Ugt2b (UDP glycosyltransferase 2 family, polypeptide B)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer ACP Haplotyper VCMap Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Ugt2b (UDP glycosyltransferase 2 family, polypeptide B) Rattus norvegicus

Analyze

No known orthologs.

Symbol:

Ugt2b

Name:

UDP glycosyltransferase 2 family, polypeptide B

RGD ID:

3936

Description:

Enables glucuronosyltransferase activity. Predicted to be located in endoplasmic reticulum membrane. Predicted to be integral component of membrane. Predicted to be active in intracellular membrane-bounded organelle. Human ortholog(s) of this gene implicated in osteoporosis. Orthologous to human UGT2B15 (UDP glucuronosyltransferase family 2 member B15) and UGT2B17 (UDP glucuronosyltransferase family 2 member B17); PARTICIPATES IN ascorbate and aldarate metabolic pathway; O-linked glycan biosynthetic pathway; pentose and glucuronate interconversion pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17alpha-ethynylestradiol; 2,3,4,7,8-Pentachlorodibenzofuran.

Type:

protein-coding

RefSeq Status:

VALIDATED

Also known as:

3-hydroxyandrogen specific; 3-hydroxyandrogen-specific UDPGT; Androsterone UDP-glucuronosyltransferase; LOC688226; RLUG23; UDP glucuronosyltransferase; UDP-glucuronosyltransferase 2B2; UDPGT 2B2; UDPGTr-4; Ugt2b2

RGD Orthologs

Alliance Genes

More Info

homologs ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Other homologs ²				less info ...
Homo sapiens (human):	UGT2B28 (UDP glucuronosyltransferase family 2 member B28)	HGNC	HomoloGene, Panther, Treefam
Homo sapiens (human):	UGT2B10 (UDP glucuronosyltransferase family 2 member B10)	HGNC	Panther, Treefam
Homo sapiens (human):	UGT2B15 (UDP glucuronosyltransferase family 2 member B15)	HGNC	Panther, Treefam
Homo sapiens (human):	UGT2B4 (UDP glucuronosyltransferase family 2 member B4)	HGNC	Panther, Treefam
Homo sapiens (human):	UGT2B11 (UDP glucuronosyltransferase family 2 member B11)	HGNC	Panther, Treefam
Homo sapiens (human):	UGT2B17 (UDP glucuronosyltransferase family 2 member B17)	HGNC	Panther, Treefam
Homo sapiens (human):	UGT2B7 (UDP glucuronosyltransferase family 2 member B7)	HGNC	Panther, Treefam
Homo sapiens (human):	UGT2A3 (UDP glucuronosyltransferase family 2 member A3)	HGNC	Panther
Alliance orthologs ³
Homo sapiens (human):	UGT2B15 (UDP glucuronosyltransferase family 2 member B15)	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Homo sapiens (human):	UGT2B17 (UDP glucuronosyltransferase family 2 member B17)	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Mus musculus (house mouse):	Ugt2b37 (UDP glucuronosyltransferase 2 family, polypeptide B37)	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Mus musculus (house mouse):	Ugt2b38 (UDP glucuronosyltransferase 2 family, polypeptide B38)	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Mus musculus (house mouse):	Ugt2b5 (UDP glucuronosyltransferase 2 family, polypeptide B5)	Alliance	DIOPT (OrthoFinder\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	ugt2a5 (UDP glucuronosyltransferase 2 family, polypeptide A5)	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG10168	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|PhylomeDB)
Caenorhabditis elegans (roundworm):	ugt-3	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG10170	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PhylomeDB)
Caenorhabditis elegans (roundworm):	ugt-16	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PhylomeDB)
Caenorhabditis elegans (roundworm):	ugt-23	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PhylomeDB)
Caenorhabditis elegans (roundworm):	ugt-24	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PhylomeDB)
Caenorhabditis elegans (roundworm):	ugt-49	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG16732	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PhylomeDB)
Caenorhabditis elegans (roundworm):	ugt-6	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PhylomeDB)
Caenorhabditis elegans (roundworm):	ugt-62	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	ugt-58	Alliance	DIOPT (Hieranoid\|OrthoFinder\|OrthoInspector\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG31002	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Ugt37c1	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Ugt35b	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Ugt86Dc	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Ugt86De	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Ugt86Dg	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Ugt86Dj	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Ugt86Dh	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Ugt86Di	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG5724	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG5999	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Ugt37a1	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Ugt37b1	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Ugt36Bb	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PhylomeDB)
Drosophila melanogaster (fruit fly):	CG3797	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	ugt-61	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Caenorhabditis elegans (roundworm):	ugt-25	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Ugt35a	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Ugt36Ba	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Ugt36Bc	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Ugt86Da	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Drosophila melanogaster (fruit fly):	Ugt86Dd	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PhylomeDB)
Caenorhabditis elegans (roundworm):	ugt-31	Alliance	DIOPT (Hieranoid\|OrthoFinder\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	14	20,630,572 - 20,665,062 (+)	NCBI	mRatBN7.2
mRatBN7.2 Ensembl	14	20,630,250 - 20,651,776 (+)	Ensembl
Rnor_6.0 Ensembl	14	22,375,955 - 22,534,720 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	14	22,323,542 - 22,344,064 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	14	22,154,370 - 22,178,222 (+)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	14	22,066,518 - 22,177,852 (+)	NCBI
Cytogenetic Map	14	p22-p21.2	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Experimental Liver Cirrhosis (EXP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (EXP)

2,3,4,7,8-Pentachlorodibenzofuran (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3,4,5,3',4',5'-Hexachlorobiphenyl (EXP)

3alpha-hydroxy-5beta-androstan-17-one (EXP)

3H-1,2-dithiole-3-thione (EXP)

4,4'-diaminodiphenylmethane (EXP)

9-cis-retinoic acid (EXP)

acetamide (EXP)

all-trans-retinoic acid (EXP)

alpha-hexachlorocyclohexane (EXP)

androsterone (EXP)

beta-naphthoflavone (EXP)

bexarotene (EXP)

bisphenol A (EXP)

clofibrate (EXP)

coumarin (EXP)

decabromodiphenyl ether (EXP)

dexamethasone (EXP)

Diallyl sulfide (EXP)

glutathione (EXP)

indole-3-methanol (EXP)

indometacin (EXP)

lithocholic acid (EXP)

N-nitrosodimethylamine (EXP)

perfluorooctanoic acid (EXP)

phenobarbital (EXP)

pirinixic acid (EXP)

propranolol (EXP)

tauroursodeoxycholic acid (EXP)

tetrachloromethane (EXP)

trichloroethene (EXP)

troglitazone (EXP)

vitamin E (EXP)

zearalenone (EXP)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Cellular Component

endoplasmic reticulum membrane (IEA)

integral component of membrane (IEA)

intracellular membrane-bounded organelle (IBA)

Molecular Function

glucuronosyltransferase activity (IDA,IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

ascorbate and aldarate metabolic pathway (IEA)

O-linked glycan biosynthetic pathway (IEA)

pentose and glucuronate interconversion pathway (IEA)

phase I biotransformation pathway via cytochrome P450 (IEA)

porphyrin and chlorophyll metabolic pathway (IEA)

retinol metabolic pathway (IEA)

starch and sucrose metabolic pathway (IEA)

steroid hormone biosynthetic pathway (IEA)

References

References - curated


1.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Jackson MR and Burchell B, Nucleic Acids Res 1986 Jan 24;14(2):779-95.
3.	KEGG
4.	Mackenzie PI J Biol Chem 1986 Oct 25;261(30):14112-7.
5.	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	Pipeline to import KEGG annotations from KEGG into RGD
7.	RGD automated data pipeline
8.	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:1909872	PMID:7492328	PMID:12477932	PMID:17435758	PMID:23230277

Genomics

Position Markers

RH127922

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	20,651,730 - 20,651,948 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	22,157,582 - 22,157,799	NCBI	Rnor6.0
Rnor_6.0	14	22,438,390 - 22,438,607	NCBI	Rnor6.0
Rnor_5.0	14	22,344,386 - 22,344,603	UniSTS	Rnor5.0
Rnor_5.0	14	22,071,655 - 22,071,872	UniSTS	Rnor5.0
RGSC_v3.4	14	22,179,529 - 22,179,746	UniSTS	RGSC3.4
RGSC_v3.4	14	22,178,177 - 22,179,746	UniSTS	RGSC3.4
Cytogenetic Map	14	p22-p21.2	UniSTS

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2300159	Bmd61	Bone mineral density QTL 61	5.3	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	14	1	26541967	Rat
2300183	Bmd60	Bone mineral density QTL 60	5.7	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	14	1	26541967	Rat
619619	Rf4	Renal disease susceptibility QTL 4	4.1	0.002	total urine protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	14	1	32754612	Rat
634352	Apr6	Acute phase response QTL 6	3.7		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	14	1	41131407	Rat
1300114	Srn2	Serum renin concentration QTL 2	3.27		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	14	3813074	21217635	Rat
70195	Mcs8	Mammary carcinoma susceptibility QTL 8	4.28		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	14	3813074	24531477	Rat
1331740	Bw26	Body weight QTL 26	3.028		body mass (VT:0001259)	body weight (CMO:0000012)	14	3813074	30767156	Rat
1581500	Renag1	Renal agenesis QTL 1			kidney development trait (VT:0000527)	percentage of study population developing unilateral renal agenesis during a period of time (CMO:0000940)	14	8170668	68298175	Rat
1358296	Ael3	Aortic elastin QTL 3	3.7	0.00051	aorta elastin amount (VT:0003905)	aortic elastin	14	8267090	53267090	Rat
2302045	Pia39	Pristane induced arthritis QTL 39	4.9	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G2a level (CMO:0002116)	14	8267090	53267090	Rat
731183	Pia20	Pristane induced arthritis QTL 20	3.55		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	14	9088978	39057237	Rat
2302277	Gluco38	Glucose level QTL 38	5.8		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11030622	28035204	Rat
631839	Niddm37	Non-insulin dependent diabetes mellitus QTL 37	3.37		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	14	11030622	95876975	Rat
631212	Bw5	Body weight QTL5	5.43		retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	14	11030812	30320092	Rat
1300140	Srn3	Serum renin concentration QTL 3	3.19		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	14	14875168	30883947	Rat
71117	Niddm17	Non-insulin dependent diabetes mellitus QTL 17	2.35		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	14	17593761	42336881	Rat
631262	Tcas4	Tongue tumor susceptibility QTL 4	7.29		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	14	17622561	42337007	Rat
2313397	Coatc1	Coat color QTL1			coat/hair pigmentation trait (VT:0010463)	coat/hair color measurement (CMO:0001808)	14	18541332	63541332	Rat
61420	Pia6	Pristane induced arthritis QTL 6	4.9		joint integrity trait (VT:0010548)	arthritic paw count (CMO:0001460)	14	18631345	42337007	Rat
10755459	Coatc15	Coat color QTL 15		0.01681	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	14	19836944	64836944	Rat

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	53
Count of miRNA genes:	46
Interacting mature miRNAs:	48
Transcripts:	ENSRNOT00000052369
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031533	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039091621	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC089792	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DQ351215	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EX489691	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ102904	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ218357	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ240959	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J02589	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000252	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M74439	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X03478	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000052369 ⟹ ENSRNOP00000043239

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	14	20,630,250 - 20,651,776 (+)	Ensembl

RefSeq Acc Id:

NM_031533 ⟹ NP_113721

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	14	20,630,591 - 20,651,409 (+)	NCBI
Rnor_5.0	14	22,323,542 - 22,344,064 (+)	NCBI
RGSC_v3.4	14	22,154,370 - 22,178,222 (+)	RGD

Sequence:

show sequence

ACACACTGTGACCAGAAGGACTTTGATGTTCAAAATGCCCAGAAAGTGGATTTCTGCTCTGTTC
CTGCTACAGATAAGTTACTGTTTCAAATCTGGGCACTGTGGGAAGGTGTTGGTGTGGCCGATGG
ACTTTAGTCACTGGATGAATATAAAAATAATCCTTGATGAACTTGTACAGAGGGGCCATGAGGT
CACTGTTCTGAAACCTTCGGCTTACTTTTTTCTTGATCCGAAAAAATCGTCTGACCTTAAGTTT
GAAATTTTTCCTACATCTATCAGTAAAGATGAGCTGCAAAATCATTTCATAAAACTTTTGGATG
TGTGGACTTATGAGTTGCCAAGAGATACATGTTTGTCATATTCTCCTATCCTTCAAAATCTAGT
TTATGAATTTTCTTATTTTTATCTAAGTATTTGTAAAGACGCTGTTTCAAACAAGCAGCTCATG
ACAAAACTACAGGAATCCAAGTTTGATGTTCTTTTCGCAGATCCTGTGGCTTCCTGTGGGGATC
TGATAGCTGAACTGCTCCACATTCCTTTTCTGTACAGTCTTAGCTTCTCTCCAGGCCACAAACT
TGAAAAGTCCATTGGAAAATTTATACTCCCTCCATCTTATGTGCCTGTAATTTTGTCGGGACTG
GCTGGCAAAATGACATTCATAGACAGGGTAAAAAATATGATATGTATGCTTTATTTCGACTTTT
GGTTCGAGAGACTTAGACACAAGGAATGGGACACATTTTACAGTGAGATTTTGGGAAGGCCCAC
CACCGTAGATGAGACAATGAGCAAAGTAGAAATATGGCTTATTAGATCCTATTGGGATTTGAAA
TTTCCCCACCCAACATTACCAAATGTTGACTATATTGGAGGACTCCATTGCAAACCTGCTAAAC
CCTTGCCTAAGGATATGGAAGAATTTGTCCAGAGCTCTGGAGAGCACGGTGTGGTGGTGTTTTC
TCTGGGGTCAATGGTCAGCAACATGACAGAAGAAAAGGCCAACGCAATTGCATGGGCCCTTGCC
CAGATTCCACAAAAGGTTCTTTGGAAATTTGATGGCAAAACCCCAGCAACATTAGGACCCAATA
CCAGAGTCTACAAGTGGCTCCCGCAGAATGACATCCTGGGTCACCCAAAAACCAAAGCCTTTGT
AACTCATGGTGGAGCCAATGGCCTCTATGAGGCAATCTATCATGGAATCCCTATGATTGGCATT
CCTCTGTTTGGAGATCAACCTGATAATATTGCCCACATGGTGGCCAAAGGAGCAGCTGTTTCAT
TGAATATCAGGACAATGTCAAAGTTAGATTTTCTCAGTGCACTGGAGGAAGTCATAGACAATCC
GTTCTATAAAAAAAATGTTATGTTGTTGTCAACCATTCACCATGACCAGCCTATGAAGCCCCTG
GACAGAGCTGTCTTCTGGATTGAGTTTATCATGCGCCACAAAGGGGCCAAGCACCTGAGACCAC
TTGGACATAACCTTCCCTGGTACCAGTACCACTCTCTGGATGTGATTGGATTCCTGCTCACCTG
TTTTGCAGTCATTGCAGCTCTTACTGTAAAATGTCTCTTGTTCATGTACCGATTCTTTGTAAAG
AAGGAAAAGAAAATGAAGAATGAGTAGAGCTCATTGACAATGCACTACAGAAATGAAATTTCAG
CGACATTCTAATTTATGAACCACCTTCTAAAAATTACTAATTTTTTATCAAGGTAGATAACCTT
TGTAGGAAGACATATAACTCCGTGAATACTGATATGTACTCAAAAATCCATCATTTTTAAATTT
TAAAACCACTTAATGTAAAAGTTACATTGTAGAAAAATGTGCAGAATAAAATTATTCTTGATAG
AGTCCAAATAATCAAAGTATTAACCTTAAAATATTTGAATAGTGTCCATTAGCTTCTTTGTCTA
ATACTGAATCTGTAGCTTTCATACAATAAAATGTAGATAACTTGTACACGATAAA

hide sequence

RefSeq Acc Id:

XM_039091621 ⟹ XP_038947549

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	14	20,630,572 - 20,665,062 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_113721	(Get FASTA)	NCBI Sequence Viewer
	XP_038947549	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA42314	(Get FASTA)	NCBI Sequence Viewer
	AAH89792	(Get FASTA)	NCBI Sequence Viewer
	AAM51149	(Get FASTA)	NCBI Sequence Viewer
	ABC71921	(Get FASTA)	NCBI Sequence Viewer
	CAA27198	(Get FASTA)	NCBI Sequence Viewer
	P08541	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_113721 ⟸ NM_031533

- Peptide Label:

precursor

- Sequence:

show sequence

MPRKWISALFLLQISYCFKSGHCGKVLVWPMDFSHWMNIKIILDELVQRGHEVTVLKPSAYFFL
DPKKSSDLKFEIFPTSISKDELQNHFIKLLDVWTYELPRDTCLSYSPILQNLVYEFSYFYLSIC
KDAVSNKQLMTKLQESKFDVLFADPVASCGDLIAELLHIPFLYSLSFSPGHKLEKSIGKFILPP
SYVPVILSGLAGKMTFIDRVKNMICMLYFDFWFERLRHKEWDTFYSEILGRPTTVDETMSKVEI
WLIRSYWDLKFPHPTLPNVDYIGGLHCKPAKPLPKDMEEFVQSSGEHGVVVFSLGSMVSNMTEE
KANAIAWALAQIPQKVLWKFDGKTPATLGPNTRVYKWLPQNDILGHPKTKAFVTHGGANGLYEA
IYHGIPMIGIPLFGDQPDNIAHMVAKGAAVSLNIRTMSKLDFLSALEEVIDNPFYKKNVMLLST
IHHDQPMKPLDRAVFWIEFIMRHKGAKHLRPLGHNLPWYQYHSLDVIGFLLTCFAVIAALTVKC
LLFMYRFFVKKEKKMKNE

hide sequence

RefSeq Acc Id:	XP_038947549 ⟸ XM_039091621
- Peptide Label:	isoform X1

RefSeq Acc Id:

ENSRNOP00000043239 ⟸ ENSRNOT00000052369

Protein Domains

UDPGT

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Damaging Variants

Assembly: Rnor_5.0

Chromosome	Start Pos	End Pos	Reference Nucleotide	Variant Nucleotide	Variant Type	Strain
14	22323705	22323706	G	T	snv	Crl:SD (UDEL)
14	22323800	22323801	A	C	snv	FHL/EurMcwi (MCW), SBH/Ygl (MCW), SBN/Ygl (MCW), SR/JrHsd (MCW), SS/JrHsdMcwi (MCW), Crl:SD (UDEL), COP/CrCrl (MCW & UW), SDLEF7/Barth (UDEL)
14	22324124	22324125	G	T	snv	LE/Stm (KyushuU)
14	22342303	22342304	A	T	snv	Crl:SD (UDEL), BUF/MNa (KyushuU), LEC/Tj (KyushuU)

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3936	AgrOrtholog
Ensembl Genes	ENSRNOG00000046540	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00000069670	Ensembl, ENTREZGENE
Ensembl Protein	ENSRNOP00000043239	ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOP00000063270	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000052369	ENTREZGENE, UniProtKB/TrEMBL
	ENSRNOT00000063915	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7370057	IMAGE-MGC_LOAD
InterPro	UDP_glucos_trans	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UDP_glycos_trans_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:24862	UniProtKB/TrEMBL
MGC_CLONE	MGC:108656	IMAGE-MGC_LOAD
NCBI Gene	24862	ENTREZGENE
Pfam	UDPGT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ugt2b	PhenoGen
PROSITE	UDPGT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A1XF83_RAT	UniProtKB/TrEMBL
	F1LM22_RAT	UniProtKB/TrEMBL
	F1M3E3_RAT	UniProtKB/TrEMBL
	P08541	ENTREZGENE
	Q5EBC8_RAT	UniProtKB/TrEMBL
	UD2B2_RAT	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2013-03-29	Ugt2b	UDP glycosyltransferase 2 family, polypeptide B	LOC688226	similar to UDP-glucuronosyltransferase 2B2 precursor (UDPGT) (3-hydroxyandrogen specific) (UDPGTr-4) (RLUG23)	Data Merged	737654	PROVISIONAL
2006-11-20	LOC688226	similar to UDP-glucuronosyltransferase 2B2 precursor (UDPGT) (3-hydroxyandrogen specific) (UDPGTr-4) (RLUG23)			Symbol and Name status set to provisional	70820	PROVISIONAL
2003-04-09	Ugt2b	UDP glycosyltransferase 2 family, polypeptide B	Ugt2b2	Androsterone UDP-glucuronosyltransferase	Symbol and Name updated	629477	APPROVED
2002-06-10	Ugt2b2	Androsterone UDP-glucuronosyltransferase			Symbol and Name status set to approved	70586	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)