Exhibits growth factor activity; heparin binding activity; and type 2 fibroblast growth factor receptor binding activity. Involved in several processes, including animal organ development; phosphatidylcholine biosynthetic process; and surfactant homeostasis. Localizes to extracellular space. Orthologous to human FGF7 (fibroblast growth factor 7); PARTICIPATES IN glypican signaling pathway; melanoma pathway; mitogen activated protein kinase signaling pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 2-amino-2-deoxy-D-glucopyranose; acrylamide.
Tetrachlorodibenzodioxin inhibits the reaction [[Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of FGF7 mRNA]
[Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of FGF7 mRNA more ...
FGFR2 inhibits the reaction [FGF7 results in decreased susceptibility to Fluorouracil], FGFR2 protein alternative form inhibits the reaction [FGF7 protein results in decreased susceptibility to Fluorouracil]
Acetylcysteine inhibits the reaction [Cadmium Chloride results in increased expression of and results in increased secretion of FGF7 protein], Cadmium Chloride results in increased expression of and results in increased secretion of FGF7 protein
Cholesterol inhibits the reaction [FGF7 protein results in increased expression of FAS mRNA], Cholesterol inhibits the reaction [FGF7 protein results in increased expression of SCD mRNA]
[Dexamethasone co-treated with rosiglitazone co-treated with 1-Methyl-3-isobutylxanthine co-treated with INS1 protein] results in decreased expression of FGF7 mRNA more ...
[1-methylanthracene co-treated with fluoranthene] results in increased expression of FGF7 mRNA, SB 203580 inhibits the reaction [[1-methylanthracene co-treated with fluoranthene] results in increased expression of FGF7 mRNA]
2-4-morpholinyl-8-phenyl-4H-1-benzopyran-4-one inhibits the reaction [[FGF7 protein results in increased phosphorylation of AKT1 protein] which results in increased expression of ESR1 protein] more ...
MRKWILTRILPTPLYRPCFHLVCLVGTISLACNDMSPEQTATSVNCSSPERHTRSYDYMEGGDI RVRRLFCRTQWYLRIDKRGKVKGTQEMRNSYNIMEIMTVAVGIVAIKGVESEYYLAMNKQGELY AKKECNEDCNFKELILENHYNTSASAKWTHSGGEMFVALNQKGLPVKGKKTKKEQKTAHFLPMA IT
MRKWILTRILPTPLYRSCFHLVCLVGTISLACNDMSPEQTATSVNCSSPERHTRSYDYMEGGDI RVRRLFCRTQWYLRIDKRGKVKGTQEMRNSYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLY AKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGLPVKGKKTKKEQKTAHFLPMA IT
MRKWILTRILPTPLYRSCFHLVCLVGTISLACNDMSPEQTATSVNCSSPERHTRSYDYMEGGDI RVRRLFCRTQWYLRIDKRGKVKGTQEMRNSYNIMEIRTVAVGIVAIKGVESEYYLAMNKEGKLY AKKECNEDCNFKELILENHYNTYASAKWTHSGGEMFVALNQKGLPVKGKKTKKEQKTAHFLPMA IT
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin
Founder strain for the heterogeneous stock (HS) rat population; SNPs from the RGSC 3.4 assembly were "lifted over" from RGSC 3.4 to Rnor 5.0 and from Rnor 5.0 to Rnor 6.0; Provided by Medical College of Wisconsin