Gtf2b (general transcription factor IIB)

Advanced Search (OLGA)

Gene: Gtf2b (general transcription factor IIB) Rattus norvegicus

Analyze

Symbol:

Gtf2b

Name:

general transcription factor IIB

RGD ID:

619735

Description:

Predicted to enable several functions, including RNA polymerase II core promoter sequence-specific DNA binding activity; RNA polymerase II general transcription initiation factor activity; and TBP-class protein binding activity. Predicted to be involved in several processes, including RNA polymerase II core complex assembly; meiotic sister chromatid cohesion; and transcription initiation at RNA polymerase II promoter. Predicted to be located in chromosome and nuclear body. Predicted to be part of transcription factor TFIID complex and transcription preinitiation complex. Predicted to be active in cell division site; germinal vesicle; and kinetochore. Orthologous to human GTF2B (general transcription factor IIB); PARTICIPATES IN RNA polymerase II transcription initiation pathway; INTERACTS WITH 2,4-dinitrotoluene; 6-propyl-2-thiouracil; amitrole.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

general transcription factor TFIIB; RNA polymerase II alpha initiation factor; transcription initiation factor IIB

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GTF2B (general transcription factor IIB)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Gtf2b (general transcription factor IIB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Gtf2b (general transcription factor IIB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GTF2B (general transcription factor IIB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GTF2B (general transcription factor IIB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Gtf2b (general transcription factor IIB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GTF2B (general transcription factor IIB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GTF2B (general transcription factor IIB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Gtf2b (general transcription factor IIB)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	GTF2B (general transcription factor IIB)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gtf2b (general transcription factor IIB)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	gtf2b (general transcription factor IIB)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	SUA7	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	TfIIB	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ttb-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	gtf2b	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	234,427,734 - 234,446,043 (+)	NCBI		GRCr8
mRatBN7.2	2	231,767,317 - 231,785,626 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	231,767,238 - 231,785,651 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	239,546,251 - 239,564,580 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	237,440,531 - 237,458,860 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	232,303,904 - 232,322,233 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	248,709,433 - 248,727,741 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	248,715,281 - 248,727,741 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	267,239,559 - 267,257,867 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	240,877,342 - 240,895,650 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	240,864,081 - 240,882,390 (+)	NCBI
Celera	2	223,777,527 - 223,795,808 (+)	NCBI		Celera
Cytogenetic Map	2	q44	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

17alpha-ethynylestradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dinitrotoluene (EXP)

2-hydroxypropanoic acid (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO)

4-hydroxynon-2-enal (ISO)

6-propyl-2-thiouracil (EXP)

aflatoxin B1 (ISO)

amitrole (EXP)

ammonium chloride (EXP)

arsenite(3-) (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

Benzo[ghi]perylene (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

caffeine (ISO)

chromium(6+) (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

CU-O LINKAGE (ISO)

cyclophosphamide (EXP)

dicrotophos (ISO)

disulfiram (ISO)

diuron (EXP)

doxorubicin (ISO)

epoxiconazole (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

finasteride (EXP)

folic acid (ISO)

formaldehyde (ISO)

genistein (ISO)

gentamycin (EXP)

geraniol (ISO)

hydrogen peroxide (ISO)

isobutanol (ISO)

ivermectin (ISO)

methimazole (EXP)

methyl methanesulfonate (ISO)

monosodium L-glutamate (ISO)

nefazodone (EXP)

nickel sulfate (ISO)

paracetamol (EXP,ISO)

perfluorooctanoic acid (EXP)

phenobarbital (EXP)

rac-lactic acid (ISO)

resveratrol (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

sulindac (EXP,ISO)

temozolomide (ISO)

tetrachloromethane (EXP,ISO)

thimerosal (ISO)

thiram (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

urethane (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

chromatin remodeling (IEA)

chromosome organization (ISO)

gene expression (ISO)

meiotic sister chromatid cohesion (IEA,ISO)

protein acetylation (IEA,ISO,ISS)

RNA polymerase II core complex assembly (IBA,IEA,ISO,ISS)

RNA polymerase II preinitiation complex assembly (IBA,IEA,ISO,ISS)

spindle assembly (IEA,ISO)

transcription by RNA polymerase II (ISO,ISS)

transcription initiation at RNA polymerase II promoter (IBA,ISO,ISS)

transcription preinitiation complex assembly (IEA)

transcriptional start site selection at RNA polymerase II promoter (IBA,IEA,ISO,ISS)

viral transcription (IEA,ISO,ISS)

Cellular Component

cell division site (IEA,ISO)

chromosome (ISO,ISS)

condensed chromosome (ISO)

germinal vesicle (IEA,ISO)

kinetochore (IEA,ISO)

nuclear body (IEA,ISO)

nucleoplasm (ISO)

nucleus (IBA,ISO,ISS)

protein-DNA complex (IEA,ISO,ISS)

RNA polymerase II transcription regulator complex (ISO)

transcription factor TFIID complex (IEA,ISO)

transcription preinitiation complex (IBA)

Molecular Function

acetyltransferase activity (IBA,ISO,ISS)

acyltransferase activity (IEA)

DNA binding (ISO)

DNA-binding transcription factor binding (ISO)

histone acetyltransferase activity (IEA)

nuclear thyroid hormone receptor binding (IEA,ISO)

promoter-specific chromatin binding (IEA,ISO,ISS)

protein binding (ISO)

RNA polymerase II complex binding (IEA,ISO,ISS)

RNA polymerase II core promoter sequence-specific DNA binding (IBA,IEA,ISO,ISS)

RNA polymerase II general transcription initiation factor activity (IBA,IEA,ISO)

TBP-class protein binding (IBA,IEA,ISO)

zinc ion binding (IEA,ISO,ISS)

Molecular Pathway Annotations Click to see Annotation Detail View

RNA polymerase II transcription initiation pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Structural insights into transcription initiation by RNA polymerase II.	Grunberg S and Hahn S, Trends Biochem Sci. 2013 Dec;38(12):603-11. doi: 10.1016/j.tibs.2013.09.002. Epub 2013 Oct 11.
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	RNA polymerase II initiation factor alpha from rat liver is almost identical to human TFIIB.	Tsuboi A, etal., Nucleic Acids Res 1992 Jun 25;20(12):3250.

Additional References at PubMed

PMID:1517211	PMID:1876184	PMID:3029109	PMID:7601352	PMID:7675079	PMID:8413225	PMID:8504927	PMID:8515820	PMID:8516312	PMID:8524305	PMID:8972203	PMID:9420329
PMID:9722567	PMID:9841876	PMID:10318856	PMID:10619841	PMID:10893273	PMID:11045620	PMID:12477932	PMID:12931194	PMID:14644612	PMID:15489334	PMID:16230532	PMID:17997859
PMID:18722179	PMID:22227519	PMID:22323595	PMID:22869340	PMID:23264107	PMID:24441171	PMID:27193682	PMID:29158257

Genomics

Comparative Map Data

Gtf2b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	2	234,427,734 - 234,446,043 (+)	NCBI		GRCr8
mRatBN7.2	2	231,767,317 - 231,785,626 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	231,767,238 - 231,785,651 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	239,546,251 - 239,564,580 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	237,440,531 - 237,458,860 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	232,303,904 - 232,322,233 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	248,709,433 - 248,727,741 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	248,715,281 - 248,727,741 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	267,239,559 - 267,257,867 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	240,877,342 - 240,895,650 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	240,864,081 - 240,882,390 (+)	NCBI
Celera	2	223,777,527 - 223,795,808 (+)	NCBI		Celera
Cytogenetic Map	2	q44	NCBI

GTF2B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	88,852,633 - 88,891,567 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	88,852,633 - 88,891,944 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	89,318,316 - 89,357,250 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	89,090,909 - 89,129,889 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	89,030,635 - 89,069,275	NCBI
Celera	1	87,564,104 - 87,603,098 (-)	NCBI		Celera
Cytogenetic Map	1	p22.2	NCBI
HuRef	1	87,435,703 - 87,474,719 (-)	NCBI		HuRef
CHM1_1	1	89,433,373 - 89,472,373 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	88,696,014 - 88,734,967 (-)	NCBI		T2T-CHM13v2.0

Gtf2b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	142,471,008 - 142,489,367 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	142,470,806 - 142,489,367 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	142,765,247 - 142,783,606 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	142,765,045 - 142,783,606 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	142,428,211 - 142,446,570 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	142,702,633 - 142,720,992 (+)	NCBI		MGSCv36	mm8
Celera	3	149,197,374 - 149,215,676 (+)	NCBI		Celera
Cytogenetic Map	3	H1	NCBI
cM Map	3	66.69	NCBI

Gtf2b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955423	5,420,584 - 5,447,148 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955423	5,420,795 - 5,447,148 (+)	NCBI	ChiLan1.0	ChiLan1.0

GTF2B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	138,078,278 - 138,117,617 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	137,234,167 - 137,273,418 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	91,568,296 - 91,607,467 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	90,319,637 - 90,359,134 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	90,319,637 - 90,359,134 (-)	Ensembl	panpan1.1		panPan2

GTF2B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	6	59,491,986 - 59,527,142 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	6	59,492,055 - 59,527,054 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	6	62,200,289 - 62,235,125 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	6	60,003,234 - 60,038,110 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	6	60,003,305 - 60,081,246 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	6	59,568,745 - 59,603,586 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	6	59,524,029 - 59,558,856 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	6	60,009,800 - 60,044,657 (+)	NCBI		UU_Cfam_GSD_1.0

Gtf2b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	99,258,716 - 99,290,490 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936732	148,369 - 183,067 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936732	148,702 - 178,992 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GTF2B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	127,522,870 - 127,561,135 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	127,522,802 - 127,559,605 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	139,747,986 - 139,784,762 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GTF2B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	44,527,150 - 44,566,398 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	44,527,599 - 44,566,424 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	73,339,911 - 73,378,634 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Gtf2b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624742	8,686,537 - 8,723,399 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624742	8,687,002 - 8,721,505 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Gtf2b
78 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	185
Count of miRNA genes:	141
Interacting mature miRNAs:	159
Transcripts:	ENSRNOT00000015032
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
631563	Hcuc3	Hepatic copper content QTL 3	3.87		liver copper amount (VT:0003065)	liver copper weight to liver dry weight ratio (CMO:0001512)	2	229059610	249053267	Rat
1331767	Hrtrt12	Heart rate QTL 12	3.373		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	218414747	240841241	Rat
1598813	Memor9	Memory QTL 9	2.7		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	199341726	234244620	Rat
1298075	Scl17	Serum cholesterol level QTL 17	3.4		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	2	211744537	249053267	Rat
2293833	Kiddil8	Kidney dilation QTL 8	2.9		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	219753301	247136170	Rat
1598835	Anxrr18	Anxiety related response QTL 18	2.98		body movement coordination trait (VT:0005424)	number of rearing movements in an experimental apparatus (CMO:0001752)	2	200990457	245990457	Rat
2298479	Eau5	Experimental allergic uveoretinitis QTL 5		0.0021	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	2	202446871	237938339	Rat
1300126	Bp175	Blood pressure QTL 175	3.46		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	214226044	247136170	Rat
7207490	Bss111	Bone structure and strength QTL 111	6.4		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	2	211744537	249053267	Rat
7207484	Bss108	Bone structure and strength QTL 108	5.3		femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	2	211744537	249053267	Rat
2313073	Bmd75	Bone mineral density QTL 75	4.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	2	215377404	237938339	Rat
7411555	Bw132	Body weight QTL 132		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	2	223389739	249053267	Rat
61366	Iddm3	Insulin dependent diabetes mellitus QTL 3	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	189599258	234599258	Rat
61398	Bp50	Blood pressure QTL 50	4.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	189599258	234599258	Rat
9587428	Epfw6	Epididymal fat weight QTL 6	7.47	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	2	223389739	249053267	Rat
7207482	Bss107	Bone structure and strength QTL 107	7		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	2	211744537	249053267	Rat
2293844	Kiddil7	Kidney dilation QTL 7	3.5		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	219753301	247136170	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
2317752	Glom23	Glomerulus QTL 23	3.6		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	2	193452645	245889826	Rat
1549836	Bss2	Bone structure and strength QTL 2	7.5		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	2	211744537	249053267	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
2317885	Alcrsp28	Alcohol response QTL 28	2.1	0.63	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	212828222	249053267	Rat

Markers in Region

BF389714

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	231,779,971 - 231,780,100 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	248,722,087 - 248,722,215	NCBI	Rnor6.0
Rnor_5.0	2	267,252,213 - 267,252,341	UniSTS	Rnor5.0
RGSC_v3.4	2	240,889,996 - 240,890,124	UniSTS	RGSC3.4
Celera	2	223,790,154 - 223,790,282	UniSTS
RH 3.4 Map	2	1581.3	UniSTS
Cytogenetic Map	2	q44	UniSTS

RH136605

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	231,785,304 - 231,785,468 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	248,727,420 - 248,727,583	NCBI	Rnor6.0
Rnor_5.0	2	267,257,546 - 267,257,709	UniSTS	Rnor5.0
RGSC_v3.4	2	240,895,329 - 240,895,492	UniSTS	RGSC3.4
Celera	2	223,795,487 - 223,795,650	UniSTS
Cytogenetic Map	2	q44	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

alimentary part of gastrointestinal system

circulatory system

endocrine system

exocrine system

hemolymphoid system

hepatobiliary system

integumental system

musculoskeletal system

nervous system

renal system

reproductive system

respiratory system

appendage

High

Medium

123

227

147

250

115

145

Low

Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031041	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC085345	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473952	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229769	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ231337	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000002	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X65948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000015032 ⟹ ENSRNOP00000015033

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	231,773,165 - 231,785,635 (+)	Ensembl
Rnor_6.0 Ensembl	2	248,723,255 - 248,727,741 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000089648 ⟹ ENSRNOP00000070077

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	231,779,762 - 231,785,635 (+)	Ensembl
Rnor_6.0 Ensembl	2	248,715,281 - 248,727,481 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000119389 ⟹ ENSRNOP00000093700

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	231,767,238 - 231,785,651 (+)	Ensembl

RefSeq Acc Id:

NM_031041 ⟹ NP_112303

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	2	234,427,734 - 234,446,043 (+)	NCBI
mRatBN7.2	2	231,767,317 - 231,785,626 (+)	NCBI
Rnor_6.0	2	248,709,433 - 248,727,741 (+)	NCBI
Rnor_5.0	2	267,239,559 - 267,257,867 (+)	NCBI
RGSC_v3.4	2	240,877,342 - 240,895,650 (+)	RGD
Celera	2	223,777,527 - 223,795,808 (+)	RGD

Sequence:

show sequence

CGCGGCCGCCTTGAAGATGGCGTCGACCAGCCGTTTGGATGCTCTCCCACGAGTCACATGTCCC
AATCATCCAGATGCGATTTTAGTTGAGGACTACAGAGCTGGCGACATGATCTGTCCCGAATGCG
GCCTAGTTGTAGGGGACCGGGTTATTGATGTGGGGTCTGAATGGAGAACTTTCAGCAATGACAA
AGCAACGAAAGACCCATCTCGAGTTGGAGACTCTCAGAATCCTCTTCTGAGTGATGGAGATTTG
TCCACCATGATTGGCAAGGGTACAGGAGCGGCAAGTTTTGATGAATTTGGCAATTCTAAGTATC
AGAACCGGAGAACAATGAGCAGCTCTGATAGAGCTATGATGAACGCATTCAAGGAGATCACGAC
CATGGCAGACAGAATCAACCTCCCACGCAATATAGTTGATCGAACAAATAATTTATTCAAGCAA
GTATATGAGCAGAAGAGCCTGAAGGGAAGAGCTAATGATGCGATAGCTTCTGCTTGTCTGTACA
TCGCTTGTAGACAAGAAGGCGTTCCCAGGACATTTAAAGAAATATGTGCTGTGTCTCGAATCTC
TAAGAAAGAAATTGGCCGTTGTTTTAAACTGATTTTGAAAGCTTTGGAGACGAGCGTGGATCTG
ATCACAACTGGGGACTTCATGTCCAGGTTCTGCTCCAACCTTTGCCTCCCCAAGCAAGTGCAGA
TGGCAGCTACACACATAGCCCGCAAGGCTGTGGAGCTGGACTTGGTTCCTGGCAGGAGTCCTAT
CTCTGTGGCGGCAGCAGCTATTTACATGGCCTCCCAGGCTTCAGCTGAGAAGCGAACACAGAAA
GAAATCGGGGATATTGCTGGTGTTGCTGATGTTACAATCCGACAGTCCTACAGACTGATCTACC
CTCGGGCTCCAGATCTCTTCCCTTCAGACTTCAAGTTTGACACCCCAGTGGACAAATTACCCCA
GCTATAAGCTGAGGCAACTAAGTGTCACACTCTTAATGTACATGGAACTTTGTGCATAGCCACA
CAGTGCTGGTTGAGCCTTTAATGAGGAAAAAGGAGATGGTACGCATTCCACAGCTAAGTATTAT
TGCTTAGTCTTCTGTATGTATATAGTAGTGCGACATATTTAATGACTTAAATTTCTTACTGATT
CTGCTTTCTTTTTTAGTGATCTAGGAAACAGTATTTTGGAAGATATTAAAATATGTAATTCTCA
AATAAAATTTT

hide sequence

Protein Sequences


Protein RefSeqs	NP_112303	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH85345	(Get FASTA)	NCBI Sequence Viewer
	CAA46766	(Get FASTA)	NCBI Sequence Viewer
	EDL82360	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015033.6
	ENSRNOP00000070077.2
	ENSRNOP00000093700.1
GenBank Protein	P62916	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_112303 ⟸ NM_031041

- UniProtKB:

P62916 (UniProtKB/Swiss-Prot), A6HW74 (UniProtKB/TrEMBL), A0A0A0MXW7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGSEWRTFSNDKATKDP
SRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSKYQNRRTMSSSDRAMMNAFKEITTMADRI
NLPRNIVDRTNNLFKQVYEQKSLKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIG
RCFKLILKALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSPISVAAA
AIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLFPSDFKFDTPVDKLPQL

hide sequence

Ensembl Acc Id:

ENSRNOP00000070077 ⟸ ENSRNOT00000089648

Ensembl Acc Id:

ENSRNOP00000015033 ⟸ ENSRNOT00000015032

Ensembl Acc Id:

ENSRNOP00000093700 ⟸ ENSRNOT00000119389

Protein Domains

Cyclin-like TFIIB-type

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P62916-F1-model_v2	AlphaFold	P62916	1-316	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:619735	AgrOrtholog
BioCyc Gene	G2FUF-50978	BioCyc
Ensembl Genes	ENSRNOG00000011135	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000015032.6	UniProtKB/TrEMBL
	ENSRNOT00000089648.2	UniProtKB/TrEMBL
	ENSRNOT00000119389.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.472.170	UniProtKB/TrEMBL
	2.20.25.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Cyclin-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7303747	IMAGE-MGC_LOAD
InterPro	Cyclin-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Cyclin-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TFIIB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TFIIB_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TFIIB_cyclin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Znf_TFIIB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:81673	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:105412	IMAGE-MGC_LOAD
NCBI Gene	81673	ENTREZGENE
PANTHER	PTHR11618	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TRANSCRIPTION INITIATION FACTOR IIB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	TF_Zn_Ribbon	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TFIIB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Gtf2b	PhenoGen
PRINTS	TIFACTORIIB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	TFIIB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ZF_TFIIB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000011135	RatGTEx
SMART	CYCLIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF47954	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Zinc beta-ribbon	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0A0MXW7	ENTREZGENE, UniProtKB/TrEMBL
	A0A0G2JWZ8_RAT	UniProtKB/TrEMBL
	A0A8I6AXE6_RAT	UniProtKB/TrEMBL
	A6HW74	ENTREZGENE, UniProtKB/TrEMBL
	P62916	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	P29053	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2004-02-26	Gtf2b	general transcription factor IIB			Symbol and Name status set to approved	625702	APPROVED
2002-08-07	Gtf2b	general transcription factor IIB			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

RGD Manual Annotations