Sstr4 (somatostatin receptor 4) - Rat Genome Database

Name: Sstr4
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Community Projects Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Sstr4 (somatostatin receptor 4) Rattus norvegicus

Analyze

Symbol:

Sstr4

Name:

somatostatin receptor 4

RGD ID:

3764

Description:

Enables somatostatin receptor activity. Involved in several processes, including cellular response to glucocorticoid stimulus; positive regulation of arachidonic acid secretion; and regulation of signal transduction. Predicted to be located in plasma membrane. Predicted to be active in neuron projection. Biomarker of status epilepticus. Orthologous to human SSTR4 (somatostatin receptor 4); PARTICIPATES IN cimetidine pharmacodynamics pathway; esomeprazole pharmacodynamics pathway; famotidine pharmacodynamics pathway; INTERACTS WITH (+)-pilocarpine; 6-propyl-2-thiouracil; acrylamide.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

Smstr4; Somatostatin receptor subtype 4 Rattus norvegicus Sprague-Dawley major hippocampal somatostatin receptor (SSTR4) mRNA; somatostatin receptor type 4; SS-4-R; SS4-R; SS4R

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SSTR4 (somatostatin receptor 4)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB
Mus musculus (house mouse):	Sstr4 (somatostatin receptor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SSTR4 (somatostatin receptor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Sstr4 (somatostatin receptor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SSTR4 (somatostatin receptor 4)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	MEX3C (mex-3 RNA binding family member C)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	SSTR4 (somatostatin receptor 4)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Sstr4 (somatostatin receptor 4)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	sstr1b (somatostatin receptor 1b)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)
Drosophila melanogaster (fruit fly):	AstC-R1	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	npr-24	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	AstC-R2	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	135,854,826 - 135,856,689 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	135,854,826 - 135,856,689 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	139,797,830 - 139,799,693 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	148,381,963 - 148,383,826 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	146,080,466 - 146,082,329 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	142,739,781 - 142,741,644 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	142,739,781 - 142,741,644 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	149,151,003 - 149,152,866 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	137,150,419 - 137,152,284 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	137,055,991 - 137,057,857 (+)	NCBI
Celera	3	134,698,650 - 134,700,513 (+)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Brain Injuries (IEP)

genetic disease (ISO)

Glucagonoma (ISO)

status epilepticus (IEP,ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-pilocarpine (EXP)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3,4-methylenedioxymethamphetamine (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

amitrole (EXP)

ammonium chloride (EXP)

amphetamine (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

carbon nanotube (ISO)

carrageenan (ISO)

CGP 52608 (ISO)

clofibrate (ISO)

Cuprizon (EXP)

decabromodiphenyl ether (EXP)

diazinon (ISO)

dioxygen (ISO)

ethanol (ISO)

folic acid (ISO)

lead diacetate (ISO)

lipopolysaccharide (ISO)

methimazole (EXP)

N-nitrosodiethylamine (ISO)

ozone (ISO)

paracetamol (ISO)

pasireotide (ISO)

piperonyl butoxide (ISO)

propanal (ISO)

propiconazole (EXP)

resveratrol (ISO)

silicon dioxide (EXP)

somatostatin (ISO)

sulfadimethoxine (EXP)

titanium dioxide (ISO)

toluene (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell migration (IDA,IMP)

cellular response to glucocorticoid stimulus (IBA,IEP)

forebrain development (IEP)

negative regulation of adenylate cyclase-activating G protein-coupled receptor signaling pathway (IDA)

neuropeptide signaling pathway (IBA)

positive regulation of arachidonic acid secretion (IDA)

positive regulation of ERK1 and ERK2 cascade (IDA)

somatostatin signaling pathway (IEA)

Cellular Component

neuron projection (IBA)

plasma membrane (IEA)

Molecular Function

neuropeptide binding (IBA)

protein binding (IPI,ISO)

somatostatin receptor activity (IBA,IDA)

Molecular Pathway Annotations Click to see Annotation Detail View

cimetidine pharmacodynamics pathway (ISO)

esomeprazole pharmacodynamics pathway (ISO)

famotidine pharmacodynamics pathway (ISO)

lansoprazole pharmacodynamics pathway (ISO)

nizatidine pharmacodynamics pathway (ISO)

omeprazole pharmacodynamics pathway (ISO)

pantoprazole pharmacodynamics pathway (ISO)

pirenzepine pharmacodynamics pathway (ISO)

rabeprazole pharmacodynamics pathway (ISO)

ranitidine pharmacodynamics pathway (ISO)

roxatidine acetate pharmacodynamics pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Functional coupling of SSTR4, a major hippocampal somatostatin receptor, to adenylate cyclase inhibition, arachidonate release and activation of the mitogen-activated protein kinase cascade.	Bito H, etal., J Biol Chem. 1994 Apr 29;269(17):12722-30.
2.	Identification of multiple somatostatin receptors in the rat somatosensory cortex during development.	Bologna E and Leroux P, J Comp Neurol. 2000 May 15;420(4):466-80.
3.	Expression changes of somatostatin receptor subtypes sst2A, sst2B, sst3 and sst4 after a cortical contusion trauma in rats.	Braun H, etal., Brain Res. 2002 Mar 15;930(1-2):191-9.
4.	Molecular cloning and functional expression of a brain-specific somatostatin receptor.	Bruno JF, etal., Proc Natl Acad Sci U S A 1992 Dec 1;89(23):11151-5.
5.	Interaction of brain somatostatin receptors with the PDZ domains of PSD-95.	Christenn M, etal., FEBS Lett. 2007 Nov 13;581(27):5173-7. Epub 2007 Oct 12.
6.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
8.	A potential role of somatostatin and its receptor SSTR4 in the migration of hepatic oval cells.	Jung Y, etal., Lab Invest. 2006 May;86(5):477-89.
9.	Identification of somatostatin receptor subtypes and an implication for the efficacy of somatostatin analogue SMS 201-995 in treatment of human endocrine tumors.	Kubota A, etal., J Clin Invest. 1994 Mar;93(3):1321-5.
10.	Expression of the five somatostatin receptor (SSTR1-5) subtypes in rat pituitary somatotrophes: quantitative analysis by double-layer immunofluorescence confocal microscopy.	Kumar U, etal., Endocrinology. 1997 Oct;138(10):4473-6.
11.	The expression of somatostatin receptors in the hippocampus of pilocarpine-induced rat epilepsy model.	Kwak SE, etal., Neuropeptides. 2008 Oct-Dec;42(5-6):569-83. Epub 2008 Oct 31.
12.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
13.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
14.	Molecular cloning and expression of a pituitary somatostatin receptor with preferential affinity for somatostatin-28.	O'Carroll AM, etal., Mol Pharmacol 1992 Dec;42(6):939-46.
15.	Role of glucocorticoids in the regulation of pituitary somatostatin receptor subtype (sst1-sst5) mRNA levels: evidence for direct and somatostatin-mediated effects.	Park S, etal., Neuroendocrinology. 2003 Sep;78(3):163-75.
16.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
17.	GOA pipeline	RGD automated data pipeline
18.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
19.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
20.	Vasculoprotective effects of somatostatin receptor subtypes.	Tigerstedt NM, etal., Mol Cell Endocrinol. 2007 Dec 15;279(1-2):34-8. Epub 2007 Sep 11.
21.	Ligand Binding and Functional Properties of the Rat Somatostatin Receptor SSTR4 Stably Expressed in Chinese Hamster Ovary Cells.	Xu Y, etal., Mol Cell Neurosci. 1993 Jun;4(3):245-9.

Additional References at PubMed

PMID:17617126	PMID:20573967	PMID:22098068	PMID:23233668	PMID:24416361	PMID:24769416	PMID:25926390	PMID:30291955

Genomics

Comparative Map Data

Sstr4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	3	135,854,826 - 135,856,689 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	135,854,826 - 135,856,689 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	139,797,830 - 139,799,693 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	148,381,963 - 148,383,826 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	146,080,466 - 146,082,329 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	142,739,781 - 142,741,644 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	142,739,781 - 142,741,644 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	149,151,003 - 149,152,866 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	137,150,419 - 137,152,284 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	3	137,055,991 - 137,057,857 (+)	NCBI
Celera	3	134,698,650 - 134,700,513 (+)	NCBI		Celera
Cytogenetic Map	3	q41	NCBI

SSTR4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	20	23,035,312 - 23,039,237 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	20	23,035,312 - 23,039,237 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	20	23,015,949 - 23,019,874 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	20	22,964,057 - 22,965,314 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	20	22,964,120 - 22,965,287	NCBI
Celera	20	23,089,437 - 23,090,694 (+)	NCBI		Celera
Cytogenetic Map	20	p11.21	NCBI
HuRef	20	22,977,578 - 22,978,835 (+)	NCBI		HuRef
CHM1_1	20	23,016,757 - 23,018,014 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	20	23,094,793 - 23,098,718 (+)	NCBI		T2T-CHM13v2.0

Sstr4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	148,237,297 - 148,238,684 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	148,237,264 - 148,238,687 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	148,395,377 - 148,396,764 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	148,395,344 - 148,396,767 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	148,221,113 - 148,222,500 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	148,086,783 - 148,092,384 (+)	NCBI		MGSCv36	mm8
Celera	2	149,668,860 - 149,670,247 (+)	NCBI		Celera
Cytogenetic Map	2	G3	NCBI
cM Map	2	73.44	NCBI

SSTR4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	20	23,910,298 - 23,914,353 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	20	22,982,009 - 22,986,058 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	20	23,333,445 - 23,334,933 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	20	23,333,320 - 23,334,766 (+)	Ensembl	panpan1.1		panPan2

Sstr4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	149,149,383 - 149,157,532 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936620	2,576,598 - 2,577,761 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936620	2,575,880 - 2,577,761 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SSTR4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	2	52,027,241 - 52,034,777 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	2	52,031,021 - 52,032,187 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666078	6,842,484 - 6,846,721 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Sstr4
6 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	86
Count of miRNA genes:	72
Interacting mature miRNAs:	85
Transcripts:	ENSRNOT00000006181
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70216	Cm14	Cardiac mass QTL 14	2.1		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	3	31172320	163586636	Rat
2301970	Bw81	Body weight QTL 81	5.19		body mass (VT:0001259)	body weight (CMO:0000012)	3	41874578	155617519	Rat
2301971	Cm71	Cardiac mass QTL 71	4.63		heart left ventricle mass (VT:0007031)	heart left ventricle weight (CMO:0000776)	3	41874578	155617519	Rat
1559282	Emca5	Estrogen-induced mammary cancer QTL 5	3.9		mammary gland integrity trait (VT:0010552)	percentage of study population developing mammary tumors during a period of time (CMO:0000948)	3	43827364	169034231	Rat
2292591	Esta4	Estrogen-induced thymic atrophy QTL 4			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	3	47233211	147415807	Rat
1581568	Rf53	Renal function QTL 53			urine total protein amount (VT:0000032)	urine protein excretion rate to body weight ratio (CMO:0001099)	3	56395968	161299569	Rat
8662816	Vetf4	Vascular elastic tissue fragility QTL 4	4		renal artery integrity trait (VT:0010642)	number of ruptures of the internal elastic lamina of the renal arteries (CMO:0002563)	3	59242096	157323038	Rat
1581546	Pur13	Proteinuria QTL 13	2.93	0.0335	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	3	78196190	146592722	Rat
8694437	Bw167	Body weight QTL 167	22.46	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	3	91797474	136797474	Rat
631841	Niddm39	Non-insulin dependent diabetes mellitus QTL 39	3.36		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	94856903	159898684	Rat
724532	Cm17	Cardiac mass QTL 17	2		heart mass (VT:0007028)	calculated heart weight (CMO:0000073)	3	95735366	140735366	Rat
1354611	Despr2	Despair related QTL 2	3.03	0.0028	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	3	97084464	142084464	Rat
2293087	Iddm27	Insulin dependent diabetes mellitus QTL 27	2.68		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	3	97551417	147415807	Rat
2312659	Slep7	Serum leptin concentration QTL 7		0.001	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	3	98535255	168026850	Rat
2312670	Bw94	Body weight QTL 94		0.01	inguinal fat pad mass (VT:0010424)	inguinal fat pad weight to body weight ratio (CMO:0001253)	3	98535255	168026850	Rat
2312673	Scl63	Serum cholesterol level QTL 63		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	3	98535255	168026850	Rat
2302373	Gluco39	Glucose level QTL 39	5.01		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	3	98535386	161695835	Rat
619618	Rf3	Renal disease susceptibility QTL 3	6.5	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate to body weight ratio (CMO:0001270)	3	107693393	152693393	Rat
1578754	Stresp16	Stress response QTL 16	4	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	3	112681431	157681431	Rat
1576306	Schws3	Schwannoma susceptibility QTL 3		0.001	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	3	118839124	163839124	Rat
1598877	Bp285	Blood pressure QTL 285	1.5	0.03	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	120538241	165538241	Rat
1300173	Rf11	Renal function QTL 11	3.38		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	3	121056165	145956249	Rat
1300159	Kidm4	Kidney mass QTL 4	3.83		kidney mass (VT:0002707)	right kidney wet weight to body weight ratio (CMO:0001953)	3	121056165	157309487	Rat
10755461	Coatc16	Coat color QTL 16			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	3	122438700	167438700	Rat
631541	Bp81	Blood pressure QTL 81	4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	3	124122556	169034231	Rat
2303620	Vencon4	Ventilatory control QTL 4	3.9		respiration trait (VT:0001943)	tidal volume (CMO:0000222)	3	127162703	168026850	Rat
631673	Iddm13	Insulin dependent diabetes mellitus QTL 13	1.3	0.663	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	3	130193298	161695983	Rat
1578656	Vnigr2	Vascular neointimal growth QTL 2	4.2		artery morphology trait (VT:0002191)	lesioned artery residual lumen area (CMO:0001417)	3	130656562	169034231	Rat
1578653	Vnigr3	Vascular neointimal growth QTL 3	3.1		artery morphology trait (VT:0002191)	artery neointimal hyperplastic lesion area (CMO:0001414)	3	130656562	169034231	Rat
9589106	Insul23	Insulin level QTL 23	13.86	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	3	131635904	169034231	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium									12			11
Low		34	6	6	9	6			42	4	23
Below cutoff	3	9	22	8	8	8	7	7	20	27	12		7

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_013036	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474026	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000119	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M96544	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U04738	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000006181 ⟹ ENSRNOP00000066231

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	3	135,854,826 - 135,856,689 (+)	Ensembl
Rnor_6.0 Ensembl	3	142,739,781 - 142,741,644 (+)	Ensembl

RefSeq Acc Id:

NM_013036 ⟹ NP_037168

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	3	135,854,826 - 135,856,689 (+)	NCBI
Rnor_6.0	3	142,739,781 - 142,741,644 (+)	NCBI
Rnor_5.0	3	149,151,003 - 149,152,866 (+)	NCBI
RGSC_v3.4	3	137,150,419 - 137,152,284 (+)	RGD
Celera	3	134,698,650 - 134,700,513 (+)	RGD

Sequence:

show sequence

GTTCAGCGTTCGGCTGCTCTCCACGGCAATCCGCTGCCCCGGGTGGGCACCCCGAAGCATGAAC
ACGCCTGCAACTCTGCCCCTGGGGGGCGAGGACACCACCTGGACCCCTGGGATCAACGCCAGCT
GGGCTCCGGATGAGGAGGAGGATGCAGTGCGGTCCGACGGCACGGGGACAGCGGGCATGGTAAC
TATCCAGTGCATCTATGCGCTCGTGTGTCTGGTGGGCCTGGTAGGAAACGCCCTGGTCATATTC
GTGATCCTACGCTATGCCAAAATGAAGACAGCCACCAACATCTACCTGCTCAACCTGGCCGTCG
CTGATGAGCTCTTCATGCTCAGTGTGCCATTTGTGGCCTCGGCGGCTGCCCTGCGCCACTGGCC
GTTCGGGGCGGTGCTGTGCCGCGCAGTGCTTAGTGTGGACGGCCTTAACATGTTCACGAGTGTC
TTCTGCCTCACAGTGCTCAGCGTGGATCGCTATGTGGCTGTAGTGCACCCTCTGCGAGCTGCCA
CCTACCGGCGGCCCAGCGTGGCCAAGCTAATCAACCTGGGAGTGTGGCTAGCATCCTTGCTGGT
CACCCTGCCCATCGCAGTCTTCGCTGACACTAGGCCAGCTCGTGGGGGTGAGGCAGTAGCTTGC
AACCTGCACTGGCCTCACCCGGCCTGGTCTGCAGTCTTTGTGATCTATACTTTTTTGCTGGGCT
TCCTACTCCCGGTTCTGGCTATCGGATTATGTTACCTGCTTATCGTGGGCAAGATGCGTGCTGT
GGCCCTGCGGGCTGGCTGGCAACAACGGAGGCGCTCAGAGAAGAAGATCACTAGGCTCGTGCTA
ATGGTGGTGACTGTCTTTGTGCTATGCTGGATGCCATTCTATGTAGTGCAGCTTCTGAATCTGT
TTGTCACCAGCCTCGATGCCACTGTCAACCATGTGTCCCTCATCCTCAGCTATGCCAACAGCTG
TGCCAACCCGATTCTCTATGGTTTCCTCTCAGACAACTTCCGACGCTCTTTCCAGCGGGTTCTG
TGCCTGCGCTGCTGTCTCCTGGAAACAACTGGAGGTGCTGAGGAAGAGCCCCTGGACTACTATG
CTACTGCTCTCAAAAGCAGAGGTGGCCCAGGATGCATATGCCCTCCATTGCCCTGCCAGCAGGA
GCCCATGCAAGCAGAACCTGCCTGCAAGCGAGTCCCTTTCACCAAGACCACTACTTTCTGAAAA
CCATTTCACCCTCCCTCAGCCCACCTGCAAGCAGGTCTGCACCACACTCTCAAGCCAGCAACTT
CAAGAAAACTCCTGTTGTCACTAAGCCAGGCCCTTTCAGCAGCCTGTGTTCTGTCCCTAGGAGC
CTCAGGACTCCTGCTAGCCCCTGCCTCTCCTAGGACTGACTGGCTCCAAGGACAACTCCGTGGG
GGTAGGACTTCTCTGGGTTTTGGGCTAGAGTACCATCCATCCTTTCCTGGACCTCTAGCAATTT
TTCAAGAGGCAGGAAGCAGGTGGTGGTCAGAAAGGGATGCCTACCCTTGTGTGACTTGTGACAG
TGACTGCTTGGAAGAGCGCTGGGAGGGTGAGGTAGGCAGAGCTAGGCTCTCTGCTGTGTGGTAG
CATAGGGCATACGGTGATACAGGGGAGAAGATATGATACCTCCAAGTGTTTTCCCTCTGTGTCT
GTCTGAGTCTCTTGTTGCTAAATGAGATGTCTACGCAACAGCTGAAAGCATTTGCTTTCCCAAG
GCAAATGTTTCTCCAGTTGTCAAAGGACCAGTAGCAGACTTCCTGCGAATGCAAATGTTTAAAG
AAGGATGGTGTGGGGCGTTTTTTGAAAAAAAAAATAATTCTGATTTCTGGTCAGGAATTAAAAG
GCAGAAAGG

hide sequence

Protein Sequences


Protein RefSeqs	NP_037168	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA17519	(Get FASTA)	NCBI Sequence Viewer
	AAA42180	(Get FASTA)	NCBI Sequence Viewer
	EDL95103	(Get FASTA)	NCBI Sequence Viewer
	EDL95104	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000066231
GenBank Protein	P30937	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_037168 ⟸ NM_013036

- UniProtKB:

P30937 (UniProtKB/Swiss-Prot), A6K7B6 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNTPATLPLGGEDTTWTPGINASWAPDEEEDAVRSDGTGTAGMVTIQCIYALVCLVGLVGNALV
IFVILRYAKMKTATNIYLLNLAVADELFMLSVPFVASAAALRHWPFGAVLCRAVLSVDGLNMFT
SVFCLTVLSVDRYVAVVHPLRAATYRRPSVAKLINLGVWLASLLVTLPIAVFADTRPARGGEAV
ACNLHWPHPAWSAVFVIYTFLLGFLLPVLAIGLCYLLIVGKMRAVALRAGWQQRRRSEKKITRL
VLMVVTVFVLCWMPFYVVQLLNLFVTSLDATVNHVSLILSYANSCANPILYGFLSDNFRRSFQR
VLCLRCCLLETTGGAEEEPLDYYATALKSRGGPGCICPPLPCQQEPMQAEPACKRVPFTKTTTF

hide sequence

RefSeq Acc Id:

ENSRNOP00000066231 ⟸ ENSRNOT00000006181

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P30937-F1-model_v2	AlphaFold	P30937	1-384	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3764	AgrOrtholog
BioCyc Gene	G2FUF-47510	BioCyc
Ensembl Genes	ENSRNOG00000004641	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000006181	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	GPCR_Rhodpsn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Somatstn_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Somatstn_rcpt_4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25555	UniProtKB/Swiss-Prot
NCBI Gene	25555	ENTREZGENE
PANTHER	NEUROPEPTIDES RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SOMATOSTATIN RECEPTOR TYPE 4	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	7tm_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Sstr4	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SOMATOSTATNR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SOMATOSTTN4R	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000004641	RatGTEx
SMART	7TM_GPCR_Srsx	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC211734
UniProt	A6K7B6	ENTREZGENE, UniProtKB/TrEMBL
	P30937	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2003-04-09	Sstr4	somatostatin receptor 4		Somatostatin receptor subtype 4 Rattus norvegicus Sprague-Dawley major hippocampal somatostatin receptor (SSTR4) mRNA	Symbol and Name updated	629477	APPROVED
2002-06-10	Sstr4	Somatostatin receptor subtype 4 Rattus norvegicus Sprague-Dawley major hippocampal somatostatin receptor (SSTR4) mRNA			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	mRNA expressed in various brain regions, particularly in cortex and hippocampus	727543
gene_physical_interaction	higher affinity for somatostatin 14 than for somatostatin 28	727543
gene_product	member of the seven transmembrane domain superfamily of G-protein coupled receptors	727543
gene_protein	predicted protein contains 384 aa residues	727543

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB