Bbox1 (gamma-butyrobetaine hydroxylase 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Bbox1 (gamma-butyrobetaine hydroxylase 1) Rattus norvegicus

Analyze

Symbol:

Bbox1

Name:

gamma-butyrobetaine hydroxylase 1

RGD ID:

619756

Description:

Enables gamma-butyrobetaine dioxygenase activity. Predicted to be involved in carnitine biosynthetic process. Predicted to be located in cytoplasm. Predicted to be active in mitochondrion. Orthologous to human BBOX1 (gamma-butyrobetaine hydroxylase 1); PARTICIPATES IN carnitine biosynthetic pathway; lysine degradation pathway; INTERACTS WITH (+)-schisandrin B; 1-benzylpiperazine; 1-naphthyl isothiocyanate.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Bbh; Bbox; butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1; butyrobetaine (gamma), 2-oxoglutarate dioxygenase 1 (gamma-butyrobetaine hydroxylase); gamma butyrobetaine hydroxylase; gamma-BBH; gamma-butyrobetaine dioxygenase; gamma-butyrobetaine hydroxylase; gamma-butyrobetaine,2-oxoglutarate dioxygenase

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	BBOX1 (gamma-butyrobetaine hydroxylase 1)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, Panther
Mus musculus (house mouse):	Bbox1 (butyrobetaine (gamma), 2-oxoglutarate dioxygenase 1 (gamma-butyrobetaine hydroxylase))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Bbox1 (gamma-butyrobetaine hydroxylase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	BBOX1 (gamma-butyrobetaine hydroxylase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	BBOX1 (gamma-butyrobetaine hydroxylase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Bbox1 (gamma-butyrobetaine hydroxylase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	BBOX1 (gamma-butyrobetaine hydroxylase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	BBOX1 (gamma-butyrobetaine hydroxylase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Bbox1 (gamma-butyrobetaine hydroxylase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ISOC1 (isochorismatase domain containing 1)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	BBOX1 (gamma-butyrobetaine hydroxylase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Bbox1 (butyrobetaine (gamma), 2-oxoglutarate dioxygenase 1 (gamma-butyrobetaine hydroxylase))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	bbox1 (butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	AIM17	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoInspector\|PANTHER)
Drosophila melanogaster (fruit fly):	CG10814	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG14630	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG5321	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	gbh-1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	bbox1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	96,822,654 - 96,871,786 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	96,822,655 - 96,871,458 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	100,395,476 - 100,434,388 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	3	108,994,430 - 109,033,342 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	3	106,746,656 - 106,785,585 (-)	NCBI	Rnor_WKY
Rnor_6.0	3	101,425,684 - 101,474,848 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	101,427,055 - 101,474,890 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	108,023,621 - 108,070,883 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	95,747,735 - 95,786,852 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	95,644,162 - 95,683,280 (-)	NCBI
Celera	3	95,835,564 - 95,874,303 (-)	NCBI		Celera
Cytogenetic Map	3	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Experimental Liver Cirrhosis (ISO)

genetic disease (ISO)

intellectual disability (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

(R)-carnitine (ISO)

1-benzylpiperazine (EXP)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,4,7,8-Pentachlorodibenzofuran (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

3,3',4,4'-tetrachlorobiphenyl (ISO)

4,4'-diaminodiphenylmethane (EXP)

4-(trimethylammonio)butanoate (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

aluminium atom (ISO)

aluminium(0) (ISO)

amiodarone (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP)

CGP 52608 (ISO)

cisplatin (ISO)

coumarin (EXP)

cycloheximide (ISO)

cyclosporin A (ISO)

D-mannitol (ISO)

doxorubicin (ISO)

endosulfan (ISO)

flutamide (EXP)

glafenine (EXP)

hydrogen peroxide (ISO)

isoniazide (ISO)

lead(0) (ISO)

lead(2+) (ISO)

lipopolysaccharide (ISO)

metacetamol (ISO)

methapyrilene (EXP)

methylmercury chloride (ISO)

N-nitrosodiethylamine (EXP)

N-nitrosodimethylamine (EXP)

nefazodone (EXP)

nimesulide (EXP)

nitrofen (EXP)

O-methyleugenol (ISO)

ochratoxin A (ISO)

ozone (EXP)

paracetamol (ISO)

paraquat (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phenobarbital (ISO)

pirinixic acid (ISO)

potassium bromate (ISO)

potassium dichromate (ISO)

propiconazole (ISO)

Propiverine (EXP)

resveratrol (EXP,ISO)

rotenone (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium dichromate (EXP)

streptozocin (EXP)

succimer (ISO)

Tesaglitazar (EXP)

tetrachloromethane (EXP,ISO)

tetracycline (ISO)

thioacetamide (EXP)

tolcapone (EXP)

troglitazone (EXP)

valdecoxib (EXP)

valproic acid (EXP,ISO)

vancomycin (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

carnitine biosynthetic process (IBA,IEA,ISO,ISS,TAS)

Cellular Component

cytoplasm (IEA)

mitochondrion (IBA)

Molecular Function

gamma-butyrobetaine dioxygenase activity (IBA,IEA,IMP,ISO,ISS,TAS)

identical protein binding (IEA,ISO)

iron ion binding (IEA)

protein binding (ISO)

zinc ion binding (IEA,ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

carnitine biosynthetic pathway (ISO)

lysine degradation pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Molecular cloning and characterization of the cDNA encoding the rat liver gamma-butyrobetaine hydroxylase.	Galland S, etal., Biochim Biophys Acta 1999 Oct 18;1441(1):85-92.
2.	Thyroid hormone controls carnitine status through modifications of gamma-butyrobetaine hydroxylase activity and gene expression.	Galland S, etal., Cell Mol Life Sci 2002 Mar;59(3):540-5.
3.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Carnitine biosynthesis: identification of the cDNA encoding human gamma-butyrobetaine hydroxylase.	Vaz FM, etal., Biochem Biophys Res Commun. 1998 Sep 18;250(2):506-10.

Additional References at PubMed

PMID:15795431	PMID:18614015	PMID:19056867	PMID:19150623	PMID:20599753	PMID:22014179	PMID:23127966	PMID:23376485	PMID:25416956

Genomics

Comparative Map Data

Bbox1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	96,822,654 - 96,871,786 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	96,822,655 - 96,871,458 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	100,395,476 - 100,434,388 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	3	108,994,430 - 109,033,342 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	3	106,746,656 - 106,785,585 (-)	NCBI	Rnor_WKY
Rnor_6.0	3	101,425,684 - 101,474,848 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	101,427,055 - 101,474,890 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	108,023,621 - 108,070,883 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	95,747,735 - 95,786,852 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	95,644,162 - 95,683,280 (-)	NCBI
Celera	3	95,835,564 - 95,874,303 (-)	NCBI		Celera
Cytogenetic Map	3	q34	NCBI

BBOX1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	27,040,815 - 27,127,809 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	11	27,040,725 - 27,127,809 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	27,062,362 - 27,149,356 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	27,019,085 - 27,105,930 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	27,019,573 - 27,105,930	NCBI
Celera	11	27,207,166 - 27,294,016 (+)	NCBI		Celera
Cytogenetic Map	11	p14.2	NCBI
HuRef	11	26,759,908 - 26,847,062 (+)	NCBI		HuRef
CHM1_1	11	27,061,931 - 27,148,767 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	11	27,181,297 - 27,268,300 (+)	NCBI		T2T-CHM13v2.0

Bbox1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	110,094,401 - 110,145,158 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	110,093,042 - 110,144,905 (-)	Ensembl		GRCm39 Ensembl
GRCm38	2	110,264,056 - 110,314,813 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	110,262,697 - 110,314,560 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	110,105,240 - 110,145,882 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	110,065,922 - 110,106,564 (-)	NCBI		MGSCv36	mm8
Celera	2	111,425,130 - 111,465,702 (-)	NCBI		Celera
Cytogenetic Map	2	E3	NCBI

Bbox1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955476	6,368,842 - 6,433,797 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955476	6,368,842 - 6,433,797 (+)	NCBI	ChiLan1.0	ChiLan1.0

BBOX1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	11	29,241,841 - 29,330,440 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	26,995,120 - 27,083,832 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	26,898,529 - 26,986,705 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	26,898,529 - 26,986,705 (+)	Ensembl	panpan1.1		panPan2

BBOX1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	21	47,707,648 - 47,766,732 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	21	47,706,717 - 47,766,503 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	21	47,198,477 - 47,257,514 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	21	48,848,545 - 48,906,661 (+)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	21	47,834,272 - 47,892,256 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	21	48,002,172 - 48,061,307 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	21	48,588,367 - 48,647,500 (+)	NCBI		UU_Cfam_GSD_1.0

Bbox1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	36,893,678 - 36,958,956 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936540	6,048,472 - 6,153,731 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936540	6,048,481 - 6,113,627 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BBOX1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	33,227,974 - 33,296,559 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	33,227,965 - 33,296,013 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	35,864,213 - 35,883,328 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

BBOX1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	37,970,238 - 38,063,854 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	1	37,967,283 - 38,062,244 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	135,283,933 - 135,376,803 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Bbox1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624766	16,903,323 - 16,957,584 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624766	16,903,327 - 16,962,176 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Bbox1
220 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	17
Count of miRNA genes:	17
Interacting mature miRNAs:	17
Transcripts:	ENSRNOT00000006197
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	30356773	98535386	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	104104347	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	41874578	104104347	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	64655305	115665732	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	64655305	115665732	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	73376539	118376539	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
2302273	Gluco35	Glucose level QTL 35	5.3	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	80800231	114297550	Rat
631649	Bp123	Blood pressure QTL 123	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	89772419	134772419	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	91797474	136797474	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat
1582252	Sual1	Serum uric acid level QTL 1	3.4	0.0123	blood uric acid amount (VT:0010302)	blood uric acid level (CMO:0000501)	3	96127817	102200699	Rat
1582219	Bw63	Body weight QTL 63	3.8	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	3	96127817	115665732	Rat

Markers in Region

RH131044

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	96,822,676 - 96,822,880 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	101,425,711 - 101,425,914	NCBI	Rnor6.0
Rnor_5.0	3	108,022,280 - 108,022,483	UniSTS	Rnor5.0
RGSC_v3.4	3	95,746,394 - 95,746,597	UniSTS	RGSC3.4
Celera	3	95,834,223 - 95,834,426	UniSTS
RH 3.4 Map	3	765.3	UniSTS
Cytogenetic Map	3	q33	UniSTS

AI170038

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	3	96,822,923 - 96,823,080 (+)	MAPPER	mRatBN7.2
Rnor_6.0	3	101,425,958 - 101,426,114	NCBI	Rnor6.0
Rnor_5.0	3	108,022,527 - 108,022,683	UniSTS	Rnor5.0
RGSC_v3.4	3	95,746,641 - 95,746,797	UniSTS	RGSC3.4
Celera	3	95,834,470 - 95,834,626	UniSTS
Cytogenetic Map	3	q33	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium			23	23		23					2
Low	1		16	14		14			37	7	13	8
Below cutoff	2	7	15	4	12	4	7	7	13	16	13	3	7

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001413175	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_022629	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017592026	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105800	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105801	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105802	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105803	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105804	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039105805	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC106654	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF160958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF644497	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF644498	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF644499	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF644500	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF644501	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF644502	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF644503	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210746	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211247	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000118	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000080175 ⟹ ENSRNOP00000073497

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	96,822,655 - 96,871,458 (-)	Ensembl
Rnor_6.0 Ensembl	3	101,427,055 - 101,465,995 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000091869 ⟹ ENSRNOP00000072919

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	3	101,429,362 - 101,474,890 (-)	Ensembl

RefSeq Acc Id:

NM_022629 ⟹ NP_072151

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	96,824,018 - 96,862,947 (-)	NCBI
Rnor_6.0	3	101,427,052 - 101,465,995 (-)	NCBI
Rnor_5.0	3	108,023,621 - 108,070,883 (-)	NCBI
RGSC_v3.4	3	95,747,735 - 95,786,852 (-)	RGD
Celera	3	95,835,564 - 95,874,303 (-)	RGD

Sequence:

show sequence

ATGCACTGTGCCATCCTAAAGGCGGAAGCAGTGGATGGGGCTCGCTTGATGCAGATCTTTTGGC
ACGATGGGGCAGAGTCCCTCTACCCAGCAGTATGGCTCAGAGACAACTGTCAGTGTTCGGACTG
CTATCTACATTCTGCAAAAGCTCGGAAACTTCTCCTGGAAGCTCTCGATGTGAACATTAGAATG
GATGACTTGACATTTGACCAGAAAAAGGTTTATATCACTTGGCCCAATGGCCATTACAGCGAAT
TTGAAGCTAATTGGCTGAAGAAAAGATGCTTTTCTCAGGAGGCCAGAGCAGGACTCCAAGGAGA
ATTATTTTTACCAGAATGTCAGTACTGGGGCTCAGAGCTCCAGCTGCCAACTCTGAACTTTGAA
GATGTGTTAAATGATGATGACCATGCATACAAATGGCTTTCTAGTCTCAAGAAAGTAGGCATTG
TGAGACTCACTGGAGCAGCTGACAAACGTGGCGAGATCATAAAACTTGGGAAAAGAATTGGCTT
TCTGTACCTCACATTTTATGGACACACTTGGCAAGTGCAGGACAAGATTGATGCCAACAATGTG
GCTTATACAACTGGGAAGCTCAGCTTCCACACAGATTACCCAGCCCTCCACCATCCACCTGGGG
TTCAGCTTCTGCACTGTATCAAGCAAACAGTCACAGGAGGTGACTCTGAAATCGTAGATGGGTT
TAATGTGTGCCAAAAACTCAAGGAGAAGAACCCCCAGGCTTTTTCTATTCTCTCCTCCACCTTT
GTGGATTTTACAGACATTGGAGTGGATTACTGTGATTTCTCTGTGCAGTCTAAACACAAGATTA
TAGAGCTGGATGATAAAGGCCAAGTGGTTCGCATCAACTTCAACAACGCAACCAGAGATACAGT
CTTCGATGTCCCCATTGAAAGAGTTCAGCCTTTCTACGCTGCTCTGAAGGAGTTTGTTGACCTG
ATGAACAGCAAAGAATACAAGTACACCTTCAAGATGAATCCAGGTGATGTGATTACCTTTGACA
ACTGGCGCTTGCTTCATGGACGTCGCAGCTATGAAGCAGGAACTGAGATATCCCGCCATCTGGA
AGGCGCTTATGCTGACTGGGATGTAGTGATGTCAAGGCTTCGTATTCTGAGACAGAGAGTCATG
AATGGGAACTGA

hide sequence

RefSeq Acc Id:

XM_039105800 ⟹ XP_038961728

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	96,822,654 - 96,871,529 (-)	NCBI

RefSeq Acc Id:

XM_039105801 ⟹ XP_038961729

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	96,822,654 - 96,871,785 (-)	NCBI

RefSeq Acc Id:

XM_039105802 ⟹ XP_038961730

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	96,822,654 - 96,871,785 (-)	NCBI

RefSeq Acc Id:

XM_039105803 ⟹ XP_038961731

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	96,822,654 - 96,871,513 (-)	NCBI

RefSeq Acc Id:

XM_039105804 ⟹ XP_038961732

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	96,822,654 - 96,871,786 (-)	NCBI

RefSeq Acc Id:

XM_039105805 ⟹ XP_038961733

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	96,828,948 - 96,871,529 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001400104	(Get FASTA)	NCBI Sequence Viewer
	NP_072151	(Get FASTA)	NCBI Sequence Viewer
	XP_038961728	(Get FASTA)	NCBI Sequence Viewer
	XP_038961729	(Get FASTA)	NCBI Sequence Viewer
	XP_038961730	(Get FASTA)	NCBI Sequence Viewer
	XP_038961731	(Get FASTA)	NCBI Sequence Viewer
	XP_038961732	(Get FASTA)	NCBI Sequence Viewer
	XP_038961733	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAD53264	(Get FASTA)	NCBI Sequence Viewer
	ABR68053	(Get FASTA)	NCBI Sequence Viewer
	ABR68054	(Get FASTA)	NCBI Sequence Viewer
	ABR68055	(Get FASTA)	NCBI Sequence Viewer
	ABR68056	(Get FASTA)	NCBI Sequence Viewer
	ABR68057	(Get FASTA)	NCBI Sequence Viewer
	ABR68058	(Get FASTA)	NCBI Sequence Viewer
	ABR68059	(Get FASTA)	NCBI Sequence Viewer
	EDL79764	(Get FASTA)	NCBI Sequence Viewer
	EDL79765	(Get FASTA)	NCBI Sequence Viewer
	Q9QZU7	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_072151 ⟸ NM_022629

- UniProtKB:

Q9QZU7 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MHCAILKAEAVDGARLMQIFWHDGAESLYPAVWLRDNCQCSDCYLHSAKARKLLLEALDVNIRM
DDLTFDQKKVYITWPNGHYSEFEANWLKKRCFSQEARAGLQGELFLPECQYWGSELQLPTLNFE
DVLNDDDHAYKWLSSLKKVGIVRLTGAADKRGEIIKLGKRIGFLYLTFYGHTWQVQDKIDANNV
AYTTGKLSFHTDYPALHHPPGVQLLHCIKQTVTGGDSEIVDGFNVCQKLKEKNPQAFSILSSTF
VDFTDIGVDYCDFSVQSKHKIIELDDKGQVVRINFNNATRDTVFDVPIERVQPFYAALKEFVDL
MNSKEYKYTFKMNPGDVITFDNWRLLHGRRSYEAGTEISRHLEGAYADWDVVMSRLRILRQRVM
NGN

hide sequence

RefSeq Acc Id:

ENSRNOP00000073497 ⟸ ENSRNOT00000080175

RefSeq Acc Id:

ENSRNOP00000072919 ⟸ ENSRNOT00000091869

RefSeq Acc Id:	XP_038961732 ⟸ XM_039105804
- Peptide Label:	isoform X1
- UniProtKB:	Q9QZU7 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_038961729 ⟸ XM_039105801
- Peptide Label:	isoform X1
- UniProtKB:	Q9QZU7 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_038961730 ⟸ XM_039105802
- Peptide Label:	isoform X1
- UniProtKB:	Q9QZU7 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_038961728 ⟸ XM_039105800
- Peptide Label:	isoform X1
- UniProtKB:	Q9QZU7 (UniProtKB/Swiss-Prot)

RefSeq Acc Id:	XP_038961731 ⟸ XM_039105803
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038961733 ⟸ XM_039105805
- Peptide Label:	isoform X2

Protein Domains

Gamma-butyrobetaine hydroxylase-like N-terminal TauD/TfdA-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9QZU7-F1-model_v2	AlphaFold	Q9QZU7	1-387	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692283

Promoter ID:

EPDNEW_R2807

Type:

initiation region

Name:

Bbox1_1

Description:

gamma-butyrobetaine hydroxylase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R2808

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	101,466,057 - 101,466,117	EPDNEW

RGD ID:

13692284

Promoter ID:

EPDNEW_R2808

Type:

multiple initiation site

Name:

Bbox1_2

Description:

gamma-butyrobetaine hydroxylase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R2807

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	101,474,485 - 101,474,545	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619756	AgrOrtholog
BioCyc Gene	G2FUF-48471	BioCyc
BioCyc Pathway	PWY-6100 [L-carnitine biosynthesis]	BioCyc
Ensembl Genes	ENSRNOG00000059519	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000073497	ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOP00000073497.2	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000080175	ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOT00000080175.2	UniProtKB/Swiss-Prot
Gene3D-CATH	3.30.2020.30	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.60.130.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	GBBH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GBBH-like_N	UniProtKB/TrEMBL
	GBBH-like_N_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GBH-like_N	UniProtKB/Swiss-Prot
	TauD-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TauD/TfdA-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:64564	UniProtKB/Swiss-Prot
NCBI Gene	64564	ENTREZGENE
PANTHER	GAMMA-BUTYROBETAINE DIOXYGENASE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GAMMA-BUTYROBETAINE HYDROXYLASE-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	DUF971	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TauD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Bbox1	PhenoGen
Superfamily-SCOP	Clavaminate synthase-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGRFAMs	carnitine_bodg	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2K5N7_RAT	UniProtKB/TrEMBL
	A6YRI8_RAT	UniProtKB/TrEMBL
	BODG_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-01	Bbox1	gamma-butyrobetaine hydroxylase 1	Bbox1	butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Bbox1	butyrobetaine (gamma), 2-oxoglutarate dioxygenase (gamma-butyrobetaine hydroxylase) 1	Bbox1	butyrobetaine (gamma), 2-oxoglutarate dioxygenase 1 (gamma-butyrobetaine hydroxylase)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-04-22	Bbox1	butyrobetaine (gamma), 2-oxoglutarate dioxygenase 1 (gamma-butyrobetaine hydroxylase)	Bbox	gamma-butyrobetaine hydroxylase	Symbol and Name updated to reflect Human and Mouse nomenclature	625702	APPROVED
2002-08-07	Bbox	gamma-butyrobetaine hydroxylase			Symbol and Name status set to provisional	70820	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_expression	mRNA expression is first detected after weaning and is increased in the adult	632240

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)