	64,077,918 - 64,083,041 (+)	NCBI		Celera
RGSC_v3.1	8	68,385,855 - 68,390,979 (+)	NCBI
Cytogenetic Map	8	q24	NCBI

RPL4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	66,498,015 - 66,504,855 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	66,498,015 - 66,524,532 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	66,790,353 - 66,797,193 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	64,578,707 - 64,584,238 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	15	64,578,707 - 64,584,238	NCBI
Celera	15	43,680,858 - 43,686,530 (-)	NCBI		Celera
Cytogenetic Map	15	q22.31	NCBI
HuRef	15	43,627,790 - 43,633,330 (-)	NCBI		HuRef
CHM1_1	15	66,909,659 - 66,915,199 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	64,319,489 - 64,326,329 (-)	NCBI		T2T-CHM13v2.0

Rpl4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	64,080,159 - 64,085,805 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	64,080,657 - 64,085,948 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	64,173,387 - 64,178,562 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	64,173,375 - 64,178,666 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	64,021,194 - 64,026,369 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	63,971,381 - 63,976,672 (+)	NCBI		MGSCv36	mm8
Celera	9	61,398,680 - 61,403,855 (+)	NCBI		Celera
Cytogenetic Map	9	C	NCBI
cM Map	9	34.54	NCBI

Rpl4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955450	9,169,648 - 9,176,604 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955450	9,170,372 - 9,175,224 (+)	NCBI	ChiLan1.0	ChiLan1.0

RPL4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	55,751,774 - 55,757,625 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	59,924,537 - 59,930,380 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	45,446,582 - 45,452,173 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	63,721,912 - 63,727,477 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	63,721,912 - 63,727,477 (-)	Ensembl	panpan1.1		panPan2

RPL4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	30,766,891 - 30,771,808 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	30,766,895 - 30,771,808 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	30,697,008 - 30,701,925 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	30,963,498 - 30,968,415 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	30,963,501 - 30,968,429 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	30,892,952 - 30,897,867 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	30,952,503 - 30,957,425 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	31,193,931 - 31,198,848 (-)	NCBI		UU_Cfam_GSD_1.0

Rpl4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	108,787,777 - 108,793,871 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	26,635,106 - 26,642,003 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936471	26,635,838 - 26,641,877 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RPL4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	164,475,357 - 164,481,534 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	164,476,269 - 164,481,765 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	182,226,366 - 182,231,693 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RPL4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	17,046,189 - 17,051,427 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666048	124,399,514 - 124,404,758 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rpl4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624781	6,209,707 - 6,214,995 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rpl4
21 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	13
Count of miRNA genes:	13
Interacting mature miRNAs:	13
Transcripts:	ENSRNOT00000013461
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39752803	84752803	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	49849908	118871671	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	39106363	103375781	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	50763951	95763951	Rat
11556286	Cm81	Cardiac mass QTL 81		0.01	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	39106258	84106258	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	51589699	99045312	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	39106363	103375781	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	44477926	89477926	Rat
4889938	Bss89	Bone structure and strength QTL 89	3.8		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	8	58991697	91341052	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	39106258	103375958	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	39106258	91341052	Rat
631210	Bw3	Body weight QTL3	5.9		mesenteric fat pad mass (VT:0010427)	mesenteric fat pad weight to body weight ratio (CMO:0000654)	8	61019838	121662124	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	63404444	108404444	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	35464071	107982864	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	47541419	92541419	Rat
61353	Bp35	Blood pressure QTL 35		0.001	arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	8	39106258	84106258	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	31543661	76543661	Rat
1359033	Bp273	Blood pressure QTL 273			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	39106258	84106258	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	50763951	107970527	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	44447837	89447837	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	49610204	94610204	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	35464071	107982864	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	55428333	127966348	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	39106363	114525825	Rat
1582254	Kidm31	Kidney mass QTL 31	3		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	8	49245178	94245178	Rat
724540	Uae8	Urinary albumin excretion QTL 8	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	8	39106258	103375958	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	62848139	107848139	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	35464071	107982864	Rat
1582243	Bw66	Body weight QTL 66	3.4	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	8	49245178	94245178	Rat
5684973	Bss100	Bone structure and strength QTL 100	4.7		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	8	58991697	91341052	Rat
61373	Mcs4	Mammary carcinoma susceptibility QTL 4	1.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	8	44475043	89475043	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	39106258	91341052	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	62848139	107848139	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	63141536	109261840	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	58337123	103337123	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	62848139	107848139	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	39106258	91341052	Rat
1331804	Cm30	Cardiac mass QTL 30	3.77443		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	8	62970527	107970527	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	62848139	107848139	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	62848139	107848139	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	62848139	107848139	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	62848139	107848139	Rat
71120	Niddm21	Non-insulin dependent diabetes mellitus QTL 21	3.73		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	8	66992095	111992095	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	60248093	105248093	Rat
2313086	Bss60	Bone structure and strength QTL 60	4.1	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	8	58991697	91341052	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	62848139	107848139	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	55428416	107963099	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	62963099	107963099	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	70041301	121080908	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	68690349	119799881	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	39106258	91341052	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	62848139	107848139	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	62982864	107982864	Rat

Markers in Region

PMC140912P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	1	206,487,299 - 206,487,454	NCBI	Rnor5.0
RGSC_v3.4	1	187,302,963 - 187,303,117	UniSTS	RGSC3.4
Celera	1	180,278,860 - 180,279,014	UniSTS
Cytogenetic Map	8	q24	UniSTS
Cytogenetic Map	1	q22	UniSTS

PMC18810P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	1	206,487,422 - 206,487,559	NCBI	Rnor5.0
RGSC_v3.4	1	187,303,086 - 187,303,222	UniSTS	RGSC3.4
Celera	1	180,278,983 - 180,279,119	UniSTS
Cytogenetic Map	18	p11	UniSTS
Cytogenetic Map	3	q35	UniSTS
Cytogenetic Map	1	q22	UniSTS
Cytogenetic Map	8	q24	UniSTS

PMC350564P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	1	206,487,427 - 206,487,551	NCBI	Rnor5.0
RGSC_v3.4	1	187,303,091 - 187,303,214	UniSTS	RGSC3.4
Celera	1	180,278,988 - 180,279,111	UniSTS
Cytogenetic Map	18	p11	UniSTS
Cytogenetic Map	3	q35	UniSTS
Cytogenetic Map	1	q22	UniSTS
Cytogenetic Map	8	q24	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_022510	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC063811	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC081801	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209448	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209532	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209571	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211151	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212557	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212566	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212656	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212694	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212896	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212979	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213045	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ213454	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215042	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215264	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215283	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215533	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215586	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215649	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216342	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216514	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216573	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216754	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216792	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218195	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218684	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219327	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219561	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219701	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ219716	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220231	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220328	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221130	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221674	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222298	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222981	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223613	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226216	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228075	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228606	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228709	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228723	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228734	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228797	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228847	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228862	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228896	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228910	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228929	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228930	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229086	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229087	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229116	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229475	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229723	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229849	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230368	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231653	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232105	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232562	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232771	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233150	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233898	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234293	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234521	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234619	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X82180	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000013461 ⟹ ENSRNOP00000013462

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	73,566,466 - 73,571,788 (+)	Ensembl
mRatBN7.2 Ensembl	8	64,671,160 - 64,676,306 (+)	Ensembl
Rnor_6.0 Ensembl	8	69,121,682 - 69,126,805 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000106792 ⟹ ENSRNOP00000083420

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	8	73,567,856 - 73,571,705 (+)	Ensembl
mRatBN7.2 Ensembl	8	64,672,556 - 64,676,306 (+)	Ensembl

RefSeq Acc Id:

NM_022510 ⟹ NP_071955

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	73,566,477 - 73,571,600 (+)	NCBI
mRatBN7.2	8	64,671,177 - 64,676,301 (+)	NCBI
Rnor_6.0	8	69,121,682 - 69,126,805 (+)	NCBI
Rnor_5.0	8	68,827,918 - 68,833,041 (+)	NCBI
RGSC_v3.4	8	68,366,802 - 68,371,925 (+)	RGD
Celera	8	64,077,918 - 64,083,041 (+)	RGD

Sequence:

show sequence

CCTGTGGGAGCAGCCGGGTAGAGAGGAGCGTGGCCTTCTCCTCTCCCCGCCATGGCTTGTGCCC
GTCCCCTCATATCGGTGTACTCTGAAAAGGGGGAGTCATCTGGCAAGAATGTCACTTTGCCAGC
TGTGTTCAAAGCTCCCATTCGACCGGATATTGTGAACTTTGTTCACACCAACTTGAGGAAGAAC
AATAGACAGCCCTATGCTGTCAGTGAATTAGCAGGTCATCAGACCAGTGCTGAGTCCTGGGGTA
CTGGTAGAGCTGTGGCTCGAATTCCAAGAGTTCGAGGTGGTGGCACCCACCGTTCTGGCCAGGG
TGCCTTTGGAAACATGTGTCGTGGAGGCCGCATGTTTGCACCAACCAAAACCTGGCGTCGTTGG
CATCGCAGAGTGAACACAACTCAGAAACGATATGCCATCTGTTCTGCCCTGGCTGCCTCGGCCT
TACCAGCTTTGGTGATGTCTAAAGGTCACTGTGTTGAGGAAGTTCCTGAACTGCCTTTGGTGGT
TGAAGATAAAGTTGAAAGTTATAAGAAGACCAAGGAGGCTGTTCAGCTGCTTAAGAAACTTAAA
GCTTGGAATGACATCAAAAAGGTCTATGCCTCCCAGAGAATGAGAGCTGGCAAGGGCAAAATGA
GAAACCGACGGCGGATCCAGCGCAGGGGACCCTGCATTATCTATAATGAAGATAATGGAATCAT
CAAGGCCTTCAGAAACATCCCTGGTATTACTCTGCTTAATGTAAGCAAGCTGAACATTTTGAAA
CTTGCTCCTGGTGGGCATGTGGGGCGTTTCTGCATTTGGACTGAAAGTGCTTTCCGGAAGTTGG
ATGAGTTGTATGGCACTTGGCGTAAGGCTGCTTCCCTCAAGAGTAACTACAACCTCCCCATGCA
CAAGATGATGAACACAGACCTTAGCAGAATCTTGAAAAGCCCAGAGATCCAAAGAGCCCTTCGA
GCACCACGCAAGAAGATTCATCGCAGAGTCTTGAAGAAGAATCCACTGAAGAATCTGAGGATCA
TGTTGAAGCTGAACCCTTACGCAAAGACTATGCGTAGGAACACCATTCTCCGCCAGGCTAGGAA
TCACAAACTTCGAGTGAAAAAGCTGGAAGCCGCAGCTGCTGCACTGGCAGCCAAATCGGAGAAG
ATTGTTCCAGAGAAGGGGGCTGGAGACAAAAAACCTGCAGTAGGCAAAAAAGGAAAGAAGCCTG
TGGATGCCAAGAAGCTGAAGAAGCCTGCAGGGAAAAAGGTGGTTACCAAGAAACCAGCAGAGAA
GAAACCTACCACAGAAGAAAAAAAGTCTGCTGCATAAACTATTAAAATTTGTTAAATTCCAGAG
AGCAAAAAGATACAGCCTATTTGAATAAATCAAAGATGCAGTG

hide sequence

Protein Sequences


Protein RefSeqs	NP_071955	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH63811	(Get FASTA)	NCBI Sequence Viewer
	AAH81801	(Get FASTA)	NCBI Sequence Viewer
	CAA57671	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000013462
GenBank Protein	P50878	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_071955 ⟸ NM_022510

- UniProtKB:

P50878 (UniProtKB/Swiss-Prot), A0A8I6GAR6 (UniProtKB/TrEMBL), Q6P3V9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MACARPLISVYSEKGESSGKNVTLPAVFKAPIRPDIVNFVHTNLRKNNRQPYAVSELAGHQTSA
ESWGTGRAVARIPRVRGGGTHRSGQGAFGNMCRGGRMFAPTKTWRRWHRRVNTTQKRYAICSAL
AASALPALVMSKGHCVEEVPELPLVVEDKVESYKKTKEAVQLLKKLKAWNDIKKVYASQRMRAG
KGKMRNRRRIQRRGPCIIYNEDNGIIKAFRNIPGITLLNVSKLNILKLAPGGHVGRFCIWTESA
FRKLDELYGTWRKAASLKSNYNLPMHKMMNTDLSRILKSPEIQRALRAPRKKIHRRVLKKNPLK
NLRIMLKLNPYAKTMRRNTILRQARNHKLRVKKLEAAAAALAAKSEKIVPEKGAGDKKPAVGKK
GKKPVDAKKLKKPAGKKVVTKKPAEKKPTTEEKKSAA

hide sequence

Ensembl Acc Id:

ENSRNOP00000013462 ⟸ ENSRNOT00000013461

Ensembl Acc Id:

ENSRNOP00000083420 ⟸ ENSRNOT00000106792

Protein Domains

Large ribosomal subunit protein uL4 C-terminal

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P50878-F1-model_v2	AlphaFold	P50878	1-421	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696064

Promoter ID:

EPDNEW_R6589

Type:

multiple initiation site

Name:

Rpl4_1

Description:

ribosomal protein L4

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	69,121,677 - 69,121,737	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619824	AgrOrtholog
BioCyc Gene	G2FUF-30116	BioCyc
Ensembl Genes	ENSRNOG00000009378	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000013461	ENTREZGENE
Gene3D-CATH	3.40.1370.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6919340	IMAGE-MGC_LOAD
	IMAGE:7192390	IMAGE-MGC_LOAD
InterPro	Ribos_L4_C_dom	UniProtKB/Swiss-Prot
	Ribosomal_L4/L1e	UniProtKB/Swiss-Prot
	Ribosomal_L4/L1e_euk/arc_CS	UniProtKB/Swiss-Prot
	Ribosomal_L4_dom_sf	UniProtKB/Swiss-Prot
	Ribosomal_L4_euk/arch	UniProtKB/Swiss-Prot
KEGG Report	rno:64302	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72833	IMAGE-MGC_LOAD
	MGC:93439	IMAGE-MGC_LOAD
NCBI Gene	64302	ENTREZGENE
PANTHER	PTHR19431	UniProtKB/Swiss-Prot
Pfam	Ribos_L4_asso_C	UniProtKB/Swiss-Prot
	Ribosomal_L4	UniProtKB/Swiss-Prot
PhenoGen	Rpl4	PhenoGen
PROSITE	RIBOSOMAL_L1E	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000009378	RatGTEx
Superfamily-SCOP	SSF52166	UniProtKB/Swiss-Prot
UniProt	A0A8I6GAR6	ENTREZGENE, UniProtKB/TrEMBL
	P50878	ENTREZGENE
	Q6P3V9	ENTREZGENE, UniProtKB/TrEMBL
	RL4_RAT	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-09-10	Rpl4	ribosomal protein L4			Symbol and Name status set to approved	1299863	APPROVED
2002-08-07	Rpl4	ribosomal protein L4			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_protein	421 amino acids	633919

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations