Advanced Search (OLGA)

Gene: Psmc3 (proteasome 26S subunit, ATPase 3) Rattus norvegicus

Analyze

Symbol:

Psmc3

Name:

proteasome 26S subunit, ATPase 3

RGD ID:

61905

Description:

Predicted to enable identical protein binding activity and proteasome-activating activity. Predicted to be involved in modulation by host of viral transcription; positive regulation of transcription by RNA polymerase II; and proteasome-mediated ubiquitin-dependent protein catabolic process. Predicted to act upstream of or within blastocyst development. Located in perinuclear region of cytoplasm. Orthologous to human PSMC3 (proteasome 26S subunit, ATPase 3); PARTICIPATES IN ubiquitin/proteasome degradation pathway; INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 1,2,4-trimethylbenzene; 2,2',4,4'-Tetrabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

26S protease regulatory subunit 6A; 26S proteasome AAA-ATPase subunit RPT5; 26S proteasome regulatory subunit 6A; proteasome (prosome, macropain) 26S subunit, ATPase 3; proteasome 26S subunit ATPase 3; spermatogenic cell/sperm-associated TAT-binding protein homolog SATA; TAT-binding protein 1; TBP-1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PSMC3 (proteasome 26S subunit, ATPase 3)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):	Psmc3 (proteasome (prosome, macropain) 26S subunit, ATPase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Psmc3 (proteasome 26S subunit, ATPase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PSMC3 (proteasome 26S subunit, ATPase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PSMC3 (proteasome 26S subunit, ATPase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Psmc3 (proteasome 26S subunit, ATPase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PSMC3 (proteasome 26S subunit, ATPase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PSMC3 (proteasome 26S subunit, ATPase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Psmc3 (proteasome 26S subunit, ATPase 3)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Psmc3 (proteasome (prosome, macropain) 26S subunit, ATPase 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PSMC3 (proteasome 26S subunit, ATPase 3)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	psmc3 (proteasome 26S subunit, ATPase 3)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rpt-5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RPT5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Rpt5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	psmc3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	97,487,643 - 97,493,025 (+)	NCBI		GRCr8
mRatBN7.2	3	77,031,825 - 77,037,207 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	77,031,825 - 77,043,358 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	80,510,318 - 80,515,699 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	89,109,333 - 89,114,714 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	86,960,503 - 86,965,883 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	79,876,938 - 79,882,319 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	79,876,938 - 79,882,319 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	86,585,691 - 86,591,072 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	75,413,567 - 75,418,948 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	75,309,938 - 75,315,317 (+)	NCBI
Celera	3	76,240,531 - 76,245,912 (+)	NCBI		Celera
Cytogenetic Map	3	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

cataract (ISO)

congenital disorder of glycosylation type IIc (ISO)

DEAFNESS, CATARACT, IMPAIRED INTELLECTUAL DEVELOPMENT, AND POLYNEUROPATHY (ISO)

Developmental Disabilities (ISO)

fetal akinesia deformation sequence syndrome 1 (ISO)

genetic disease (ISO)

human immunodeficiency virus infectious disease (ISO)

hypertrophic cardiomyopathy (ISO)

intellectual disability (ISO)

Neurodevelopmental Disorders (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP)

1,2,4-trimethylbenzene (EXP)

1,2-dimethylhydrazine (ISO)

14-Deoxy-11,12-didehydroandrographolide (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO)

1H-pyrazole (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-amino-14,16-dimethyloctadecan-3-ol (ISO)

2-bromohexadecanoic acid (ISO)

2-hydroxypropanoic acid (ISO)

2-methoxyethanol (EXP)

4,4'-sulfonyldiphenol (ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (EXP)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

all-trans-retinoic acid (ISO)

alpha-hexachlorocyclohexane (EXP)

amiodarone (EXP)

ammonium chloride (EXP)

arsenous acid (ISO)

atrazine (ISO)

benzatropine (ISO)

benzbromarone (EXP)

benzo[a]pyrene (ISO)

beta-lapachone (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bromobenzene (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

caffeine (ISO)

cisplatin (ISO)

clofibrate (EXP,ISO)

clozapine (ISO)

cobalt dichloride (ISO)

coumarin (ISO)

coumestrol (ISO)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dibutyl phthalate (ISO)

doxorubicin (ISO)

Enterolactone (ISO)

ethanol (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

FR900359 (ISO)

glafenine (EXP)

hydrazine (ISO)

hydrogen peroxide (ISO)

ivermectin (ISO)

L-ascorbic acid (ISO)

L-ethionine (EXP)

lead(0) (ISO)

leflunomide (EXP)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

methamphetamine (EXP)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

N-nitrosomorpholine (EXP)

nefazodone (EXP)

nimesulide (EXP)

nitrates (ISO)

omeprazole (EXP)

ozone (ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (ISO)

phenethyl isothiocyanate (ISO)

phenobarbital (EXP)

picrotoxin (EXP)

piperonyl butoxide (EXP)

pirinixic acid (EXP,ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

rotenone (EXP)

sodium arsenite (ISO)

sunitinib (ISO)

temozolomide (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

triptonide (ISO)

urethane (ISO)

valdecoxib (EXP)

valproic acid (EXP)

zearalenone (ISO)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

blastocyst development (IEA,ISO)

modulation by host of viral transcription (IEA,ISO)

positive regulation of proteasomal protein catabolic process (IEA)

positive regulation of transcription by RNA polymerase II (IEA,ISO)

proteasome-mediated ubiquitin-dependent protein catabolic process (IBA)

Cellular Component

cytoplasm (IEA)

nucleus (IEA,ISO)

P-body (IEA,ISO,ISS)

perinuclear region of cytoplasm (IDA)

proteasome accessory complex (IEA,ISO,ISS)

proteasome complex (IEA,ISO)

proteasome regulatory particle, base subcomplex (IBA)

Molecular Function

ATP binding (IEA)

ATP hydrolysis activity (IEA)

identical protein binding (IEA,ISO)

nucleotide binding (IEA)

proteasome-activating activity (IBA)

protein binding (IPI,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

ubiquitin/proteasome degradation pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat alpha-synuclein interacts with Tat binding protein 1, a component of the 26S proteasomal complex.	Ghee M, etal., J Neurochem. 2000 Nov;75(5):2221-4.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Structures of the rat proteasomal ATPases: determination of highly conserved structural motifs and rules for their spacing.	Makino Y, etal., Biochem Biophys Res Commun 1996 Mar 27;220(3):1049-54.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	A protein associated with the manchette during rat spermiogenesis is encoded by a gene of the TBP-1-like subfamily with highly conserved ATPase and protease domains.	Rivkin E, etal., Mol Reprod Dev 1997 Sep;48(1):77-89.
11.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
12.	The EARP Complex and Its Interactor EIPR-1 Are Required for Cargo Sorting to Dense-Core Vesicles.	Topalidou I, etal., PLoS Genet. 2016 May 18;12(5):e1006074. doi: 10.1371/journal.pgen.1006074. eCollection 2016 May.

Additional References at PubMed

PMID:2194290	PMID:8419915	PMID:9688553	PMID:10657252	PMID:10945464	PMID:16857966	PMID:17323924	PMID:19182904	PMID:19517565	PMID:19853614	PMID:19946888	PMID:21630459
PMID:22078707	PMID:22871113	PMID:25416956	PMID:30053369	PMID:35352799

Genomics

Comparative Map Data

Psmc3
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	97,487,643 - 97,493,025 (+)	NCBI		GRCr8
mRatBN7.2	3	77,031,825 - 77,037,207 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	77,031,825 - 77,043,358 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	80,510,318 - 80,515,699 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	89,109,333 - 89,114,714 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	86,960,503 - 86,965,883 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	79,876,938 - 79,882,319 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	79,876,938 - 79,882,319 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	86,585,691 - 86,591,072 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	75,413,567 - 75,418,948 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	75,309,938 - 75,315,317 (+)	NCBI
Celera	3	76,240,531 - 76,245,912 (+)	NCBI		Celera
Cytogenetic Map	3	q24	NCBI

PSMC3
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	11	47,418,775 - 47,426,439 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	11	47,418,769 - 47,426,473 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	11	47,440,326 - 47,447,990 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	11	47,396,896 - 47,404,600 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	11	47,396,895 - 47,404,565	NCBI
Celera	11	47,582,015 - 47,589,718 (-)	NCBI		Celera
Cytogenetic Map	11	p11.2	NCBI
HuRef	11	47,139,662 - 47,147,028 (-)	NCBI		HuRef
CHM1_1	11	47,439,552 - 47,447,251 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	11	47,577,679 - 47,585,336 (-)	NCBI		T2T-CHM13v2.0

Psmc3
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	90,884,361 - 90,889,783 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	90,884,354 - 90,896,714 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	91,054,016 - 91,059,438 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	91,054,009 - 91,066,369 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	90,894,173 - 90,899,595 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	90,854,921 - 90,860,267 (+)	NCBI		MGSCv36	mm8
Celera	2	92,438,480 - 92,443,912 (+)	NCBI		Celera
Cytogenetic Map	2	E1	NCBI
cM Map	2	50.44	NCBI

Psmc3
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955422	837,573 - 845,341 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955422	837,934 - 843,161 (+)	NCBI	ChiLan1.0	ChiLan1.0

PSMC3
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	9	49,621,734 - 49,629,444 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	11	49,641,522 - 49,649,232 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	11	47,366,986 - 47,374,677 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	11	47,920,295 - 47,927,654 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	11	47,920,295 - 47,927,654 (-)	Ensembl	panpan1.1		panPan2

PSMC3
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	18	42,212,083 - 42,218,958 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	18	40,942,640 - 40,949,498 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	18	42,867,799 - 42,874,682 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	18	42,867,947 - 42,874,677 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	18	42,354,412 - 42,361,285 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	18	41,909,294 - 41,916,243 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	18	42,638,826 - 42,645,702 (+)	NCBI		UU_Cfam_GSD_1.0

Psmc3
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	19,699,233 - 19,705,397 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936562	1,810,864 - 1,823,077 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936562	1,810,883 - 1,817,040 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PSMC3
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	15,166,306 - 15,193,047 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	15,185,482 - 15,191,189 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	16,392,149 - 16,397,835 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PSMC3
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	1	17,881,844 - 17,896,942 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666038	115,190,816 - 115,198,248 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Psmc3
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624767	1,362,132 - 1,372,083 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624767	1,361,970 - 1,367,282 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Psmc3
19 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	122
Count of miRNA genes:	98
Interacting mature miRNAs:	105
Transcripts:	ENSRNOT00000015757
Prediction methods:	Microtar, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1300178	Hrtrt4	Heart rate QTL 4	3.74		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	43827364	90905114	Rat
61377	Edpm3	Estrogen-dependent pituitary mass QTL 3	7.05	0.038	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	53184692	89878207	Rat
2301414	Kidm37	Kidney mass QTL 37		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	3	70653097	121056321	Rat
1582238	Bw68	Body weight QTL 68	3.2	0.0064	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1331795	Rf30	Renal function QTL 30	3.708		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	3	39454637	89115240	Rat
1582239	Epfw1	Epididymal fat weight QTL 1	4.5	0.0006	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	3	53184593	115665732	Rat
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
1354589	Bw31	Body weight QTL 31	3.3		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	78196190	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1358362	Srcrt2	Stress Responsive Cort QTL 2	2.78		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	3	38192233	133483320	Rat
737818	Hcar12	Hepatocarcinoma resistance QTL 12	2.6		liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	3	29463235	118376539	Rat
1582218	Bw74	Body weight QTL 74	3.9	0.0021	body mass (VT:0001259)	body weight (CMO:0000012)	3	53184593	115665732	Rat
1331777	Bw24	Body weight QTL 24	3.503		body mass (VT:0001259)	body weight (CMO:0000012)	3	39454637	89115240	Rat
1582221	Kidm30	Kidney mass QTL 30	3.5	0.0008	kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	3	64655305	115665732	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
1582210	Bw71	Body weight QTL 71	3.3	0.0012	body mass (VT:0001259)	body weight (CMO:0000012)	3	64655305	115665732	Rat
1300111	Rf12	Renal function QTL 12	3.78		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	61017749	121056321	Rat
724523	Tsu1	Thymus enlargement suppressive QTL 1	3.84		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	3	50437504	115638231	Rat
1600376	Arunc5	Aerobic running capacity QTL 5		0.21	exercise endurance trait (VT:0002332)	maximum distance run on treadmill (CMO:0001406)	3	73376539	118376539	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
1581503	Cm58	Cardiac mass QTL 58	2.7	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	3	43827364	121056321	Rat
2292613	Ept16	Estrogen-induced pituitary tumorigenesis QTL 16	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat
731180	Bp152	Blood pressure QTL 152		0.03	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	53781112	91609953	Rat
738019	Anxrr10	Anxiety related response QTL 10	3.9		exploratory behavior trait (VT:0010471)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	3	38517803	83517803	Rat
631200	Cm25	Cardiac mass QTL 25	4.8	0.0001	heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	3	61134348	89115068	Rat
61419	Cia11	Collagen induced arthritis QTL 11	5.6		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	3	30356773	98535386	Rat
12879848	Bw181	Body weght QTL 181		0.015	body mass (VT:0001259)	body weight (CMO:0000012)	3	70348525	121056321	Rat
1358905	Hrtrt17	Heart rate QTL 17	5.9	0.000014	heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	3	10861912	89878372	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1358885	Bp251	Blood pressure QTL 251	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1354597	Kidm13	Kidney mass QTL 13	2.9		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	3	41874578	104104347	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2290452	Scl56	Serum cholesterol level QTL 56	2.26		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	3	1	91609953	Rat
1354604	Bw36	Body weight QTL 36	2.9		body mass (VT:0001259)	body weight (CMO:0000012)	3	33703347	104104347	Rat
631665	Bw8	Body weight QTL 8	5.5		body mass (VT:0001259)	body weight (CMO:0000012)	3	50437042	119183768	Rat
1358888	Bp264	Blood pressure QTL 264	4.43		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	3	14489145	121056321	Rat
1358186	Ept2	Estrogen-induced pituitary tumorigenesis QTL 2	8.3		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	3	47233430	110362260	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031595	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039104795	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC062019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473949	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D83522	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ214351	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225567	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ226273	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ232987	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ233836	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000003	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U77918	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000015757 ⟹ ENSRNOP00000015757

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	77,031,825 - 77,037,206 (+)	Ensembl
Rnor_6.0 Ensembl	3	79,876,938 - 79,882,319 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103724 ⟹ ENSRNOP00000082627

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	77,031,825 - 77,043,358 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000104701 ⟹ ENSRNOP00000088016

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	77,031,825 - 77,037,206 (+)	Ensembl

RefSeq Acc Id:

NM_031595 ⟹ NP_113783

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,487,643 - 97,493,024 (+)	NCBI
mRatBN7.2	3	77,031,825 - 77,037,206 (+)	NCBI
Rnor_6.0	3	79,876,938 - 79,882,319 (+)	NCBI
Rnor_5.0	3	86,585,691 - 86,591,072 (+)	NCBI
RGSC_v3.4	3	75,413,567 - 75,418,948 (+)	RGD
Celera	3	76,240,531 - 76,245,912 (+)	RGD

Sequence:

show sequence

CATTTCTCCCTCACAAACTGGAGCAACCGGCGAGCCCGGGGCGGGCCCTGTGGCCTCGGTTTGG
TTCGTGGAGTCCCAGCGGCAGATTCGCTCGGCAACGCGGACAGGGCCAATTCTGTCGCGTCAGG
AATCGCGGGTGAAGTTCGCCACCGGTGGAGAGAAGACGTTGAGAAAAGCCGCGCTGGGCTCCCT
CAGGGGCTCGTGCGCACTCCCAGTTTCGGCCTTTTCATGCAGGAAATGAATCTGCTGCCGACGC
CCGAGAGTCCAGTGACTCGGCAGGAGAAGATGGCGACCGTGTGGGATGAAGCTGAGCAAGATGG
CATTGGGGAGGAGGTGCTCAAGATGTCCACAGAAGAGATCGTCCAGCGCACACGGCTGCTAGAC
AGCGAGATCAAGATCATGAAGAGTGAAGTGCTGCGAGTCACCCACGAACTCCAAGCCATGAAAG
ACAAAATCAAAGAGAACAGTGAGAAAATCAAAGTGAACAACACCCTCCCATACCTAGTCTCCAA
CGTTATTGAGTTGCTGGATGTTGACCCCAATGACCAGGAGGAGGATGGTGCCAATATTGACCTG
GACTCGCAGAGGAAGGGCAAGTGTGCAGTGATCAAAACTTCTACCCGACAAACGTACTTCCTGC
CAGTGATTGGGTTGGTAGATGCCGAAAAGCTGAAGCCGGGAGACCTGGTGGGTGTGAACAAAGA
CTCCTATCTGATCCTGGAGACCCTGCCCACCGAATATGACTCTCGGGTGAAGGCCATGGAGGTG
GACGAGCGGCCCACAGAGCAATACAGTGACATTGGCGGCCTGGACAAGCAGATCCAGGAGCTGG
TGGAAGCCATTGTCCTGCCTATGAACCACAAAGAGAAGTTTGAGAACTTGGGTATCCAGCCCCC
AAAAGGAGTGCTGATGTATGGGCCGCCTGGTACAGGGAAGACTCTCCTCGCCCGAGCCTGTGCT
GCTCAGACCAAGGCCACCTTCTTGAAGCTGGCAGGCCCTCAGCTGGTGCAGATGTTTATTGGAG
ATGGCGCCAAGCTGGTCCGTGATGCTTTTGCCCTGGCCAAGGAGAAGGCACCATCTATTATCTT
TATAGATGAGTTGGATGCCATTGGCACCAAGCGCTTCGACAGTGAAAAGGCAGGGGACCGAGAG
GTGCAGAGGACCATGCTAGAGCTCCTGAACCAGATGGATGGCTTCCAGCCCAACACCCAAGTGA
AGGTAATTGCAGCCACTAACAGGGTGGACATCCTGGACCCTGCCCTGCTCCGCTCAGGACGCCT
AGACCGCAAGATTGAGTTTCCAATGCCCAATGAGGAGGCCCGAGCCAGAATTATGCAGATCCAC
TCACGGAAGATGAACGTCAGTCCTGATGTGAACTATGAAGAGCTGGCTCGCTGCACTGATGACT
TCAATGGGGCCCAGTGCAAGGCCGTGTGTGTGGAGGCGGGTATGATCGCACTGCGCAGGGGTGC
CACGGAGCTCACTCACGAGGACTACATGGAGGGCATCCTGGAGGTGCAGGCCAAGAAGAAAGCC
AACCTTCAGTACTATGCCTAGGGACACCTCTAGTCTGTCTGCTGGGGCGGGGGCTCGGTTGATA
ATAAAGGGGGTTTTTGTTCTTTTCCCA

hide sequence

RefSeq Acc Id:

XM_039104795 ⟹ XP_038960723

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	3	97,489,599 - 97,493,025 (+)	NCBI
mRatBN7.2	3	77,033,781 - 77,037,207 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_113783	(Get FASTA)	NCBI Sequence Viewer
	XP_038960723	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB70882	(Get FASTA)	NCBI Sequence Viewer
	AAH62019	(Get FASTA)	NCBI Sequence Viewer
	BAA11939	(Get FASTA)	NCBI Sequence Viewer
	EDL79502	(Get FASTA)	NCBI Sequence Viewer
	EDL79503	(Get FASTA)	NCBI Sequence Viewer
	EDL79504	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000015757
	ENSRNOP00000015757.2
	ENSRNOP00000082627.1
	ENSRNOP00000088016.1
GenBank Protein	Q63569	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_113783 ⟸ NM_031595

- UniProtKB:

Q63569 (UniProtKB/Swiss-Prot), P97638 (UniProtKB/Swiss-Prot), Q6P6U2 (UniProtKB/TrEMBL), A6HNA2 (UniProtKB/TrEMBL), F7EY30 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MQEMNLLPTPESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIVQRTRLLDSEIKIMKSEVLR
VTHELQAMKDKIKENSEKIKVNNTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIK
TSTRQTYFLPVIGLVDAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIG
GLDKQIQELVEAIVLPMNHKEKFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAG
PQLVQMFIGDGAKLVRDAFALAKEKAPSIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQM
DGFQPNTQVKVIAATNRVDILDPALLRSGRLDRKIEFPMPNEEARARIMQIHSRKMNVSPDVNY
EELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDYMEGILEVQAKKKANLQYYA

hide sequence

Ensembl Acc Id:

ENSRNOP00000015757 ⟸ ENSRNOT00000015757

RefSeq Acc Id:	XP_038960723 ⟸ XM_039104795
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000088016 ⟸ ENSRNOT00000104701

Ensembl Acc Id:

ENSRNOP00000082627 ⟸ ENSRNOT00000103724

Protein Domains

AAA+ ATPase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q63569-F1-model_v2	AlphaFold	Q63569	1-439	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13692204

Promoter ID:

EPDNEW_R2729

Type:

initiation region

Name:

Psmc3_1

Description:

proteasome 26S subunit, ATPase 3

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	3	79,876,987 - 79,877,047	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:61905	AgrOrtholog
BioCyc Gene	G2FUF-48753	BioCyc
Ensembl Genes	ENSRNOG00000011414	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000015757	ENTREZGENE
	ENSRNOT00000015757.4	UniProtKB/TrEMBL
	ENSRNOT00000103724.1	UniProtKB/TrEMBL
	ENSRNOT00000104701.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.8.60	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	2.40.50.140	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	3.40.50.300	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:5620971	IMAGE-MGC_LOAD
InterPro	26S_Proteasome_ATPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AAA+_ATPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AAA_lid_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ATPase_AAA_core	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ATPase_AAA_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NA-bd_OB-fold	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	P-loop_NTPase	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Prot_ATP_ID_OB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:29677	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:72399	IMAGE-MGC_LOAD
NCBI Gene	29677	ENTREZGENE
PANTHER	26S PROTEASOME REGULATORY SUBUNIT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	AAA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	AAA_lid_3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Prot_ATP_ID_OB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Psmc3	PhenoGen
PROSITE	AAA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000011414	RatGTEx
SMART	AAA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF52540	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5ZUG8_RAT	UniProtKB/TrEMBL
	A0A8I6A723_RAT	UniProtKB/TrEMBL
	A6HNA1_RAT	UniProtKB/TrEMBL
	A6HNA2	ENTREZGENE, UniProtKB/TrEMBL
	A6HNA3_RAT	UniProtKB/TrEMBL
	F7EY30	ENTREZGENE, UniProtKB/TrEMBL
	P97638	ENTREZGENE
	PRS6A_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q6P6U2	ENTREZGENE
UniProt Secondary	P97638	UniProtKB/Swiss-Prot
	Q6P6U2	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-08-19	Psmc3	proteasome 26S subunit, ATPase 3	Psmc3	proteasome (prosome, macropain) 26S subunit, ATPase 3	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Psmc3	proteasome (prosome, macropain) 26S subunit, ATPase 3			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)