Timm17a (translocase of inner mitochondrial membrane 17A)

Advanced Search (OLGA)

Gene: Timm17a (translocase of inner mitochondrial membrane 17A) Rattus norvegicus

Analyze

Symbol:

Timm17a

Name:

translocase of inner mitochondrial membrane 17A

RGD ID:

3862

Description:

Enables enzyme binding activity. Involved in positive regulation of protein processing. Located in mitochondrial inner membrane. Orthologous to human TIMM17A (translocase of inner mitochondrial membrane 17A); PARTICIPATES IN presequence pathway of mitochondrial protein import; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4-dinitrotoluene; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

inner membrane preprotein translocase Tim17a; MGC72274; mitochondrial import inner membrane translocase subunit Tim17-A; Tim17; Timm17; translocase of inner mitochondrial membrane 17 homolog A; translocase of inner mitochondrial membrane 17 homolog A (yeast); translocator of inner mitochondrial membrane 17 kDa; translocator of inner mitochondrial membrane 17 kDa a; translocator of inner mitochondrial membrane 17 kDa, a; translocator of inner mitochondrial membrane 17a; translocator of inner mitochondrial membrane 17a (yeast)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TIMM17A (translocase of inner mitochondrial membrane 17A)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Timm17a (translocase of inner mitochondrial membrane 17a)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Timm17a (translocase of inner mitochondrial membrane 17A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TIMM17A (translocase of inner mitochondrial membrane 17A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TIMM17A (translocase of inner mitochondrial membrane 17A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Timm17a (translocase of inner mitochondrial membrane 17A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TIMM17A (translocase of inner mitochondrial membrane 17A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TIMM17A (translocase of inner mitochondrial membrane 17A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Timm17a (translocase of inner mitochondrial membrane 17A)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	TIMM17A (translocase of inner mitochondrial membrane 17A)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Timm17a (translocase of inner mitochondrial membrane 17a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	timm17a (translocase of inner mitochondrial membrane 17 homolog A (yeast))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG1724	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	TIM17	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	timm-17B.1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Tim17a1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	Tim17a2	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	Tim17b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Tim17b1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	Tim17b2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	timm17a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Related Pseudogenes:

Timm17al1

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	49,282,918 - 49,296,363 (-)	NCBI		GRCr8
mRatBN7.2	13	46,731,117 - 46,742,604 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	46,730,660 - 46,742,655 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	49,337,908 - 49,349,396 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	50,625,983 - 50,637,472 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	47,890,625 - 47,902,136 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	52,124,641 - 52,136,127 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	52,124,635 - 52,136,127 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	57,174,172 - 57,185,658 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	48,297,516 - 48,309,303 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	48,311,558 - 48,323,346 (-)	NCBI
Celera	13	47,051,694 - 47,063,180 (-)	NCBI		Celera
Cytogenetic Map	13	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

familial adult myoclonic epilepsy 5 (ISO)

gastrointestinal stromal tumor (ISO)

Hypokalemic Periodic Paralysis, Type 1 (ISO)

parathyroid carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,10-phenanthroline (ISO)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2-palmitoylglycerol (ISO)

4,4'-diaminodiphenylmethane (ISO)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

all-trans-retinoic acid (ISO)

alpha-pinene (ISO)

amiodarone (ISO)

amitrole (EXP)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

ATP (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

calcium atom (EXP)

calcium(0) (EXP)

carbamazepine (ISO)

carbon nanotube (ISO)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

cycloheximide (ISO)

cyclosporin A (ISO)

dibenzo[a,l]pyrene (ISO)

dicrotophos (ISO)

dioxygen (ISO)

ethanol (EXP,ISO)

ethyl methanesulfonate (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

folpet (ISO)

glafenine (EXP)

hydrogen peroxide (ISO)

methidathion (ISO)

methimazole (EXP)

methotrexate (ISO)

mifepristone (ISO)

nefazodone (EXP)

nickel atom (ISO)

nimesulide (EXP)

ozone (ISO)

paracetamol (ISO)

paraquat (ISO)

perfluorooctanoic acid (EXP)

phenobarbital (EXP)

phenol (ISO)

phorbol 13-acetate 12-myristate (ISO)

pirinixic acid (EXP)

piroxicam (ISO)

potassium dichromate (ISO)

resveratrol (ISO)

silicon dioxide (ISO)

sulfadimethoxine (EXP)

tamibarotene (ISO)

tamoxifen (ISO)

thapsigargin (ISO)

titanium dioxide (ISO)

valproic acid (ISO)

vinclozolin (EXP)

zearalenone (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

positive regulation of protein processing (IMP)

protein import into mitochondrial matrix (IBA,IEA)

protein transport (IEA)

Cellular Component

mitochondrial inner membrane (IDA,IEA,ISO)

mitochondrion (ISO)

nucleoplasm (IEA,ISO)

TIM23 mitochondrial import inner membrane translocase complex (IBA,IEA,ISO)

Molecular Function

enzyme binding (IPI)

protein binding (IPI)

protein transmembrane transporter activity (IBA,IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

presequence pathway of mitochondrial protein import (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Combined genealogical, mapping, and expression approaches to identify spontaneously hypertensive rat hypertension candidate genes.	Hinojos CA, etal., Hypertension 2005 Apr;45(4):698-704. Epub 2005 Feb 14.
4.	Identification of the protein import components of the rat mitochondrial inner membrane, rTIM17, rTIM23, and rTIM44.	Ishihara N and Mihara K, J Biochem (Tokyo) 1998 Apr;123(4):722-32.
5.	Characterization of the initial steps of precursor import into rat liver mitoplasts.	Ishihara N, etal., J Biochem. 1998 Oct;124(4):824-34.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Unlocking the presequence import pathway.	Schulz C, etal., Trends Cell Biol. 2015 May;25(5):265-75. doi: 10.1016/j.tcb.2014.12.001. Epub 2014 Dec 23.
12.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
13.	Cooperation of protein machineries in mitochondrial protein sorting.	Wenz LS, etal., Biochim Biophys Acta. 2015 May;1853(5):1119-29. doi: 10.1016/j.bbamcr.2015.01.012. Epub 2015 Jan 26.

Additional References at PubMed

PMID:10339406	PMID:12477932	PMID:14651853	PMID:18614015	PMID:20053669

Genomics

Comparative Map Data

Timm17a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	49,282,918 - 49,296,363 (-)	NCBI		GRCr8
mRatBN7.2	13	46,731,117 - 46,742,604 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	46,730,660 - 46,742,655 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	49,337,908 - 49,349,396 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	50,625,983 - 50,637,472 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	47,890,625 - 47,902,136 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	52,124,641 - 52,136,127 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	52,124,635 - 52,136,127 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	57,174,172 - 57,185,658 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	48,297,516 - 48,309,303 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	48,311,558 - 48,323,346 (-)	NCBI
Celera	13	47,051,694 - 47,063,180 (-)	NCBI		Celera
Cytogenetic Map	13	q13	NCBI

TIMM17A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	201,955,503 - 201,970,664 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	201,955,503 - 201,970,664 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	201,924,631 - 201,939,792 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	200,191,271 - 200,206,412 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	198,656,304 - 198,671,444	NCBI
Celera	1	175,048,350 - 175,063,536 (+)	NCBI		Celera
Cytogenetic Map	1	q32.1	NCBI
HuRef	1	173,090,472 - 173,105,672 (+)	NCBI		HuRef
CHM1_1	1	203,346,842 - 203,362,018 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	201,213,194 - 201,228,387 (+)	NCBI		T2T-CHM13v2.0

Timm17a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	135,229,273 - 135,241,475 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	135,222,951 - 135,241,516 (-)	Ensembl		GRCm39 Ensembl
GRCm38	1	135,301,535 - 135,313,737 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	135,295,213 - 135,313,778 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	137,198,112 - 137,210,314 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	137,117,946 - 137,130,148 (-)	NCBI		MGSCv36	mm8
Celera	1	137,926,600 - 137,940,154 (-)	NCBI		Celera
Cytogenetic Map	1	E4	NCBI
cM Map	1	58.48	NCBI

Timm17a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955406	38,020,850 - 38,031,651 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955406	38,020,886 - 38,031,651 (+)	NCBI	ChiLan1.0	ChiLan1.0

TIMM17A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	47,412,600 - 47,427,100 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	47,377,315 - 47,391,712 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	177,552,399 - 177,567,148 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	181,854,424 - 181,868,960 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	181,854,412 - 181,868,960 (+)	Ensembl	panpan1.1		panPan2

TIMM17A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	1,002,710 - 1,015,803 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	7	1,003,236 - 1,015,694 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	1,054,363 - 1,067,437 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	1,010,536 - 1,023,620 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	1,010,178 - 1,023,535 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	998,561 - 1,011,620 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	1,106,754 - 1,119,814 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	1,130,770 - 1,143,830 (-)	NCBI		UU_Cfam_GSD_1.0

Timm17a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	73,301,779 - 73,313,520 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936567	2,536,454 - 2,548,138 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TIMM17A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	10	24,200,368 - 24,211,786 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	10	24,200,345 - 24,211,790 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

TIMM17A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	27,436,066 - 27,450,512 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666055	28,218,698 - 28,232,886 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Timm17a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624807	8,814,582 - 8,826,622 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624807	8,814,584 - 8,826,649 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Timm17a
63 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	153
Count of miRNA genes:	118
Interacting mature miRNAs:	135
Transcripts:	ENSRNOT00000009398
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	46088046	91088046	Rat
10755495	Bp387	Blood pressure QTL 387	3.78		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	34663461	87525369	Rat
9589141	Insul28	Insulin level QTL 28	10.82	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	13	9313465	54313465	Rat
6893344	Cm79	Cardiac mass QTL 79	1.5	0.04	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	13	43720770	62022792	Rat
70220	Bp55	Blood pressure QTL 55	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	37374509	82374509	Rat
71119	Thym2	Thymus enlargement QTL 2	3.8		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	13	46197976	84753113	Rat
61391	Bp5	Blood pressure QTL 5	5.6		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	22301875	67301875	Rat
4889861	Pur29	Proteinuria QTL 29	13.8	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	37415584	80753406	Rat
2317040	Aia21	Adjuvant induced arthritis QTL 21	2.75		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	13	9831541	54831541	Rat
631645	Bp121	Blood pressure QTL 121	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	14915655	59915655	Rat
2317046	Aia8	Adjuvant induced arthritis QTL 8	3.9700000286102295		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	13	9831541	54831541	Rat
12879441	Bp396	Blood pressure QTL 396			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45699983	90699983	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	39754544	84754544	Rat
1581570	Eae17	Experimental allergic encephalomyelitis QTL 17	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	13	8897350	101631289	Rat
70170	Eae14	Experimental allergic encephalomyelitis QTL 14		0.0024	nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	13	23203448	68203448	Rat
1331784	Bp222	Blood pressure QTL 222	2.944		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	17694436	53050594	Rat
61340	Bp25	Blood pressure QTL 25	4.2	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	34535218	79535218	Rat
1581573	Uae36	Urinary albumin excretion QTL 36			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	5994833	77046787	Rat
1549897	Stresp12	Stress response QTL 12	3.35		stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	13	38433408	83433408	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	20605871	101339738	Rat
4145117	Mcs27	Mammary carcinoma susceptibility QTL 27		0.0001	mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	13	43437904	47841255	Rat
1558644	Cm45	Cardiac mass QTL 45	3.6	0.002	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	13	23692969	68692969	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	31241331	93395974	Rat
61349	Bp31	Blood pressure QTL 31	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	37374509	82374509	Rat
2303563	Bw89	Body weight QTL 89	6		body mass (VT:0001259)	body weight (CMO:0000012)	13	32284471	77284471	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	30395351	101056920	Rat
2301962	Cm72	Cardiac mass QTL 72	4.12		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	13	31241331	58363171	Rat
1581554	Pur11	Proteinuria QTL 11			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	13	5994833	77046787	Rat
12879477	Bp401	Blood pressure QTL 401			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	37262092	82262092	Rat
1331750	Bp220	Blood pressure QTL 220	2.98		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	37415584	82415584	Rat
6893338	Cm76	Cardiac mass QTL 76	0	0.99	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	13	23692969	68692969	Rat
12879472	Bp399	Blood pressure QTL 399			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45228358	47841255	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	101056920	Rat
9589164	Gluco66	Glucose level QTL 66	6.67	0.001	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	13	15158722	60158722	Rat
7411662	Foco29	Food consumption QTL 29	20.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	13	9313465	54313465	Rat

Markers in Region

D13Hmgc62

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	46,740,002 - 46,740,211 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	52,133,526 - 52,133,734	NCBI	Rnor6.0
Rnor_5.0	13	57,183,057 - 57,183,265	UniSTS	Rnor5.0
RGSC_v3.4	13	48,306,701 - 48,306,909	UniSTS	RGSC3.4
Celera	13	47,060,579 - 47,060,787	UniSTS
Cytogenetic Map	13	q13	UniSTS

RH127788

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	46,731,205 - 46,731,389 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	52,124,730 - 52,124,913	NCBI	Rnor6.0
Rnor_5.0	13	57,174,261 - 57,174,444	UniSTS	Rnor5.0
RGSC_v3.4	13	48,297,605 - 48,297,788	UniSTS	RGSC3.4
Celera	13	47,051,783 - 47,051,966	UniSTS
RH 3.4 Map	10	194.1	UniSTS
Cytogenetic Map	13	q13	UniSTS

RH136499

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	79,637,593 - 79,637,802 (+)	MAPPER	mRatBN7.2
mRatBN7.2	13	46,731,287 - 46,731,496 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	52,124,812 - 52,125,020	NCBI	Rnor6.0
Rnor_6.0	6	83,252,719 - 83,252,927	NCBI	Rnor6.0
Rnor_5.0	13	57,174,343 - 57,174,551	UniSTS	Rnor5.0
Rnor_5.0	6	92,772,158 - 92,772,366	UniSTS	Rnor5.0
RGSC_v3.4	6	82,484,770 - 82,484,978	UniSTS	RGSC3.4
RGSC_v3.4	13	48,297,687 - 48,297,895	UniSTS	RGSC3.4
Celera	13	47,051,865 - 47,052,073	UniSTS
Celera	6	78,292,310 - 78,292,518	UniSTS
Cytogenetic Map	13	q13	UniSTS
Cytogenetic Map	6	q23	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019351	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272562	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB006450	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC096239	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC061982	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000009398 ⟹ ENSRNOP00000009398

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	46,731,127 - 46,742,623 (-)	Ensembl
Rnor_6.0 Ensembl	13	52,124,635 - 52,136,127 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000099219 ⟹ ENSRNOP00000094804

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	46,730,660 - 46,742,655 (-)	Ensembl

RefSeq Acc Id:

NM_019351 ⟹ NP_062224

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	49,282,918 - 49,294,404 (-)	NCBI
mRatBN7.2	13	46,731,117 - 46,742,604 (-)	NCBI
Rnor_6.0	13	52,124,641 - 52,136,127 (-)	NCBI
Rnor_5.0	13	57,174,172 - 57,185,658 (-)	NCBI
RGSC_v3.4	13	48,297,516 - 48,309,303 (-)	RGD
Celera	13	47,051,694 - 47,063,180 (-)	RGD

Sequence:

show sequence

CAAGATGGAGGAGTACGCGAGAGAGCCGTGCCCCTGGAGAATTGTGGATGACTGTGGCGGTGCC
TTTACCATGGGTACCATAGGTGGTGGCATCTTCCAGGCCTTCAAAGGTTTTCGAAATTCTCCAG
TGGGAGTAAACCACAGACTCCGAGGGAGTTTAACAGCTATTAAAACCAGGGCCCCACAATTGGG
AGGTAGCTTTGCAGTTTGGGGAGGCCTGTTTTCCACGATTGACTGTGGTATGGTTCAGATAAGA
GGCAAAGAAGACCCCTGGAACTCCATCACTAGCGGTGCCTTAACAGGAGCCATCCTGGCAGCAA
GAAATGGACCGGTAGCCATGGTTGGGTCAGCTGCGATGGGCGGCATTCTCCTAGCTTTAATTGA
AGGAGCTGGTATCCTGTTGACCAGGTTTGCCTCTGCACAGTTTCCTAATGGCCCTCAGTTTGCT
GAAGACCACTCCCAGTTGCCTTCAAGCCAGTTGCCGTCCTCACCATTTGGAGACTACCGACAGT
ATCAGTAGGACTTGGTCCCCGGGATTCCTGGACCTGGGTGGACTGCAGTTTGGTAGGGTTTCAG
AAGATCAAGTTACAGTCTGTTGAAAGCCTTAGGTGGGACACCGGCGGCCAAGCAGGCCATCAAG
AGACATTTAGCACATTTTTCTATTTAAAAGAGACTCAGAGTGTGGAAAAGATACCGAGTTTATT
TATTCATGCTTGGATTGCGTCTGTGATCAAAATAAATGTCTAATACCATTTAAAGAATGTATAT
GAACTTAGAAGATAAAGGACCAAAGGCCACATAACAGTGAAATTCGACTGTCCTTCCTTCGGGA
CTTTTTTGCCTGGTGTTTATGTACAGTTGTTCAGACAATAAAAGGCTTTTGGGACTTGACCTTT
CC

hide sequence

RefSeq Acc Id:

XM_063272562 ⟹ XP_063128632

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	49,282,925 - 49,296,363 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_062224	(Get FASTA)	NCBI Sequence Viewer
	XP_063128632	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH61982	(Get FASTA)	NCBI Sequence Viewer
	BAA21818	(Get FASTA)	NCBI Sequence Viewer
	EDM09699	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000009398.5
	ENSRNOP00000094804.1
GenBank Protein	O35092	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_062224 ⟸ NM_019351
- UniProtKB:	O35092 (UniProtKB/Swiss-Prot), A6ICE7 (UniProtKB/TrEMBL), A0A8I6ANA6 (UniProtKB/TrEMBL)
- Sequence:	show sequence MEEYAREPCPWRIVDDCGGAFTMGTIGGGIFQAFKGFRNSPVGVNHRLRGSLTAIKTRAPQLGG SFAVWGGLFSTIDCGMVQIRGKEDPWNSITSGALTGAILAARNGPVAMVGSAAMGGILLALIEG AGILLTRFASAQFPNGPQFAEDHSQLPSSQLPSSPFGDYRQYQ hide sequence

Ensembl Acc Id:

ENSRNOP00000009398 ⟸ ENSRNOT00000009398

Ensembl Acc Id:

ENSRNOP00000094804 ⟸ ENSRNOT00000099219

RefSeq Acc Id:	XP_063128632 ⟸ XM_063272562
- Peptide Label:	isoform X1
- UniProtKB:	O35092 (UniProtKB/Swiss-Prot), A0A8I6ANA6 (UniProtKB/TrEMBL), A6ICE7 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O35092-F1-model_v2	AlphaFold	O35092	1-171	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698842

Promoter ID:

EPDNEW_R9366

Type:

multiple initiation site

Name:

Timm17a_1

Description:

translocase of inner mitochondrial membrane 17A

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	13	52,136,141 - 52,136,201	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3862	AgrOrtholog
BioCyc Gene	G2FUF-18211	BioCyc
Ensembl Genes	ENSRNOG00000007040	Ensembl, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000009398.5	UniProtKB/TrEMBL
	ENSRNOT00000099219.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:5598788	IMAGE-MGC_LOAD
InterPro	Tim17	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:54311	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:72274	IMAGE-MGC_LOAD
NCBI Gene	54311	ENTREZGENE
PANTHER	MITOCHONDRIAL IMPORT INNER MEMBRANE TRANSLOCASE SUBUNIT TIM-17	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	MITOCHONDRIAL IMPORT INNER MEMBRANE TRANSLOCASE SUBUNIT TIM17-A	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Tim17	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Timm17a	PhenoGen
RatGTEx	ENSRNOG00000007040	RatGTEx
TIGR	TC228848
UniProt	A0A8I6ANA6	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2Q460_RAT	UniProtKB/TrEMBL
	A6ICE7	ENTREZGENE, UniProtKB/TrEMBL
	O35092	ENTREZGENE
	Q6P6W9_RAT	UniProtKB/TrEMBL
	TI17A_RAT	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-02-01	Timm17a	translocase of inner mitochondrial membrane 17A	Timm17a	translocase of inner mitochondrial membrane 17 homolog A (yeast)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-10-23	Timm17a	translocase of inner mitochondrial membrane 17 homolog A (yeast)	Timm17a	translocase of inner mitochondrial membrane 17a	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-15	Timm17a	translocase of inner mitochondrial membrane 17a	Timm17a	translocator of inner mitochondrial membrane 17a	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Timm17a	translocator of inner mitochondrial membrane 17a		translocator of inner mitochondrial membrane 17a (yeast)	Name updated	1299863	APPROVED
2002-06-10	Timm17a	translocator of inner mitochondrial membrane 17a (yeast)			Name updated	70584	APPROVED
2001-12-06	Timm17a	translocator of inner mitochondrial membrane 17 kDa, a			Symbol updated to reflect Human and Mouse nomenclature	69665	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expression is decreased 1.3 fold in SHR compared with WKY rats	1357414

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations