BGLAP (bone gamma-carboxyglutamate protein)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer ACP Haplotyper Genome Scanner VCMap Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: BGLAP (bone gamma-carboxyglutamate protein) Homo sapiens

Analyze

Symbol:

BGLAP

Name:

bone gamma-carboxyglutamate protein

RGD ID:

619567

HGNC Page

HGNC

Description:

Predicted to have calcium-dependent protein binding activity; hydroxyapatite binding activity; and metal ion binding activity. Predicted to be a structural constituent of bone. Involved in osteoblast differentiation and response to vitamin D. Localizes to cytoplasm. Implicated in osteoarthritis; osteoporosis; prostate cancer; rheumatoid arthritis; and vitamin K deficiency bleeding. Biomarker of several diseases, including calcium oxalate nephrolithiasis; cystic fibrosis; diabetes insipidus; diabetes mellitus (multiple); and end stage renal disease.

Type:

protein-coding

RefSeq Status:

REVIEWED

Also known as:

BGP; bone gamma-carboxyglutamate (gla) protein (osteocalcin); bone Gla protein; gamma-carboxyglutamic acid-containing protein; OC; OCN; osteocalcin; PMF1

RGD Orthologs

Mouse

Rat

Chinchilla

Bonobo

Dog

Squirrel

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38.p13 Ensembl	1	156,242,184 - 156,243,317 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh38	1	156,242,184 - 156,243,317 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh37	1	156,211,975 - 156,213,108 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	154,478,629 - 154,479,736 (+)	NCBI	NCBI36		hg18	NCBI36
Build 34	1	153,025,077 - 153,026,185	NCBI
Celera	1	129,284,933 - 129,286,094 (+)	NCBI
Cytogenetic Map	1	q22	NCBI
HuRef	1	127,573,050 - 127,574,222 (+)	NCBI		HuRef
CHM1_1	1	157,607,726 - 157,609,096 (+)	NCBI		CHM1_1

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

asthma (EXP)

autosomal dominant hypocalcemia (ISO)

Bone Fractures (IEP)

calcinosis (EXP,IEP)

calcium oxalate nephrolithiasis (IEP)

Charcot-Marie-Tooth disease type 2 (IAGP)

congenital hypothyroidism (ISO)

Crohn's disease (IEP)

cystic fibrosis (IEP)

diabetes insipidus (IEP)

Diabetic Nephropathies (IEP)

end stage renal disease (IEP,ISO)

Experimental Arthritis (ISO)

Experimental Diabetes Mellitus (ISO)

gastrointestinal stromal tumor (IAGP)

heart valve disease (EXP)

Kidney Calculi (ISO)

Knee Osteoarthritis (IEP,ISO)

Metabolic Syndrome (IEP)

nephrolithiasis (IAGP)

nephrotic syndrome (IEP)

neurofibromatosis 1 (IEP)

osteoarthritis (IDA)

osteoporosis (IAGP,IEP,ISO)

parathyroid carcinoma (IAGP)

Parkinson's disease (IEP)

polycystic kidney disease (ISO)

progressive osseous heteroplasia (IEP)

prostate cancer (IDA)

Prostatic Neoplasms (EXP)

rheumatoid arthritis (IDA,IEP)

Spinal Fractures (IEP)

type 1 diabetes mellitus (IEP)

type 2 diabetes mellitus (IEP)

Vitamin D Deficiency (ISO)

vitamin K deficiency bleeding (IDA)

X-linked dominant hypophosphatemic rickets (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(20S)-ginsenoside Rg3 (ISO)

(S)-nicotine (EXP,ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

15-deoxy-Delta(12,14)-prostaglandin J2 (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (EXP)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

1H-[1,2,4]oxadiazolo[4,3-a]quinoxalin-1-one (EXP)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3-bisphospho-D-glyceric acid (EXP)

2,3-bisphosphoglyceric acid (EXP)

2,4,6-trinitrobenzenesulfonic acid (ISO)

2-amino-2-deoxy-D-glucopyranose (EXP)

3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

3,3',5,5'-tetrabromobisphenol A (EXP)

3-aminobenzamide (EXP)

4',5,7-trihydroxy-3'-methoxyflavone (ISO)

5-(1,4-diazepane-1-sulfonyl)isoquinoline (ISO)

5-azacytidine (ISO)

5-fluorouracil (ISO)

5-formyltetrahydrofolic acid (ISO)

6-propyl-2-thiouracil (ISO)

6alpha-methylprednisolone (ISO)

9-cis-retinoic acid (EXP,ISO)

acrylamide (ISO)

aldehydo-D-glucosamine (EXP)

alendronic acid (ISO)

all-trans-retinoic acid (ISO)

allethrin (ISO)

allopurinol (ISO)

alloxanthine (ISO)

aluminium atom (ISO)

aluminium oxide (EXP)

aluminium(0) (ISO)

ammonium chloride (EXP,ISO)

amphetamine (ISO)

anthra[1,9-cd]pyrazol-6(2H)-one (ISO)

antimycin A (ISO)

apocynin (ISO)

Aroclor 1254 (ISO)

arsenous acid (ISO)

atorvastatin calcium (EXP)

aucubin (EXP)

azadirachtin A (ISO)

bafilomycin A1 (EXP)

beclomethasone (EXP)

benzo[a]pyrene (EXP)

berberine (EXP)

beta-D-glucosamine (EXP)

bexarotene (EXP)

bisphenol A (ISO)

Bisphenol A diglycidyl ether (ISO)

boron atom (EXP)

budesonide (EXP)

Butylparaben (ISO)

cadmium atom (EXP)

cadmium dichloride (ISO)

caesium atom (ISO)

caffeine (ISO)

calciol (EXP,ISO)

calcitriol (EXP,ISO)

calcium carbonate (EXP)

calcium dichloride (EXP)

cannabidiol (EXP)

CHIR 99021 (ISO)

chitosan (EXP)

chlormequat chloride (ISO)

chloroquine (EXP)

cobalt dichloride (EXP,ISO)

copper(II) sulfate (EXP)

corticosterone (ISO)

cycloheximide (ISO)

daidzein (EXP)

dexamethasone (EXP,ISO)

diarsenic trioxide (ISO)

disulfiram (ISO)

dorsomorphin (EXP)

doxorubicin (ISO)

elemental boron (EXP)

enalapril (ISO)

enzacamene (ISO)

ethanol (ISO)

Falecalcitriol (EXP)

fasudil hydrochloride (ISO)

fentin hydroxide (ISO)

flavonoids (ISO)

fluticasone (EXP)

fulvestrant (EXP,ISO)

gamma-aminobutyric acid (ISO)

gamma-Oryzanol (TN) (ISO)

genistein (EXP,ISO)

glycerol 2-phosphate (EXP,ISO)

glycyrrhetinate (ISO)

glycyrrhetinic acid (ISO)

Goserelin (EXP)

hexadecanoic acid (ISO)

hydrogen chloride (EXP)

hydrogen peroxide (EXP,ISO)

icariin (ISO)

icariside II (ISO)

ifosfamide (EXP)

ionomycin (ISO)

iron dextran (ISO)

isonicotinamide (EXP,ISO)

L-ascorbic acid (EXP,ISO)

L-ascorbic acid 2-phosphate (EXP)

lead diacetate (ISO)

lead(0) (EXP,ISO)

lead(2+) (EXP,ISO)

levonorgestrel (EXP)

lithium chloride (EXP)

lithocholic acid (EXP)

magnesium atom (EXP)

melatonin (EXP)

menadione (EXP,ISO)

menaquinone (EXP,ISO)

menaquinone-7 (ISO)

menatetrenone (ISO)

methotrexate (ISO)

methylparaben (ISO)

montelukast (ISO)

myricitrin (EXP,ISO)

N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO)

naringin (EXP,ISO)

nebivolol (ISO)

neoeriocitrin (ISO)

nicotine (EXP,ISO)

nitric acid (ISO)

NMN zwitterion (ISO)

norethisterone (EXP)

notoginsenoside R1 (EXP)

ormeloxifene (ISO)

oxaliplatin (ISO)

pamidronate (EXP)

paracetamol (EXP)

perfluorooctane-1-sulfonic acid (EXP)

Phenylamil (EXP)

phosphatidic acid (EXP)

phylloquinone (ISO)

pioglitazone (ISO)

poly(ethylene) (EXP)

prallethrin (ISO)

quercetin (EXP,ISO)

quinoxyfen (ISO)

raloxifene (EXP)

resveratrol (EXP,ISO)

rotenone (EXP)

SB 203580 (ISO)

SB 431542 (EXP)

sciadopitysin (ISO)

simvastatin (EXP,ISO)

sirolimus (EXP)

sodium arsenite (ISO)

sodium fluoride (EXP,ISO)

streptozocin (ISO)

sunitinib (EXP)

tamoxifen (EXP)

tetrachloromethane (ISO)

titanium atom (ISO)

topotecan (ISO)

tributylstannane (EXP,ISO)

troglitazone (ISO)

tubocurarine (EXP)

tungsten (ISO)

uranium atom (ISO)

valproic acid (EXP)

vitamin D (EXP,ISO)

vitamin E (ISO)

vitamin K (ISO)

vorinostat (EXP)

warfarin (ISO)

zinc atom (ISO)

zinc dichloride (ISO)

zinc sulfate (ISO)

zinc(0) (ISO)

zoledronic acid (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

aging (ISO)

bone development (IBA,ISO)

bone mineralization (NAS)

cell adhesion (NAS)

cell aging (IEA,ISO)

cellular response to BMP stimulus (ISO)

cellular response to growth factor stimulus (IEA,ISO)

cellular response to vitamin D (IEA,ISO)

endoplasmic reticulum to Golgi vesicle-mediated transport (TAS)

odontogenesis (IEA,ISO)

ossification (ISO)

osteoblast development (IEA,ISO)

osteoblast differentiation (IBA,IEP,ISO)

regulation of bone mineralization (IEA)

regulation of bone resorption (NAS)

regulation of cellular response to insulin stimulus (IEA)

regulation of osteoclast differentiation (NAS)

response to activity (IEA,ISO)

response to drug (IEA,ISO)

response to estrogen (IEA,ISO)

response to ethanol (IEA,ISO)

response to glucocorticoid (IEA,ISO)

response to gravity (IEA,ISO)

response to hydroxyisoflavone (IEA,ISO)

response to inorganic substance (ISO)

response to mechanical stimulus (IEA,ISO)

response to nutrient levels (ISO)

response to organic cyclic compound (ISO)

response to testosterone (IEA,ISO)

response to vitamin D (IEP)

response to vitamin K (IEA,ISO)

response to zinc ion (IEA,ISO)

skeletal system development (TAS)

Cellular Component

cell projection (ISO)

collagen-containing extracellular matrix (ISO)

cytoplasm (IDA,ISO)

dendrite (IEA,ISO)

endoplasmic reticulum lumen (TAS)

extracellular region (IBA,ISO)

extracellular space (IEA,ISO)

Golgi apparatus (ISO)

Golgi lumen (TAS)

perikaryon (IEA,ISO)

rough endoplasmic reticulum (IEA,ISO)

vesicle (IEA,ISO)

Molecular Function

calcium ion binding (IBA)

calcium-dependent protein binding (ISO)

hydroxyapatite binding (IBA,NAS)

protein binding (IPI)

structural constituent of bone (IBA,ISO,NAS)

structural molecule activity (NAS)

transition metal ion binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

fibroblast growth factor signaling pathway (EXP)

Phenotype Annotations Click to see Annotation Detail View

Human Phenotype

Calcium oxalate nephrolithiasis (IAGP)

Gastrointestinal stroma tumor (IAGP)

Osteoporosis (IAGP)

Parathyroid carcinoma (IAGP)

References

References - curated


1.	Achemlal L, etal., Clin Rheumatol. 2005 Sep;24(5):493-6. Epub 2005 Mar 4.
2.	Arrabal-Polo MA, etal., Urology. 2012 Jan;79(1):48-54. doi: 10.1016/j.urology.2011.07.1382. Epub 2011 Sep 9.
3.	Bruyere O, etal., Maturitas. 2003 Apr 25;44(4):259-65.
4.	Christoforidis A, etal., J Bone Miner Metab. 2011 May;29(3):321-7. doi: 10.1007/s00774-010-0220-1. Epub 2010 Sep 16.
5.	Gevers G, etal., Br J Rheumatol. 1986 Aug;25(3):260-2.
6.	GOA_HUMAN data from the GO Consortium
7.	Horiuchi T, etal., J Bone Miner Metab. 2004;22(3):236-40.
8.	Inukai T, etal., Diabetes Res Clin Pract. 1997 Oct;38(1):53-9.
9.	Kalichman L and Kobyliansky E, Rheumatol Int. 2010 Jun;30(8):1131-5. Epub 2010 Feb 16.
10.	Kanazawa I, etal., Calcif Tissue Int. 2009 Sep;85(3):228-34. doi: 10.1007/s00223-009-9272-4. Epub 2009 Jul 30.
11.	Kang KY, etal., Rheumatol Int. 2012 Mar 25.
12.	Kim SY, etal., J Cutan Pathol. 2008 Sep;35(9):826-31. doi: 10.1111/j.1600-0560.2007.00904.x. Epub 2008 Apr 18.
13.	Li YL and Wang H, Zhongguo Dang Dai Er Ke Za Zhi. 2012 Sep;14(9):653-6.
14.	Maicas N, etal., Antioxid Redox Signal. 2011 Aug 15;15(4):889-901. Epub 2011 May 25.
15.	Masse PG, etal., J Am Coll Nutr. 2010 Aug;29(4):419-29.
16.	Miazgowski T and Czekalski S, Osteoporos Int. 1998;8(5):399-403.
17.	Naito K, etal., Int J Mol Med. 2012 May;29(5):756-60. doi: 10.3892/ijmm.2012.897. Epub 2012 Jan 26.
18.	Nakajima S, etal., Nutrition. 2011 Oct;27(10):1023-8. Epub 2011 Apr 9.
19.	Nickolas TL, etal., J Am Soc Nephrol. 2011 Aug;22(8):1560-72. doi: 10.1681/ASN.2010121275. Epub 2011 Jul 22.
20.	Nicolaidou P, etal., Eur J Pediatr. 2006 Aug;165(8):540-5. Epub 2006 Apr 19.
21.	Okura T, etal., Kidney Blood Press Res. 2010;33(1):66-71. Epub 2010 Mar 2.
22.	Oostlander AE, etal., J Cell Biochem. 2012 Jul;113(7):2424-2431. doi: 10.1002/jcb.24119.
23.	Oste L, etal., Ren Fail. 2007;29(1):1-12.
24.	Owen C, etal., J Cell Biochem. 2012 Jul;113(7):2432-41. doi: 10.1002/jcb.24115.
25.	Pennisi P, etal., J Endocrinol Invest. 2009 Jun;32(6):546-51. Epub 2009 May 5.
26.	Petramala L, etal., Arch Dermatol Res. 2012 May;304(4):325-31. Epub 2011 Nov 27.
27.	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
28.	Pivonello R, etal., J Clin Endocrinol Metab. 1998 Jul;83(7):2275-80.
29.	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
30.	RGD automated import pipeline for gene-chemical interactions
31.	Salekzamani S, etal., Diabetes Metab Syndr Obes. 2011;4:205-12. Epub 2011 Jun 10.
32.	Sato Y, etal., Mov Disord. 2005 Dec;20(12):1598-603.
33.	Silva IV, etal., J Bone Miner Res. 2003 Apr;18(4):615-23.
34.	Soontrapa S, etal., J Med Assoc Thai. 2005 Oct;88 Suppl 5:S29-32.
35.	Takeuchi H, etal., Endocr J. 1993 Jun;40(3):351-62.
36.	Thomas S, etal., Bone Miner. 1990 Jan;8(1):1-6.
37.	Tural S, etal., Gene. 2013 Feb 15;515(1):167-72. doi: 10.1016/j.gene.2012.10.041. Epub 2012 Nov 5.
38.	Wang CJ, etal., Arch Orthop Trauma Surg. 2011 Aug;131(8):1153-8. Epub 2011 Mar 9.
39.	Weiler H, etal., Pediatr Nephrol. 2002 Oct;17(10):795-9. Epub 2002 Aug 10.
40.	Wientroub S, etal., Calcif Tissue Int. 1987 Mar;40(3):166-72.
41.	Wu HC, etal., Eur Urol. 2003 Feb;43(2):197-200.
42.	Zeng GF, etal., J Ethnopharmacol. 2011 Jun 14;136(1):224-9. Epub 2011 Apr 28.

Additional References at PubMed

PMID:2336375	PMID:2394711	PMID:2785029	PMID:3019668	PMID:6967872	PMID:7768973	PMID:9076588	PMID:10393081	PMID:10486212	PMID:10865224	PMID:11199188	PMID:11396736
PMID:11574953	PMID:11856645	PMID:11918225	PMID:11979972	PMID:12112004	PMID:12145306	PMID:12202187	PMID:12270142	PMID:12393937	PMID:12467198	PMID:12477932	PMID:12674332
PMID:12843190	PMID:12879219	PMID:15108070	PMID:15502821	PMID:15562030	PMID:15753298	PMID:15949438	PMID:16263577	PMID:16387359	PMID:16412323	PMID:16735944	PMID:17000892
PMID:17023519	PMID:17242729	PMID:17252541	PMID:17254772	PMID:17627084	PMID:17889845	PMID:18160010	PMID:18163903	PMID:18171674	PMID:18285546	PMID:18321663	PMID:18496130
PMID:18551993	PMID:18657532	PMID:19031822	PMID:19063687	PMID:19088165	PMID:19136823	PMID:19453261	PMID:19595020	PMID:19732762	PMID:19751416	PMID:19751417	PMID:19767102
PMID:19856264	PMID:19877133	PMID:20139978	PMID:20200947	PMID:20221651	PMID:20305683	PMID:20355242	PMID:20395593	PMID:20410230	PMID:20433876	PMID:20501596	PMID:20562864
PMID:20574675	PMID:20577791	PMID:20587710	PMID:20592451	PMID:20625700	PMID:20694489	PMID:20831864	PMID:21153019	PMID:21169728	PMID:21178793	PMID:21292339	PMID:21301010
PMID:21333348	PMID:21353261	PMID:21425331	PMID:21427224	PMID:21487672	PMID:21521304	PMID:21521333	PMID:21558934	PMID:21590731	PMID:21713451	PMID:21873635	PMID:21935388
PMID:21944272	PMID:21964930	PMID:21968268	PMID:22034088	PMID:22068385	PMID:22068892	PMID:22102412	PMID:22136751	PMID:22219025	PMID:22517558	PMID:22577088	PMID:22615158
PMID:22652825	PMID:22679141	PMID:22735266	PMID:22752126	PMID:22773701	PMID:22842327	PMID:22978420	PMID:23001602	PMID:23135318	PMID:23162093	PMID:23206207	PMID:23261860
PMID:23342952	PMID:23386651	PMID:23485732	PMID:23512417	PMID:23553865	PMID:23616149	PMID:23696116	PMID:23788330	PMID:24037881	PMID:24078129	PMID:24113735	PMID:24167545
PMID:24219294	PMID:24339141	PMID:24405382	PMID:24455828	PMID:24465160	PMID:24503413	PMID:24529156	PMID:24583540	PMID:24606073	PMID:24785155	PMID:24801588	PMID:24804200
PMID:24842726	PMID:24852846	PMID:24859912	PMID:24893146	PMID:24896339	PMID:25050899	PMID:25068814	PMID:25093461	PMID:25134387	PMID:25163392	PMID:25174991	PMID:25195811
PMID:25224152	PMID:25279794	PMID:25325424	PMID:25327813	PMID:25365314	PMID:25376262	PMID:25416346	PMID:25480426	PMID:25538061	PMID:25577163	PMID:25587715	PMID:25644945
PMID:25675353	PMID:25716667	PMID:25721846	PMID:25738584	PMID:25809656	PMID:25816734	PMID:25855755	PMID:25868823	PMID:25871789	PMID:25932680	PMID:25955226	PMID:25963022
PMID:26077201	PMID:26078267	PMID:26089135	PMID:26166639	PMID:26194493	PMID:26308289	PMID:26372899	PMID:26381729	PMID:26406918	PMID:26567728	PMID:26576474	PMID:26636404
PMID:26708046	PMID:26743527	PMID:26747614	PMID:26772621	PMID:26863345	PMID:26922969	PMID:26938749	PMID:27025722	PMID:27061949	PMID:27251081	PMID:27515675	PMID:27604070
PMID:27667744	PMID:27673554	PMID:27889949	PMID:28000970	PMID:28002816	PMID:28093839	PMID:28106724	PMID:28242268	PMID:28429221	PMID:28443718	PMID:28521505	PMID:28732499
PMID:28766135	PMID:28822067	PMID:28841723	PMID:28847266	PMID:28921598	PMID:28922389	PMID:28933309	PMID:28991837	PMID:29050649	PMID:29172726	PMID:29476244	PMID:29638140
PMID:29712943	PMID:29882816	PMID:30010079	PMID:30051143	PMID:30089739	PMID:30179426	PMID:30188218	PMID:30372633	PMID:30424752	PMID:30941847	PMID:31300749	PMID:31397589
PMID:31455100	PMID:31549398	PMID:31769248	PMID:31886290	PMID:32296183	PMID:32370705	PMID:32418417	PMID:32927845	PMID:33057142	PMID:33237935

Genomics

Comparative Map Data

BGLAP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38.p13 Ensembl	1	156,242,184 - 156,243,317 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh38	1	156,242,184 - 156,243,317 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh37	1	156,211,975 - 156,213,108 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	154,478,629 - 154,479,736 (+)	NCBI	NCBI36		hg18	NCBI36
Build 34	1	153,025,077 - 153,026,185	NCBI
Celera	1	129,284,933 - 129,286,094 (+)	NCBI
Cytogenetic Map	1	q22	NCBI
HuRef	1	127,573,050 - 127,574,222 (+)	NCBI		HuRef
CHM1_1	1	157,607,726 - 157,609,096 (+)	NCBI		CHM1_1

Bglap
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	88,290,802 - 88,291,773 (-)	NCBI	GRCm39		mm39
GRCm39 Ensembl	3	88,290,808 - 88,291,771 (-)	Ensembl
GRCm38	3	88,383,495 - 88,384,466 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	88,383,501 - 88,384,464 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	88,187,417 - 88,188,386 (-)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	3	88,469,422 - 88,470,391 (-)	NCBI			mm8
Celera	3	88,423,135 - 88,424,104 (-)	NCBI		Celera
Cytogenetic Map	3	F1	NCBI
cM Map	3	38.82	NCBI

Bglap
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	173,838,518 - 173,839,495 (-)	NCBI
Rnor_6.0 Ensembl	2	187,741,770 - 187,742,747 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0	2	187,741,770 - 187,748,445 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_5.0	2	207,144,494 - 207,150,926 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	180,482,313 - 180,483,290 (-)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	2	180,432,418 - 180,433,396 (-)	NCBI
Celera	2	167,783,260 - 167,784,237 (-)	NCBI		Celera
Cytogenetic Map	2	q34	NCBI

Bglap
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955545	2,381,156 - 2,381,978 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955545	2,381,091 - 2,382,114 (+)	NCBI	ChiLan1.0	ChiLan1.0

BGLAP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	1	135,413,871 - 135,416,432 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	135,413,871 - 135,416,432 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	1	131,583,789 - 131,586,459 (+)	NCBI	Mhudiblu_PPA_v0		panPan3

BGLAP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	41,630,092 - 41,630,976 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	41,630,098 - 41,665,791 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	41,117,871 - 41,118,763 (-)	NCBI
ROS_Cfam_1.0	7	41,494,521 - 41,495,418 (-)	NCBI
UMICH_Zoey_3.1	7	41,275,834 - 41,276,717 (-)	NCBI
UNSW_CanFamBas_1.0	7	41,329,023 - 41,329,894 (-)	NCBI
UU_Cfam_GSD_1.0	7	41,613,117 - 41,614,007 (-)	NCBI

LOC101978603
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	26,449,368 - 26,451,906 (+)	NCBI
SpeTri2.0	NW_004936580	5,480,023 - 5,482,288 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LOC103223843
(Chlorocebus sabaeus - African green monkey)

Vervet Assembly	Chr	Position (strand)	Source	Genome Browsers
Vervet Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	7,623,716 - 7,626,353 (-)	NCBI
ChlSab1.1 Ensembl	20	7,623,883 - 7,624,812 (-)	Ensembl

Bglap
(Heterocephalus glaber - naked mole-rat)

Molerat Assembly	Chr	Position (strand)	Source	Genome Browsers
Molerat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624885	1,526,625 - 1,528,235 (+)	NCBI

Position Markers

PMC351321P3

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	1	156,212,359 - 156,212,931	UniSTS	GRCh37
Build 36	1	154,478,983 - 154,479,555	RGD	NCBI36
Celera	1	129,285,341 - 129,285,913	RGD
Cytogenetic Map	1	q	UniSTS
Cytogenetic Map	1	q22	UniSTS
HuRef	1	127,573,458 - 127,574,030	UniSTS

A003B36

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	1	156,213,273 - 156,213,422	UniSTS	GRCh37
Build 36	1	154,479,897 - 154,480,046	RGD	NCBI36
Celera	1	129,286,255 - 129,286,404	RGD
Cytogenetic Map	1	q22	UniSTS
HuRef	1	127,574,372 - 127,574,521	UniSTS
GeneMap99-GB4 RH Map	1	562.48	UniSTS
NCBI RH Map	1	1405.1	UniSTS

AB055289

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	1	156,213,226 - 156,213,374	UniSTS	GRCh37
Build 36	1	154,479,850 - 154,479,998	RGD	NCBI36
Celera	1	129,286,208 - 129,286,356	RGD
HuRef	1	127,574,325 - 127,574,473	UniSTS

STS-X04143

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	1	156,212,985 - 156,213,169	UniSTS	GRCh37
Build 36	1	154,479,609 - 154,479,793	RGD	NCBI36
Celera	1	129,285,967 - 129,286,151	RGD
Cytogenetic Map	1	q22	UniSTS
HuRef	1	127,574,084 - 127,574,268	UniSTS
GeneMap99-GB4 RH Map	1	560.93	UniSTS

RH12024

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	1	156,213,292 - 156,213,460	UniSTS	GRCh37
Build 36	1	154,479,916 - 154,480,084	RGD	NCBI36
Celera	1	129,286,274 - 129,286,442	RGD
Cytogenetic Map	1	q22	UniSTS
HuRef	1	127,574,391 - 127,574,559	UniSTS
GeneMap99-GB4 RH Map	1	562.37	UniSTS
NCBI RH Map	1	1400.3	UniSTS

RH11125

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	1	156,212,062 - 156,212,394	UniSTS	GRCh37
Build 36	1	154,478,686 - 154,479,018	RGD	NCBI36
Celera	1	129,285,044 - 129,285,376	RGD
Cytogenetic Map	1	q22	UniSTS
HuRef	1	127,573,161 - 127,573,493	UniSTS
GeneMap99-GB4 RH Map	1	562.07	UniSTS

UniSTS:485876

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	1	156,211,951 - 156,213,043	UniSTS	GRCh37
Celera	1	129,284,933 - 129,286,025	UniSTS
HuRef	1	127,573,050 - 127,574,142	UniSTS

miRNA Target Status

Confirmed Target Of

miRNA Gene	Mature miRNA	Method Name	Result Type	Data Type	Support Type	PMID
MIR146A	hsa-miR-146a-5p	Mirtarbase	external_info	qRT-PCR	Functional MTI (Weak)	20110513
MIR135B	hsa-miR-135b-5p	Mirtarbase	external_info	qRT-PCR	Non-Functional MTI (Weak)	19795981

Predicted Target Of

	Summary Value
Count of predictions:	650
Count of miRNA genes:	445
Interacting mature miRNAs:	493
Transcripts:	ENST00000368272, ENST00000471413
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

alimentary part of gastrointestinal system

circulatory system

endocrine system

exocrine system

hemolymphoid system

hepatobiliary system

integumental system

musculoskeletal system

nervous system

renal system

reproductive system

respiratory system

sensory system

adipose tissue

appendage

entire extraembryonic component

pharyngeal arch

High

Medium

862

358

857

199

404

373

1670

604

671

209

317

Low

1517

2593

821

570

1503

418

3905

1810

2049

292

815

882

160

995

2470

Below cutoff

161

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NG_047015	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_199173	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AY147065	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC113432	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC113434	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BU622466	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CA428336	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH471121	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CS025626	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CS185557	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ007079	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HD117875	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	HH735900	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X04143	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X51699	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X53698	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENST00000368272 ⟹ ENSP00000357255

RefSeq Status:

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p13 Ensembl	1	156,242,184 - 156,243,317 (+)	Ensembl

RefSeq Acc Id:

ENST00000471413

RefSeq Status:

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p13 Ensembl	1	156,242,189 - 156,243,289 (+)	Ensembl

RefSeq Acc Id:

NM_199173 ⟹ NP_954642

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	1	156,242,184 - 156,243,317 (+)	NCBI
GRCh37	1	156,211,951 - 156,213,123 (+)	ENTREZGENE
Build 36	1	154,478,629 - 154,479,736 (+)	NCBI Archive
HuRef	1	127,573,050 - 127,574,222 (+)	ENTREZGENE
CHM1_1	1	157,607,726 - 157,609,096 (+)	NCBI

Sequence:

show sequence

GATTGTGGCTCACCCTCCATCACTCCCAGGGGCCCCTGGCCCAGCAGCCGCAGCTCCCAACCAC
AATATCCTTTGGGGTTTGGCCTACGGAGCTGGGGCGGATGACCCCCAAATAGCCCTGGCAGATT
CCCCCTAGACCCGCCCGCACCATGGTCAGGCATGCCCCTCCTCATCGCTGGGCACAGCCCAGAG
GGTATAAACAGTGCTGGAGGCTGGCGGGGCAGGCCAGCTGAGTCCTGAGCAGCAGCCCAGCGCA
GCCACCGAGACACCATGAGAGCCCTCACACTCCTCGCCCTATTGGCCCTGGCCGCACTTTGCAT
CGCTGGCCAGGCAGGTGCGAAGCCCAGCGGTGCAGAGTCCAGCAAAGGTGCAGCCTTTGTGTCC
AAGCAGGAGGGCAGCGAGGTAGTGAAGAGACCCAGGCGCTACCTGTATCAATGGCTGGGAGCCC
CAGTCCCCTACCCGGATCCCCTGGAGCCCAGGAGGGAGGTGTGTGAGCTCAATCCGGACTGTGA
CGAGTTGGCTGACCACATCGGCTTTCAGGAGGCCTATCGGCGCTTCTACGGCCCGGTCTAGGGT
GTCGCTCTGCTGGCCTGGCCGGCAACCCCAGTTCTGCTCCTCTCCAGGCACCCTTCTTTCCTCT
TCCCCTTGCCCTTGCCCTGACCTCCCAGCCCTATGGATGTGGGGTCCCCATCATCCCAGCTGCT
CCCAAATAAACTCCAGAAGAGGAATCTGTGGGCCTGTGAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_954642	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI13433	(Get FASTA)	NCBI Sequence Viewer
	AAI13435	(Get FASTA)	NCBI Sequence Viewer
	AAY16981	(Get FASTA)	NCBI Sequence Viewer
	CAA27763	(Get FASTA)	NCBI Sequence Viewer
	CAA35996	(Get FASTA)	NCBI Sequence Viewer
	CAA37736	(Get FASTA)	NCBI Sequence Viewer
	CAI61690	(Get FASTA)	NCBI Sequence Viewer
	CAJ42738	(Get FASTA)	NCBI Sequence Viewer
	CBW53724	(Get FASTA)	NCBI Sequence Viewer
	CBX74359	(Get FASTA)	NCBI Sequence Viewer
	EAW52986	(Get FASTA)	NCBI Sequence Viewer
	P02818	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_954642 ⟸ NM_199173
- Peptide Label:	preproprotein
- UniProtKB:	P02818 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MRALTLLALLALAALCIAGQAGAKPSGAESSKGAAFVSKQEGSEVVKRPRRYLYQWLGAPVPYP DPLEPRREVCELNPDCDELADHIGFQEAYRRFYGPV hide sequence

RefSeq Acc Id:

ENSP00000357255 ⟸ ENST00000368272

Protein Domains

Gla

Promoters

RGD ID:

6784706

Promoter ID:

HG_KWN:5492

Type:

CpG-Island

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

CD4+TCell, HeLa_S3, Lymphoblastoid, NB4

Transcripts:

OTTHUMT00000040867, OTTHUMT00000046294

Position:

Human Assembly	Chr	Position (strand)	Source
Build 36	1	154,477,441 - 154,478,787 (+)	MPROMDB

RGD ID:

6857558

Promoter ID:

EPDNEW_H1944

Type:

initiation region

Name:

BGLAP_2

Description:

bone gamma-carboxyglutamate protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H1946

Experiment Methods:

Single-end sequencing.; Paired-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	1	156,233,626 - 156,233,686	EPDNEW

RGD ID:

6857562

Promoter ID:

EPDNEW_H1946

Type:

multiple initiation site

Name:

BGLAP_1

Description:

bone gamma-carboxyglutamate protein

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_H1944

Experiment Methods:

Single-end sequencing.; Paired-end sequencing.

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	1	156,242,189 - 156,242,249	EPDNEW

Clinical Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
NM_198406.3(PAQR6):c.*663C>T	single nucleotide variant	Calcium oxalate urolithiasis [RCV000128582]	Chr1:156243466 [GRCh38] Chr1:156213257 [GRCh37] Chr1:154479881 [NCBI36] Chr1:1q22	association
GRCh38/hg38 1q22(chr1:155834419-156434205)x3	copy number gain	See cases [RCV000138885]	Chr1:155834419..156434205 [GRCh38] Chr1:155804210..156403997 [GRCh37] Chr1:154070834..154670621 [NCBI36] Chr1:1q22	uncertain significance
GRCh38/hg38 1q21.3-23.1(chr1:154566501-157624084)x3	copy number gain	See cases [RCV000139902]	Chr1:154566501..157624084 [GRCh38] Chr1:154538977..157593874 [GRCh37] Chr1:152805601..155860498 [NCBI36] Chr1:1q21.3-23.1	pathogenic
GRCh38/hg38 1q21.2-25.2(chr1:149854269-180267197)x3	copy number gain	See cases [RCV000143515]	Chr1:149854269..180267197 [GRCh38] Chr1:149825831..180236332 [GRCh37] Chr1:148092455..178502955 [NCBI36] Chr1:1q21.2-25.2	pathogenic
GRCh37/hg19 1q21.3-23.1(chr1:153751465-156660462)x3	copy number gain	not provided [RCV000585385]	Chr1:153751465..156660462 [GRCh37] Chr1:1q21.3-23.1	likely pathogenic
GRCh37/hg19 1q22(chr1:156070888-156238593)x1	copy number loss	See cases [RCV000599483]	Chr1:156070888..156238593 [GRCh37] Chr1:1q22	pathogenic
GRCh37/hg19 1p36.33-q44(chr1:849467-249224684)x3	copy number gain	See cases [RCV000510383]	Chr1:849467..249224684 [GRCh37] Chr1:1p36.33-q44	pathogenic
GRCh37/hg19 1p36.33-q44(chr1:849467-249224684)	copy number gain	See cases [RCV000510926]	Chr1:849467..249224684 [GRCh37] Chr1:1p36.33-q44	pathogenic
Single allele	inversion	Pediatric metastatic thyroid tumour [RCV000585807]	Chr1:154130985..156843877 [GRCh37] Chr1:1q21.3-23.1	likely pathogenic
GRCh37/hg19 1q22-23.1(chr1:155636337-158024499)x1	copy number loss	not provided [RCV000684658]	Chr1:155636337..158024499 [GRCh37] Chr1:1q22-23.1	pathogenic
GRCh37/hg19 1q22-23.1(chr1:155999570-156844432)x3	copy number gain	not provided [RCV000684659]	Chr1:155999570..156844432 [GRCh37] Chr1:1q22-23.1	uncertain significance
GRCh37/hg19 1p36.33-q44(chr1:47851-249228449)x3	copy number gain	not provided [RCV000736295]	Chr1:47851..249228449 [GRCh37] Chr1:1p36.33-q44	pathogenic
GRCh37/hg19 1p36.33-q44(chr1:82154-249218992)x3	copy number gain	not provided [RCV000736305]	Chr1:82154..249218992 [GRCh37] Chr1:1p36.33-q44	pathogenic
LMNA-NTRK1 fusion	fusion	Infantile fibrosarcoma [RCV000754610]	Chr1:156100565..156844697 [GRCh37] Chr1:1q22-23.1	pathogenic
NM_199173.6(BGLAP):c.281G>A (p.Arg94Gln)	single nucleotide variant	not provided [RCV000961307]	Chr1:156243140 [GRCh38] Chr1:156212931 [GRCh37] Chr1:1q22	benign
NC_000001.11:g.(?_156114919)_(156243162_?)del	deletion	Charcot-Marie-Tooth disease, type 2 [RCV000823232]	Chr1:156114919..156243162 [GRCh38] Chr1:156084710..156212953 [GRCh37] Chr1:1q22	pathogenic
GRCh37/hg19 1q22(chr1:156037369-156463980)x3	copy number gain	not provided [RCV000846254]	Chr1:156037369..156463980 [GRCh37] Chr1:1q22	uncertain significance
GRCh37/hg19 1q22-23.1(chr1:155770505-156652136)x3	copy number gain	not provided [RCV000848811]	Chr1:155770505..156652136 [GRCh37] Chr1:1q22-23.1	uncertain significance
NC_000001.10:g.(?_130980840)_(248900000_?)dup	duplication	Gastrointestinal stromal tumor [RCV001300221]\|Parathyroid carcinoma [RCV001341077]	Chr1:130980840..248900000 [GRCh37] Chr1:1q12-44	uncertain significance

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	HGNC:1043	AgrOrtholog
COSMIC	BGLAP	COSMIC
Ensembl Genes	ENSG00000242252	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSP00000357255	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000368272	ENTREZGENE, UniProtKB/Swiss-Prot
GTEx	ENSG00000242252	GTEx
HGNC ID	HGNC:1043	ENTREZGENE
Human Proteome Map	BGLAP	Human Proteome Map
InterPro	GLA-like_dom_SF	UniProtKB/Swiss-Prot
	GLA_domain	UniProtKB/Swiss-Prot
	Osteocalcin	UniProtKB/Swiss-Prot
	Osteocalcin/MGP	UniProtKB/Swiss-Prot
KEGG Report	hsa:632	UniProtKB/Swiss-Prot
NCBI Gene	632	ENTREZGENE
OMIM	112260	OMIM
PANTHER	PTHR14235	UniProtKB/Swiss-Prot
PharmGKB	BGLAP	RGD, PharmGKB
PRINTS	GLABONE	UniProtKB/Swiss-Prot
PROSITE	GLA_1	UniProtKB/Swiss-Prot
	GLA_2	UniProtKB/Swiss-Prot
SMART	GLA	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF57630	UniProtKB/Swiss-Prot
UniProt	OSTCN_HUMAN	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	Q5TCK6	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-29	BGLAP	bone gamma-carboxyglutamate protein		bone gamma-carboxyglutamate (gla) protein	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - PID (archival)