Suclg1 (succinate-CoA ligase GDP/ADP-forming subunit alpha)

Advanced Search (OLGA)

Gene: Suclg1 (succinate-CoA ligase GDP/ADP-forming subunit alpha) Rattus norvegicus

Analyze

Symbol:

Suclg1

Name:

succinate-CoA ligase GDP/ADP-forming subunit alpha

RGD ID:

619821

Description:

Enables GDP binding activity; succinate-CoA ligase (ADP-forming) activity; and succinate-CoA ligase (GDP-forming) activity. Involved in succinate metabolic process; succinyl-CoA metabolic process; and tricarboxylic acid cycle. Part of succinate-CoA ligase complex (GDP-forming). Human ortholog(s) of this gene implicated in mitochondrial DNA depletion syndrome 9. Orthologous to human SUCLG1 (succinate-CoA ligase GDP/ADP-forming subunit alpha); PARTICIPATES IN citric acid cycle pathway; fumaric aciduria pathway; mitochondrial complex II deficiency pathway; INTERACTS WITH (+)-schisandrin B; 2,3,7,8-tetrachlorodibenzodioxine; 5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

SCS-alpha; succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial; succinate-CoA ligase, alpha subunit; succinate-CoA ligase, GDP-forming alpha subunit; succinate-CoA ligase, GDP-forming, alpha subunit; succinyl-CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial; succinyl-CoA ligase [GDP-forming] subunit alpha, mitochondrial; succinyl-CoA synthetase alpha subunit; succinyl-CoA synthetase subunit alpha

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SUCLG1 (succinate-CoA ligase GDP/ADP-forming subunit alpha)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Suclg1 (succinate-CoA ligase, GDP-forming, alpha subunit)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Suclg1 (succinate-CoA ligase GDP/ADP-forming subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SUCLG1 (succinate-CoA ligase GDP/ADP-forming subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SUCLG1 (succinate-CoA ligase GDP/ADP-forming subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Suclg1 (succinate-CoA ligase GDP/ADP-forming subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SUCLG1 (succinate-CoA ligase GDP/ADP-forming subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SUCLG1 (succinate-CoA ligase GDP/ADP-forming subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Suclg1 (succinate-CoA ligase GDP/ADP-forming subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Rattus rattus (black rat):	Suclg1 (succinate-CoA ligase GDP/ADP-forming subunit alpha)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SUCLG1 (succinate-CoA ligase GDP/ADP-forming subunit alpha)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Suclg1 (succinate-CoA ligase, GDP-forming, alpha subunit)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	suclg1 (succinate-CoA ligase, alpha subunit)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	LSC1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Scsalpha1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Scsalpha2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	Scsalpha2	Alliance	DIOPT (Hieranoid\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	sucl-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	sucl-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	suclg1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	106,866,329 - 106,895,686 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	106,866,114 - 106,895,689 (+)	Ensembl				GRCr8
mRatBN7.2	4	105,308,236 - 105,337,595 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	105,308,039 - 105,337,600 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	110,679,963 - 110,709,281 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	106,455,073 - 106,484,379 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	105,075,992 - 105,105,347 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	101,181,315 - 101,210,692 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	101,180,404 - 101,210,746 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	165,937,922 - 165,967,277 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	106,572,140 - 106,601,495 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	94,449,454 - 94,478,818 (+)	NCBI		Celera
RGSC_v3.1	8	36,133,697 - 36,137,263 (-)	NCBI
Cytogenetic Map	4	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Disease Progression (ISO)

genetic disease (ISO)

mitochondrial DNA depletion syndrome (ISO)

mitochondrial DNA depletion syndrome 9 (ISO)

Stomach Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dimethoxyphenol (ISO)

2-hydroxypropanoic acid (ISO)

3,3',4,4'-tetrachlorobiphenyl (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxynon-2-enal (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (ISO)

aflatoxin B1 (ISO)

amiodarone (EXP,ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

benzatropine (ISO)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

beta-naphthoflavone (EXP)

bezafibrate (EXP)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbon nanotube (ISO)

clofibrate (EXP,ISO)

clozapine (ISO)

copper(II) sulfate (ISO)

dexamethasone (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (EXP)

dicrotophos (ISO)

disodium selenite (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

fenbendazole (ISO)

fenofibrate (EXP,ISO)

finasteride (EXP)

folic acid (ISO)

furfural (ISO)

gentamycin (EXP)

indometacin (EXP)

isoniazide (ISO)

isotretinoin (ISO)

ivermectin (ISO)

L-ethionine (EXP)

lead diacetate (ISO)

methidathion (ISO)

methoxychlor (EXP)

morphine (EXP)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodiethylamine (EXP)

nobiletin (ISO)

omeprazole (EXP)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (EXP,ISO)

perfluorooctanoic acid (EXP,ISO)

phenylpropanolamine (ISO)

pirinixic acid (EXP,ISO)

pregnenolone 16alpha-carbonitrile (EXP)

rac-lactic acid (ISO)

resveratrol (ISO)

rotenone (EXP)

SB 431542 (ISO)

sodium arsenate (ISO)

sodium arsenite (EXP,ISO)

sodium chloride (ISO)

sodium fluoride (ISO)

Soman (EXP)

sulindac (EXP)

sunitinib (ISO)

tetrachloromethane (EXP)

thioacetamide (EXP)

tributylstannane (ISO)

tungsten (ISO)

valproic acid (ISO)

vincaleukoblastine (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

succinate metabolic process (IDA)

succinyl-CoA metabolic process (IDA)

tricarboxylic acid cycle (IBA,IDA,IEA,ISO)

Cellular Component

mitochondrial matrix (ISO)

mitochondrion (IBA,IEA)

protein-containing complex (IDA)

succinate-CoA ligase complex (ADP-forming) (IBA)

succinate-CoA ligase complex (GDP-forming) (IDA,IEA,ISO)

Molecular Function

catalytic activity (IEA)

GDP binding (IDA)

ligase activity (IEA)

nucleotide binding (IEA)

protein binding (ISO)

protein-containing complex binding (IDA)

succinate-CoA ligase (ADP-forming) activity (IBA,IDA,IEA,ISO)

succinate-CoA ligase (GDP-forming) activity (IBA,IDA,IEA)

succinate-CoA ligase activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

citric acid cycle pathway (IDA,IEA,ISO)

fumaric aciduria pathway (ISO)

mitochondrial complex II deficiency pathway (ISO)

propanoate metabolic pathway (IEA)

pyruvate dehydrogenase E2 deficiency pathway (ISO)

pyruvate dehydrogenase E3 deficiency pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Affinity chromatography and affinity labeling of rat liver succinyl-CoA synthetase.	Ball DJ and Nishimura JS, J Biol Chem. 1980 Nov 25;255(22):10805-12.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Cloning and sequencing of the cytoplasmic precursor to the alpha subunit of rat liver mitochondrial succinyl-CoA synthetase.	Henning WD, etal., Proc Natl Acad Sci U S A 1988 Mar;85(5):1432-6.
5.	Mitochondrial GTP regulates glucose-stimulated insulin secretion.	Kibbey RG, etal., Cell Metab. 2007 Apr;5(4):253-64.
6.	Localization and characterization of the mitochondrial isoform of the nucleoside diphosphate kinase in the pancreatic beta cell: evidence for its complexation with mitochondrial succinyl-CoA synthetase.	Kowluru A, etal., Arch Biochem Biophys. 2002 Feb 15;398(2):160-9.
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
10.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
11.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
12.	GOA pipeline	RGD automated data pipeline
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:10559001	PMID:12865426	PMID:14651853	PMID:16854843	PMID:18614015	PMID:22658674	PMID:23376485	PMID:26316108	PMID:29476059	PMID:30053369	PMID:31505169

Genomics

Comparative Map Data

Suclg1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	4	106,866,329 - 106,895,686 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	4	106,866,114 - 106,895,689 (+)	Ensembl				GRCr8
mRatBN7.2	4	105,308,236 - 105,337,595 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	105,308,039 - 105,337,600 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	4	110,679,963 - 110,709,281 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	106,455,073 - 106,484,379 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	105,075,992 - 105,105,347 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	101,181,315 - 101,210,692 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	101,180,404 - 101,210,746 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	4	165,937,922 - 165,967,277 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	4	106,572,140 - 106,601,495 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	4	94,449,454 - 94,478,818 (+)	NCBI		Celera
RGSC_v3.1	8	36,133,697 - 36,137,263 (-)	NCBI
Cytogenetic Map	4	q32	NCBI

SUCLG1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	84,423,528 - 84,459,280 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	84,423,528 - 84,460,045 (-)	Ensembl			hg38	GRCh38
GRCh37	2	84,650,652 - 84,686,404 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	84,504,163 - 84,540,097 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	2	84,562,333 - 84,598,043	NCBI
Celera	2	84,479,456 - 84,515,401 (-)	NCBI		Celera
Cytogenetic Map	2	p11.2	NCBI
HuRef	2	84,546,643 - 84,582,492 (-)	NCBI		HuRef
CHM1_1	2	84,580,608 - 84,616,546 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	84,425,228 - 84,460,977 (-)	NCBI		T2T-CHM13v2.0

Suclg1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	73,225,488 - 73,253,890 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	73,225,365 - 73,253,894 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	6	73,248,505 - 73,276,907 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	73,248,382 - 73,276,911 (+)	Ensembl			mm10	GRCm38
MGSCv37	6	73,198,499 - 73,226,901 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	6	73,178,182 - 73,206,391 (+)	NCBI		MGSCv36	mm8
Celera	6	75,301,953 - 75,330,652 (+)	NCBI		Celera
Cytogenetic Map	6	C1	NCBI
cM Map	6	32.4	NCBI

Suclg1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955424	2,810,557 - 2,842,036 (+)	Ensembl
ChiLan1.0	NW_004955424	2,810,557 - 2,838,827 (+)	NCBI	ChiLan1.0	ChiLan1.0

SUCLG1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	12	41,918,257 - 41,954,439 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2A	41,921,021 - 41,957,203 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	84,476,814 - 84,512,920 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	86,035,506 - 86,071,537 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	86,035,723 - 86,066,622 (-)	Ensembl			panPan2	panpan1.1

SUCLG1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	40,392,969 - 40,424,875 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	40,393,178 - 40,424,711 (+)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	40,072,920 - 40,104,818 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	41,200,797 - 41,232,708 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	41,200,984 - 41,232,708 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	40,277,386 - 40,309,286 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	40,340,635 - 40,372,518 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	40,741,593 - 40,773,497 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Suclg1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	869,277 - 904,045 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936650	3,275,019 - 3,313,599 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936650	3,278,769 - 3,313,537 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SUCLG1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	60,142,435 - 60,177,378 (+)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	3	60,142,340 - 60,177,497 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	63,138,718 - 63,174,813 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SUCLG1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	22,712,622 - 22,748,648 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	22,712,661 - 22,748,845 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666045	89,647,622 - 89,683,679 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Suclg1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624749	18,551,188 - 18,583,183 (+)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624749	18,552,154 - 18,580,676 (+)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Suclg1
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	6	73,271,289 - 73,301,385 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Suclg1
455 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	34
Count of miRNA genes:	31
Interacting mature miRNAs:	33
Transcripts:	ENSRNOT00000007624
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1582232	Gluco25	Glucose level QTL 25	3.6	0.0023	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	86583980	149763391	Rat
631689	Scl4	Serum cholesterol level QTL 4	1.9	0.008	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	96731383	141731383	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	39431983	123203361	Rat
1578655	Bmd11	Bone mineral density QTL 11	11		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	4	92406430	137406430	Rat
10755501	Bp390	Blood pressure QTL 390	2.5		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	27730518	170099664	Rat
1357342	Bw40	Body weight QTL 40		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	4	74233320	119233320	Rat
631556	Bp135	Blood pressure QTL 135		0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	80212111	119233320	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	26234499	134199155	Rat
70167	Bw22	Body weight QTL 22	3.1		body mass (VT:0001259)	body weight (CMO:0000012)	4	74233320	119233320	Rat
737821	Hcar9	Hepatocarcinoma resistance QTL 9	3.7		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	106848959	168870974	Rat
1549839	Bw52	Body weight QTL 52		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	71647492	116647492	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82944895	154403548	Rat
6909128	Pancm4	Pancreatic morphology QTL 4	11.35		pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	4	27862204	126119996	Rat
61476	Aia3	Adjuvant induced arthritis QTL 3	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	75939858	140508796	Rat
1641919	Alc22	Alcohol consumption QTL 22		0.0005	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	65060960	127749483	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	45429897	149763204	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	51085655	113588029	Rat
1578670	Bss14	Bone structure and strength QTL 14	16.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	4	88883695	133883695	Rat
2317588	Eae27	Experimental allergic encephalomyelitis QTL 27			nervous system integrity trait (VT:0010566)	percentage of study population developing experimental autoimmune encephalomyelitis during a period of time (CMO:0001047)	4	69036742	114036742	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	40490442	117737312	Rat
70201	Gcr1	Gastric cancer resistance QTL 1	2.7		stomach morphology trait (VT:0000470)	stomach tumor susceptibility score (CMO:0002043)	4	103834277	148834277	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	57613339	151163960	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	12212457	182430611	Rat
6478684	Anxrr30	Anxiety related response QTL 30		0.00087	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	64084079	109084079	Rat
1578662	Bss15	Bone structure and strength QTL 15	19.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	4	88883695	133883695	Rat
2306547	Iddm38	Insulin dependent diabetes mellitus QTL 38			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	68353567	113353567	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	60916264	184426481	Rat
2306545	Iddm39	Insulin dependent diabetes mellitus QTL 39			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	78687630	123687630	Rat
6478772	Anxrr49	Anxiety related response QTL 49		0.15488	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	64084079	109084079	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	94638356	168870820	Rat
631646	Stl4	Serum triglyceride level QTL 4	6.5	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	4	74169813	134199155	Rat
634334	Xhs3	X-ray hypersensitivity QTL 3	10		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	86058928	131411333	Rat
61406	Scwia1	Streptococcal cell wall induced arthritis QTL 1	2.3		joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	4	75939858	140508796	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	45429897	149763204	Rat
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5889999	148002343	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	174095838	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	100752691	179366077	Rat
631662	Hcar2	Hepatocarcinoma resistance QTL 2	3.1	0.0003	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	84349032	129349032	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	45429709	157555683	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	63245026	129846354	Rat
631651	Bp124	Blood pressure QTL 124	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	64209744	109209744	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	60916264	184426481	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	86709649	168870974	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	57664252	127749483	Rat
2306899	Bp338	Blood pressure QTL 338		0.071	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	82336765	127336765	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	65495851	159259805	Rat
6478743	Anxrr40	Anxiety related response QTL 40		0.83076	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	64084079	109084079	Rat
12798523	Anxrr56	Anxiety related response QTL 56	2.83	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	86583980	131583980	Rat
61434	Cia3	Collagen induced arthritis QTL 3	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	63224393	108224393	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	33538597	116185060	Rat

Markers in Region

D4Got273

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	105,320,244 - 105,320,446 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	101,193,341 - 101,193,540	NCBI	Rnor6.0
Rnor_5.0	4	165,949,931 - 165,950,130	UniSTS	Rnor5.0
RGSC_v3.4	4	106,584,149 - 106,584,348	UniSTS	RGSC3.4
Celera	4	94,461,463 - 94,461,672	UniSTS
Cytogenetic Map	4	q33	UniSTS

RH129077

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	105,317,070 - 105,317,250 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	101,190,167 - 101,190,346	NCBI	Rnor6.0
Rnor_5.0	4	165,946,757 - 165,946,936	UniSTS	Rnor5.0
RGSC_v3.4	4	106,580,975 - 106,581,154	UniSTS	RGSC3.4
Celera	4	94,458,289 - 94,458,468	UniSTS
RH 3.4 Map	4	652.42	UniSTS
Cytogenetic Map	4	q33	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	165	91	90	59	92	59	6	356	192	11	144	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053752	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008762973	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AH003693	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061537	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473957	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212668	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214532	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215028	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215469	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216826	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216893	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ217244	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000007624 ⟹ ENSRNOP00000007624

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	106,866,114 - 106,895,689 (+)	Ensembl
mRatBN7.2 Ensembl	4	105,308,039 - 105,337,598 (+)	Ensembl
Rnor_6.0 Ensembl	4	101,180,404 - 101,210,746 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096453 ⟹ ENSRNOP00000089480

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	106,873,693 - 106,894,820 (+)	Ensembl
mRatBN7.2 Ensembl	4	105,315,600 - 105,336,729 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000099700 ⟹ ENSRNOP00000096556

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	105,315,526 - 105,337,600 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000105574 ⟹ ENSRNOP00000086059

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	4	106,866,114 - 106,894,820 (+)	Ensembl
mRatBN7.2 Ensembl	4	105,308,039 - 105,336,729 (+)	Ensembl

RefSeq Acc Id:

NM_053752 ⟹ NP_446204

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	4	106,866,329 - 106,895,686 (+)	NCBI
mRatBN7.2	4	105,308,236 - 105,337,595 (+)	NCBI
Rnor_6.0	4	101,181,332 - 101,210,687 (+)	NCBI
Rnor_5.0	4	165,937,922 - 165,967,277 (+)	NCBI
RGSC_v3.4	4	106,572,140 - 106,601,495 (+)	RGD
Celera	4	94,449,454 - 94,478,818 (+)	RGD

Sequence:

show sequence

GTCATTGGGGGAATGACCGCAGCGGTAGTTGCTGCGGCTGCCACTGCAACCATGGTCTCCGGCA
GCAGCGGCCTTGCCGCCGCCCGCCTGCTGTCGCGCACCTTCCTCCTGCAACAGAATGGAATACG
GCACGGGTCTTACACAGCCTCTCGGAAAAATATCTATATTGATAAAAATACGAAGGTTATTTGC
CAGGGTTTCACAGGCAAGCAGGGTACCTTTCACAGCCAGCAGGCTTTGGAGTACGGCACCAAAC
TCGTGGGAGGAACCACTCCAGGGAAAGGGGGCAAGAAGCACCTGGGCTTACCTGTCTTTAATAC
TGTGAAGGAAGCCAAAGAGAAAACAGGAGCGACAGCTTCTGTCATTTATGTCCCTCCTCCTTTC
GCTGCTGCCGCCATCAATGAAGCAATTGACGCAGAGATTCCCTTGGTTGTGTGCATTACTGAAG
GTATTCCGCAGCAGGACATGGTGCGGGTCAAGCACAAGCTGACACGCCAGGGGAAGACGAGGCT
AATTGGGCCAAACTGCCCCGGTATCATCAACCCTGGAGAATGCAAAATCGGCATCATGCCTGGC
CACATTCACAAGAAAGGAAGAATAGGTATCGTGTCCAGGTCCGGTACTCTGACTTATGAAGCAG
TTCACCAAACAACCCAAGTTGGATTGGGGCAGTCCTTGTGTATTGGCATTGGAGGTGACCCTTT
TAATGGGACTAATTTTATTGATTGCCTTGACGTCTTCCTGAAGGATCCAGCTACAGAAGGCATC
GTACTGATTGGTGAAATTGGTGGTCACGCTGAAGAAAATGCTGCGGAGTTTCTGAAGGAGCATA
ACTCAGGTCCAAAGGCCAAGCCTGTAGTGTCCTTCATTGCTGGTATAACTGCTCCTCCTGGCAG
AAGGATGGGCCACGCAGGGGCGATTATTGCTGGAGGAAAAGGTGGCGCCAAAGAGAAGATCTCT
GCTCTTCAGAGTGCGGGTGTAATTGTCAGCATGTCCCCCGCACAGCTGGGAACCTGCATGTATA
AGGAATTTGAAAAGAGGAAGATGCTTTGAAGGACACGACATGAATTTTAAGGCTGTGGAGGAAA
TCTCACAGACTGGAGAGCCCGTCCAGACTGCAGCCCAGGCACCTGACCCTGGTCTCTCAGTACA
GGGGAAGTCCAGGCACGTTTTAGAATGTCCTAAATTGAGCTATTTTCACTTACTGTGTAACAGA
GACAGATAATAAATCTATCATTTGATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_446204	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB18748	(Get FASTA)	NCBI Sequence Viewer
	AAF88164	(Get FASTA)	NCBI Sequence Viewer
	AAH61537	(Get FASTA)	NCBI Sequence Viewer
	EDL91058	(Get FASTA)	NCBI Sequence Viewer
	EDL91059	(Get FASTA)	NCBI Sequence Viewer
	EDL91060	(Get FASTA)	NCBI Sequence Viewer
	EDL91061	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000007624
GenBank Protein	P13086	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_446204 ⟸ NM_053752
- Peptide Label:	precursor
- UniProtKB:	Q6P7S4 (UniProtKB/Swiss-Prot), P13086 (UniProtKB/Swiss-Prot), A0A0H2UHE1 (UniProtKB/TrEMBL), A6IAE0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MTAAVVAAAATATMVSGSSGLAAARLLSRTFLLQQNGIRHGSYTASRKNIYIDKNTKVICQGFT GKQGTFHSQQALEYGTKLVGGTTPGKGGKKHLGLPVFNTVKEAKEKTGATASVIYVPPPFAAAA INEAIDAEIPLVVCITEGIPQQDMVRVKHKLTRQGKTRLIGPNCPGIINPGECKIGIMPGHIHK KGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCIGIGGDPFNGTNFIDCLDVFLKDPATEGIVLIG EIGGHAEENAAEFLKEHNSGPKAKPVVSFIAGITAPPGRRMGHAGAIIAGGKGGAKEKISALQS AGVIVSMSPAQLGTCMYKEFEKRKML hide sequence

Ensembl Acc Id:

ENSRNOP00000007624 ⟸ ENSRNOT00000007624

Ensembl Acc Id:

ENSRNOP00000086059 ⟸ ENSRNOT00000105574

Ensembl Acc Id:

ENSRNOP00000096556 ⟸ ENSRNOT00000099700

Ensembl Acc Id:

ENSRNOP00000089480 ⟸ ENSRNOT00000096453

Protein Domains

ATP-citrate synthase/succinyl-CoA ligase C-terminal CoA-binding

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P13086-F1-model_v2	AlphaFold	P13086	1-346	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619821	AgrOrtholog
BioCyc Gene	G2FUF-44120	BioCyc
Ensembl Genes	ENSRNOG00000005587	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000007624	ENTREZGENE
Gene3D-CATH	3.40.50.261	UniProtKB/Swiss-Prot
	NAD(P)-binding Rossmann-like Domain	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:6920009	IMAGE-MGC_LOAD
InterPro	Cit_synth/succinyl-CoA_lig_AS	UniProtKB/Swiss-Prot
	Citrt_syn/SCS-alpha_CS	UniProtKB/Swiss-Prot
	CoA-bd	UniProtKB/Swiss-Prot
	CoA_lig_alpha	UniProtKB/Swiss-Prot
	CoA_ligase	UniProtKB/Swiss-Prot
	NAD(P)-bd_dom_sf	UniProtKB/Swiss-Prot
	Succinyl-CoA_synth-like	UniProtKB/Swiss-Prot
KEGG Report	rno:114597	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72737	IMAGE-MGC_LOAD
NCBI Gene	114597	ENTREZGENE
PANTHER	SUCCINATE--COA LIGASE [ADP/GDP-FORMING] SUBUNIT ALPHA, MITOCHONDRIAL	UniProtKB/Swiss-Prot
	SUCCINYL-COA LIGASE SUBUNIT ALPHA	UniProtKB/Swiss-Prot
Pfam	CoA_binding	UniProtKB/Swiss-Prot
	Ligase_CoA	UniProtKB/Swiss-Prot
PhenoGen	Suclg1	PhenoGen
PIRSF	SucCS_alpha	UniProtKB/Swiss-Prot
PRINTS	SCOASYNTHASE	UniProtKB/Swiss-Prot
PROSITE	SUCCINYL_COA_LIG_1	UniProtKB/Swiss-Prot
	SUCCINYL_COA_LIG_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000005587	RatGTEx
SMART	CoA_binding	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF51735	UniProtKB/Swiss-Prot
	SSF52210	UniProtKB/Swiss-Prot
UniProt	A0A0H2UHE1	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6A4L2_RAT	UniProtKB/TrEMBL
	A0A8I6AAD9_RAT	UniProtKB/TrEMBL
	A6IAE0	ENTREZGENE, UniProtKB/TrEMBL
	A6IAE1_RAT	UniProtKB/TrEMBL
	A6IAE2_RAT	UniProtKB/TrEMBL
	A6IAE3_RAT	UniProtKB/TrEMBL
	P13086	ENTREZGENE
	Q6P7S4	ENTREZGENE
	SUCA_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q6P7S4	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-12-06	Suclg1	succinate-CoA ligase GDP/ADP-forming subunit alpha	Suclg1	succinate-CoA ligase, alpha subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-10-23	Suclg1	succinate-CoA ligase, alpha subunit	Suclg1	succinate-CoA ligase, GDP-forming, alpha subunit	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-02-26	Suclg1	succinate-CoA ligase, GDP-forming, alpha subunit			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Suclg1	succinate-CoA ligase, GDP-forming, alpha subunit			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_other	alpha and beta subunits of the succinate-CoA ligase enzyme are encoded by separate genes	634078

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)