Pak2 (p21 (RAC1) activated kinase 2)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Pak2 (p21 (RAC1) activated kinase 2) Rattus norvegicus

Analyze

Symbol:

Pak2

Name:

p21 (RAC1) activated kinase 2

RGD ID:

61953

Description:

Predicted to enable several functions, including enzyme binding activity; identical protein binding activity; and protein tyrosine kinase activator activity. Involved in cardiac muscle hypertrophy and cellular response to transforming growth factor beta stimulus. Located in secretory granule. Biomarker of ureteral obstruction. Human ortholog(s) of this gene implicated in ductal carcinoma in situ. Orthologous to human PAK2 (p21 (RAC1) activated kinase 2); PARTICIPATES IN vascular endothelial growth factor signaling pathway; epidermal growth factor/neuregulin signaling pathway; mitogen activated protein kinase signaling pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,3,7,8-Tetrachlorodibenzofuran; 2,4,6-trinitrobenzenesulfonic acid.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

gamma-PAK; LOC100910732; p21 (CDKN1A)-activated kinase 2; p21 protein (Cdc42/Rac)-activated kinase 2; p21-activated kinase 2; PAK-2; serine/threonine-protein kinase PAK 2; serine/threonine-protein kinase PAK 2-like

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PAK2 (p21 (RAC1) activated kinase 2)	HGNC	EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Pak2 (p21 (RAC1) activated kinase 2)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Pak2 (p21 (RAC1) activated kinase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PAK2 (p21 (RAC1) activated kinase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PAK2 (p21 (RAC1) activated kinase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pak2 (p21 (RAC1) activated kinase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PAK2 (p21 (RAC1) activated kinase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PAK2 (p21 (RAC1) activated kinase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pak2 (p21 (RAC1) activated kinase 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Pak2 (p21 (RAC1) activated kinase 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PAK2 (p21 (RAC1) activated kinase 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pak2b (p21 protein (Cdc42/Rac)-activated kinase 2b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	pak2a (p21 protein (Cdc42/Rac)-activated kinase 2a)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	STE20	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	pak-1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pak2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	11	68,707,940 - 68,768,816 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	68,707,969 - 68,768,816 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	77,545,003 - 77,605,878 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	70,206,629 - 70,267,901 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	69,234,099 - 69,294,967 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	72,829,407 - 72,865,815 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	72,829,238 - 72,865,902 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	11	71,959,228 - 72,021,224 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	75,895,329 - 75,939,106 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	70,529,961 - 70,588,511 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	11	70,587,549 - 70,646,100 (+)	NCBI
Celera	11	68,130,464 - 68,189,144 (+)	NCBI		Celera
Cytogenetic Map	11	q22	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

atrial fibrillation (ISO)

autism spectrum disorder (ISS)

autistic disorder (ISO)

Breast Neoplasms (ISO)

chromosome 3q29 microdeletion syndrome (ISO)

ductal carcinoma in situ (ISO)

genetic disease (ISO)

Knobloch Syndrome (ISO)

Knobloch Syndrome Type II (ISO)

proteinuria (ISO)

Puromycin Aminonucleoside Nephrosis (IEP)

schizophrenia (ISO)

ureteral obstruction (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-citrinin (ISO)

(S)-nicotine (ISO)

1,2-dimethylhydrazine (ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4,6-trinitrobenzenesulfonic acid (EXP)

2-amino-14,16-dimethyloctadecan-3-ol (ISO)

2-ethoxyethanol (EXP)

2-methoxyethanol (EXP)

4,4'-diaminodiphenylmethane (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

butanal (ISO)

cadmium atom (ISO)

caffeine (ISO)

carbamazepine (ISO)

CGP 52608 (ISO)

chlorpyrifos (EXP)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

coumarin (ISO)

curcumin (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (ISO)

diclofenac (ISO)

dimethylarsinic acid (EXP)

doxorubicin (ISO)

epoxiconazole (ISO)

ethanol (ISO)

Ethylenethiourea (EXP)

folic acid (ISO)

genistein (ISO)

hexadecanoic acid (ISO)

hydrogen peroxide (ISO)

ivermectin (ISO)

methapyrilene (EXP)

methotrexate (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

nickel atom (ISO)

nicotine (ISO)

oxaliplatin (EXP,ISO)

p-menthan-3-ol (ISO)

p-toluidine (EXP)

paracetamol (EXP,ISO)

pirinixic acid (EXP,ISO)

poly(I:C) (EXP)

resveratrol (ISO)

Salinomycin (ISO)

tamibarotene (ISO)

tetrachloromethane (ISO)

tetracycline (ISO)

thapsigargin (EXP)

thioacetamide (EXP)

topotecan (EXP)

valproic acid (ISO)

vitamin E (ISO)

zearalenone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adherens junction assembly (ISO)

bicellular tight junction assembly (ISO)

cardiac muscle hypertrophy (IEP)

cellular response to organic cyclic compound (ISO)

cellular response to transforming growth factor beta stimulus (IEP)

dendritic spine development (ISO)

intracellular signal transduction (IBA)

localization (ISO)

negative regulation of apoptotic process (ISO)

negative regulation of stress fiber assembly (ISO)

phosphorylation (ISO)

positive regulation of extrinsic apoptotic signaling pathway (ISO)

positive regulation of peptidyl-tyrosine phosphorylation (ISO)

protein localization to cell-cell junction (ISO)

regulation of axonogenesis (IBA)

regulation of cytoskeleton organization (ISO)

regulation of MAPK cascade (IBA)

Cellular Component

cell-cell junction (ISO)

cytoplasm (IBA,ISO)

cytosol (ISO)

glutamatergic synapse (ISO)

membrane (IEA)

nucleus (ISO)

perinuclear region of cytoplasm (IEA)

postsynaptic density (ISO)

secretory granule (IDA)

Molecular Function

ATP binding (IEA)

identical protein binding (ISO)

protein binding (ISO)

protein kinase activity (ISO)

protein kinase binding (ISO)

protein serine kinase activity (IEA)

protein serine/threonine kinase activity (IBA,IEA,ISO,ISS)

protein tyrosine kinase activator activity (ISO)

small GTPase binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

epidermal growth factor/neuregulin signaling pathway (IEA)

mitogen activated protein kinase signaling pathway (IEA)

renal cell carcinoma pathway (IEA)

T cell receptor signaling pathway (IEA)

vascular endothelial growth factor signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Expression of mitogen-activated protein kinase pathways during postnatal development of rat heart.	Kim SO, etal., J Cell Biochem 1998 Nov 1;71(2):286-301.
4.	Identification and validation of new autoantibodies for the diagnosis of DCIS and node negative early-stage breast cancers.	Lacombe J, etal., Int J Cancer. 2013 Mar 1;132(5):1105-13. doi: 10.1002/ijc.27766. Epub 2012 Aug 28.
5.	A brain serine/threonine protein kinase activated by Cdc42 and Rac1.	Manser E, etal., Nature 1994 Jan 6;367(6458):40-6.
6.	A novel serine kinase activated by rac1/CDC42Hs-dependent autophosphorylation is related to PAK65 and STE20.	Martin GA, etal., EMBO J 1995 May 1;14(9):1970-8.
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Comprehensive gene review and curation	RGD comprehensive gene curation
13.	p21-activated protein kinase gamma-PAK in pituitary secretory granules phosphorylates prolactin.	Tuazon PT, etal., FEBS Lett. 2002 Mar 27;515(1-3):84-8.
14.	A novel player in cellular hypertrophy: Gibetagamma/PI3K-dependent activation of the RacGEF TIAM-1 is required for alpha(1)-adrenoceptor induced hypertrophy in neonatal rat cardiomyocytes.	Vettel C, etal., J Mol Cell Cardiol. 2012 Aug;53(2):165-75. doi: 10.1016/j.yjmcc.2012.04.015. Epub 2012 May 4.
15.	Imatinib mesylate blocks a non-Smad TGF-beta pathway and reduces renal fibrogenesis in vivo.	Wang S, etal., FASEB J. 2005 Jan;19(1):1-11.
16.	Cell-type-specific activation of PAK2 by transforming growth factor beta independent of Smad2 and Smad3.	Wilkes MC, etal., Mol Cell Biol. 2003 Dec;23(23):8878-89.
17.	p21-activated kinases regulate actin remodeling in glomerular podocytes.	Zhu J, etal., Am J Physiol Renal Physiol. 2010 Apr;298(4):F951-61. doi: 10.1152/ajprenal.00536.2009. Epub 2010 Jan 13.

Additional References at PubMed

PMID:7592896	PMID:8625410	PMID:10075701	PMID:11121037	PMID:11278486	PMID:11805089	PMID:15182717	PMID:16396499	PMID:16641100	PMID:16837009	PMID:17060906	PMID:17224451
PMID:19103160	PMID:19240112	PMID:21555521	PMID:22871113	PMID:23509247	PMID:25468996	PMID:25753039	PMID:25979836	PMID:26912410	PMID:28408623	PMID:30620686	PMID:31505169

Genomics

Comparative Map Data

Pak2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	11	68,707,940 - 68,768,816 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	68,707,969 - 68,768,816 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	77,545,003 - 77,605,878 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	11	70,206,629 - 70,267,901 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	11	69,234,099 - 69,294,967 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	11	72,829,407 - 72,865,815 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	72,829,238 - 72,865,902 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_6.0 Ensembl	11	71,959,228 - 72,021,224 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	75,895,329 - 75,939,106 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	70,529,961 - 70,588,511 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	11	70,587,549 - 70,646,100 (+)	NCBI
Celera	11	68,130,464 - 68,189,144 (+)	NCBI		Celera
Cytogenetic Map	11	q22	NCBI

PAK2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	3	196,739,857 - 196,832,647 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	3	196,739,857 - 196,832,647 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	3	196,466,728 - 196,559,518 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	197,951,312 - 198,043,756 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	3	197,955,224 - 198,047,662	NCBI
Celera	3	195,047,767 - 195,144,272 (+)	NCBI		Celera
Cytogenetic Map	3	q29	NCBI
HuRef	3	193,763,319 - 193,859,670 (+)	NCBI		HuRef
CHM1_1	3	196,437,954 - 196,530,860 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	3	199,459,234 - 199,558,334 (+)	NCBI		T2T-CHM13v2.0

Pak2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	16	31,835,108 - 31,898,160 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	16	31,835,108 - 31,898,160 (-)	Ensembl		GRCm39 Ensembl
GRCm38	16	32,016,290 - 32,079,342 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	16	32,016,290 - 32,079,342 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	16	32,017,949 - 32,079,359 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	16	31,937,610 - 31,999,020 (-)	NCBI		MGSCv36	mm8
Celera	16	32,511,700 - 32,575,354 (-)	NCBI		Celera
Cytogenetic Map	16	B2	NCBI
cM Map	16	22.4	NCBI

Pak2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955420	12,892,845 - 12,930,955 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955420	12,893,760 - 12,930,955 (+)	NCBI	ChiLan1.0	ChiLan1.0

PAK2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	3	194,614,360 - 194,704,443 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	3	194,084,037 - 194,174,010 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	3	204,023,357 - 204,111,515 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	3	204,023,357 - 204,111,507 (+)	Ensembl	panpan1.1		panPan2

PAK2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	33	29,774,645 - 29,863,661 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	33	29,774,593 - 29,987,478 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	33	29,798,837 - 29,887,939 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	33	30,018,726 - 30,108,342 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	33	30,018,587 - 30,235,797 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	33	29,795,936 - 29,906,532 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	33	29,850,899 - 29,940,690 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	33	30,473,517 - 30,563,048 (+)	NCBI		UU_Cfam_GSD_1.0

Pak2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	124,493,276 - 124,572,628 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936784	1,351,039 - 1,391,992 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936784	1,351,034 - 1,391,992 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PAK2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	133,273,112 - 133,389,458 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	133,276,122 - 133,383,506 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	142,923,496 - 142,963,953 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PAK2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	15	90,474,367 - 90,488,814 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	15	90,398,660 - 90,449,346 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
ChlSab1.1 Ensembl	15	90,398,660 - 90,449,346 (-)	NCBI	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666041	64,177,811 - 64,268,335 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pak2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624730	61,817,300 - 61,879,755 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624730	61,809,876 - 61,879,755 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pak2
422 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	27
Count of miRNA genes:	26
Interacting mature miRNAs:	27
Transcripts:	ENSRNOT00000049862
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300147	Bp187	Blood pressure QTL 187	3.67		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	11	1	69446234	Rat
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	18976208	86241447	Rat
724563	Uae10	Urinary albumin excretion QTL 10	6		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	11	27672410	82846715	Rat
1300110	Stl7	Serum triglyceride level QTL 7	4.64		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	11	29528418	82566702	Rat
2298551	Neuinf10	Neuroinflammation QTL 10	3.7		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	11	31239134	78851519	Rat
70180	BpQTLcluster10	Blood pressure QTL cluster 10	3.19		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	11	34918041	79918041	Rat
1300135	Rf19	Renal function QTL 19	3.38		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	11	40946188	82566702	Rat
2312566	Glom20	Glomerulus QTL 20	3.6	0.001	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	11	44285759	82566702	Rat
1581565	Pur10	Proteinuria QTL 10		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	44803318	82846466	Rat
1581572	Uae35	Urinary albumin excretion QTL 35		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	44803318	82846466	Rat
4889859	Pur28	Proteinuria QTL 28	19.5	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	11	45459323	75190161	Rat
724561	Plsm4	Polydactyly-luxate syndrome (PLS) morphotypes QTL 4		0.0003	forelimb integrity trait (VT:0010562)	front foot phalanges count (CMO:0001947)	11	54457534	86241447	Rat
4889521	Gluco62	Glucose level QTL 62	2.82	0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	55136729	82993457	Rat
7411658	Foco27	Food consumption QTL 27	16.2	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	11	56351424	86241447	Rat
631506	Bp104	Blood pressure QTL 104	2.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	11	59802794	82566545	Rat
70208	Niddm22	Non-insulin dependent diabetes mellitus QTL 22	3.61		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	11	59802794	82566553	Rat
10058954	Gmadr7	Adrenal mass QTL 7	2.49	0.0049	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	60346590	86241447	Rat
1549848	Bvd6	Brain ventricular dilatation QTL 6	3.1	0.0001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	11	66113321	82169223	Rat
634339	Niddm50	Non-insulin dependent diabetes mellitus QTL 50	3.32		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	11	66422148	86241447	Rat
1354593	Stl12	Serum triglyceride level QTL 12	3.36		blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	11	66422148	86241447	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium
Low			3		6						1	1
Below cutoff	2	5	18	6	11	6	6	6	13	8	11	9	6

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001393703	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_053306	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473967	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000222	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S80221	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U19967	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U35345	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000049862 ⟹ ENSRNOP00000040162

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	68,707,969 - 68,767,873 (+)	Ensembl
Rnor_6.0 Ensembl	11	71,959,228 - 72,017,463 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000071060 ⟹ ENSRNOP00000065949

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	11	72,829,238 - 72,865,902 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000077269 ⟹ ENSRNOP00000072644

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	68,730,236 - 68,768,816 (+)	Ensembl
Rnor_6.0 Ensembl	11	71,981,060 - 72,021,224 (+)	Ensembl

RefSeq Acc Id:

NM_001393703 ⟹ NP_001380632

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	11	68,707,940 - 68,768,816 (+)	NCBI

RefSeq Acc Id:

NM_053306 ⟹ NP_445758

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	11	68,707,940 - 68,768,816 (+)	NCBI
Rnor_6.0	11	72,829,407 - 72,865,815 (+)	NCBI
Rnor_5.0	11	75,895,329 - 75,939,106 (+)	NCBI
RGSC_v3.4	11	70,529,961 - 70,588,511 (+)	RGD
Celera	11	68,130,464 - 68,189,144 (+)	RGD

Sequence:

show sequence

AAAGTACAAAGAAGTTACTGCCATCCTCCCTCTCTCGTCCCCTAGCACAGTGCTCGCCCGCGTC
TGGCCCTGGCAGGCCCTGGGTCGGGCGGAGACCTTTCCTCTCTGGCTGTTTCCTAATTCTGAAT
CATGTCTGATAACGGGGAGCTAGAGGACAAGCCCCCAGCACCTCCAGTGCGGATGAGCAGCACC
ATTTTTAGCACTGGAGGAAAGGATCCTTTATCAGCCAATCACAGTTTGAAGCCTTTGCCTTCTG
TTCCAGAGGAAAAAAAACCGAGGAACAAAATCATCTCCATATTCTCAAGCACAGAAAAAGGAAG
TAAAAAGAAAGAAAAAGAACGGCCAGAGATTTCTCCGCCGTCTGATTTTGAGTATACCATCCAT
GTTGGCTTTGATGCTGTTACGGGAGAGTTCACTGGCATGCCAGAGCAGTGGGCACGGCTGTTGC
AGACCTCCAACATTACCAAACTGGAGCAGAAGAAGAACCCGCAGGCTGTGCTGGATGTCTTGAA
GTTCTACGACTCCAACACTGTGAAGCAGAAGTACCTGAGCTTCACTCCTCCTGAGAAAGATGGC
TTTCCTTCTGGAACACCAGCACTGAACACCAAGGGGTCAGAGACATCAGCTGTGGTGACAGAGG
AAGACGATGACGATGAAGATGCTGCTCCTCCCGTCATTGCCCCTCGGCCAGATCATACAAAATC
AATCTACACAAGGTCTGTCATCGACCCTATTCCTGCTCCAGTTGGTGACTCTAATGTCGACAGT
GGTGCCAAGTCTTCAGACAAACAGAAAAAGAAAGCCAAGATGACCGATGAAGAGATTATGGAGA
AATTAAGAACTATTGTGAGCATAGGTGACCCTAAGAAAAAATACACAAGATATGAAAAAATCGG
GCAAGGGGCTTCTGGTACAGTTTTTACTGCAACTGATGTGGCCCTGGGGCAAGAGGTTGCTATC
AAGCAGATTAATTTACAGAAACAACCAAAGAAGGAATTGATCATTAATGAAATTCTGGTGATGA
AGGAGTTAAAGAATCCCAACATAGTTAACTTCTTGGACAGTTACCTGGTAGGAGACGAGTTGTT
TGTGGTAATGGAGTACCTTGCTGGTGGGTCCCTCACTGATGTCGTGACAGAAACCTGCATGGAT
GAAGCGCAGATCGCAGCTGTGTGCAGAGAGTGTTTACAGGCGTTGGAGTTTTTACATGCTAATC
AAGTGATCCACAGAGACATCAAAAGTGACAATGTGCTTTTGGGAATGGAAGGCTCAGTTAAACT
CACTGATTTTGGCTTCTGTGCCCAGATCACCCCTGAACAGAGCAAACGCAGTACAATGGTTGGA
ACGCCATACTGGATGGCACCGGAGGTAGTCACGCGGGAAGCCTATGGCCCCAAAGTTGACATAT
GGTCTCTGGGCATCATGGCTATCGAAATGGTGGAAGGAGAGCCTCCATACCTCAATGAAAATCC
TTTACGGGCATTATACCTGATAGCAACGAATGGAACACCTGAGCTCCAGAATCCAGAAAAACTT
TCCCCCATATTTCGGGATTTCTTAAATCGGTGTTTGGAAATGGATGTGGAGAAGAGGGGTTCAG
CCAAAGAACTATTACAGCATCCTTTCCTGAAACTGGCCAAACCATTATCCAGCTTGACGCCTCT
GATCCTGGCAGCTAAAGAAGCAATGAAGAGTAACCGCTAACGTCGTCAGCGAGGCCTCATGTTC
CTTTATCCATTTTCTAAAGAAGTCTTTTAATACATGAAATTGTTACTCTGAGGGGTGTAAAGAG
ACAGTTTGCATCACATGGAGAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001380632	(Get FASTA)	NCBI Sequence Viewer
	NP_445758	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA79064	(Get FASTA)	NCBI Sequence Viewer
	AAB35608	(Get FASTA)	NCBI Sequence Viewer
	AAF06695	(Get FASTA)	NCBI Sequence Viewer
	EDM11448	(Get FASTA)	NCBI Sequence Viewer
	Q64303	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_445758 ⟸ NM_053306

- UniProtKB:

Q64303 (UniProtKB/Swiss-Prot), Q9QYU0 (UniProtKB/Swiss-Prot), A6IRU5 (UniProtKB/TrEMBL), A0A8L2R675 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSDNGELEDKPPAPPVRMSSTIFSTGGKDPLSANHSLKPLPSVPEEKKPRNKIISIFSSTEKGS
KKKEKERPEISPPSDFEYTIHVGFDAVTGEFTGMPEQWARLLQTSNITKLEQKKNPQAVLDVLK
FYDSNTVKQKYLSFTPPEKDGFPSGTPALNTKGSETSAVVTEEDDDDEDAAPPVIAPRPDHTKS
IYTRSVIDPIPAPVGDSNVDSGAKSSDKQKKKAKMTDEEIMEKLRTIVSIGDPKKKYTRYEKIG
QGASGTVFTATDVALGQEVAIKQINLQKQPKKELIINEILVMKELKNPNIVNFLDSYLVGDELF
VVMEYLAGGSLTDVVTETCMDEAQIAAVCRECLQALEFLHANQVIHRDIKSDNVLLGMEGSVKL
TDFGFCAQITPEQSKRSTMVGTPYWMAPEVVTREAYGPKVDIWSLGIMAIEMVEGEPPYLNENP
LRALYLIATNGTPELQNPEKLSPIFRDFLNRCLEMDVEKRGSAKELLQHPFLKLAKPLSSLTPL
ILAAKEAMKSNR

hide sequence

RefSeq Acc Id:

ENSRNOP00000065949 ⟸ ENSRNOT00000071060

RefSeq Acc Id:

ENSRNOP00000072644 ⟸ ENSRNOT00000077269

RefSeq Acc Id:

ENSRNOP00000040162 ⟸ ENSRNOT00000049862

RefSeq Acc Id:	NP_001380632 ⟸ NM_001393703
- UniProtKB:	Q64303 (UniProtKB/Swiss-Prot), Q9QYU0 (UniProtKB/Swiss-Prot), A6IRU5 (UniProtKB/TrEMBL), A0A8L2R675 (UniProtKB/TrEMBL)

Protein Domains

CRIB Protein kinase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q64303-F1-model_v2	AlphaFold	Q64303	1-524	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:61953	AgrOrtholog
BioCyc Gene	G2FUF-21079	BioCyc
Ensembl Genes	ENSRNOG00000001747	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOG00000048597	Ensembl
Ensembl Protein	ENSRNOP00000040162	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOP00000072644	ENTREZGENE
	ENSRNOP00000072644.2	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000049862	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOT00000077269	ENTREZGENE
	ENSRNOT00000077269.2	UniProtKB/TrEMBL
Gene3D-CATH	3.90.810.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Transferase(Phosphotransferase) domain 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	CRIB_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CRIB_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Kinase-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PAK_BD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Prot_kinase_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Protein_kinase_ATP_BS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ser/Thr_kinase_AS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	STK_PAK2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:29432	UniProtKB/Swiss-Prot
NCBI Gene	29432	ENTREZGENE
PANTHER	SERINE/THREONINE-PROTEIN KINASE PAK 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SERINE/THREONINE-PROTEIN KINASE TAO	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	PBD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Pkinase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Pak2	PhenoGen
PROSITE	CRIB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROTEIN_KINASE_ATP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROTEIN_KINASE_DOM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PROTEIN_KINASE_ST	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	PBD	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	S_TKc	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF56112	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8L2R675	ENTREZGENE, UniProtKB/TrEMBL
	A6IRU5	ENTREZGENE, UniProtKB/TrEMBL
	PAK2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q9QYU0	ENTREZGENE
UniProt Secondary	Q9QYU0	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Pak2	p21 (RAC1) activated kinase 2	LOC100910732	serine/threonine-protein kinase PAK 2-like	Data Merged	737654	PROVISIONAL
2017-06-20	Pak2	p21 (RAC1) activated kinase 2	Pak2	p21 protein (Cdc42/Rac)-activated kinase 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2017-03-27	Pak2	p21 protein (Cdc42/Rac)-activated kinase 2	Pak2	p21 (RAC1) activated kinase 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-05-12	Pak2	p21 (RAC1) activated kinase 2	Pak2	p21 protein (Cdc42/Rac)-activated kinase 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-05	LOC100910732	serine/threonine-protein kinase PAK 2-like			Symbol and Name status set to provisional	70820	PROVISIONAL
2009-05-27	Pak2	p21 protein (Cdc42/Rac)-activated kinase 2	Pak2	p21 (CDKN1A)-activated kinase 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Pak2	p21 (CDKN1A)-activated kinase 2			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in many tissues	61685
gene_expression	expressed in many tissues	70317
gene_function	phosphorylates protein serine/threonine residues	61685
gene_function	phosphorylates protein serine/threonine residues	70317

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)