Rgs5 (regulator of G-protein signaling 5)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Rgs5 (regulator of G-protein signaling 5) Rattus norvegicus

Analyze

Symbol:

Rgs5

Name:

regulator of G-protein signaling 5

RGD ID:

3568

Description:

Involved in negative regulation of vascular associated smooth muscle cell proliferation and signal transduction. Predicted to be located in cytosol and intracellular membrane-bounded organelle. Biomarker of hypertension. Human ortholog(s) of this gene implicated in colorectal adenocarcinoma and essential hypertension. Orthologous to human RGS5 (regulator of G protein signaling 5); PARTICIPATES IN calcium signaling pathway via the calcium-sensing receptor; G protein mediated signaling pathway via Galphai family; G protein mediated signaling pathway via Galphaq family; INTERACTS WITH 1,2,4-trimethylbenzene; 1-naphthyl isothiocyanate; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

regulator of G protein signaling 5

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	13	81,848,254 - 81,885,053 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	81,836,304 - 81,885,518 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	84,476,082 - 84,512,900 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	13	85,768,861 - 85,805,669 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	13	83,001,335 - 83,038,141 (+)	NCBI	Rnor_WKY
Rnor_6.0	13	87,966,820 - 88,002,831 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	87,966,758 - 88,003,035 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	92,595,346 - 92,631,357 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	85,445,325 - 85,482,294 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	85,459,512 - 85,496,482 (+)	NCBI
Celera	13	81,513,956 - 81,550,630 (+)	NCBI		Celera
Cytogenetic Map	13	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

colorectal adenocarcinoma (ISO)

essential hypertension (ISO)

Experimental Liver Cirrhosis (ISO)

gastrointestinal stromal tumor (ISO)

hypertension (IEP,ISO)

parathyroid carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-catechin (ISO)

1,2,4-trimethylbenzene (EXP)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,4-dinitrotoluene (EXP)

3,4-methylenedioxymethamphetamine (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-fluorouracil (ISO)

acrylamide (ISO)

Actein (EXP)

all-trans-retinoic acid (ISO)

amphetamine (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

avobenzone (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

butanal (ISO)

cadmium dichloride (EXP)

carbon nanotube (ISO)

clorgyline (ISO)

cobalt dichloride (ISO)

copper atom (EXP)

copper(0) (EXP)

crocidolite asbestos (ISO)

deoxynivalenol (ISO)

dibenz[a,h]anthracene (ISO)

dioxygen (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

ellagic acid (ISO)

entinostat (ISO)

ethanol (ISO)

fenthion (ISO)

fipronil (EXP)

flavonoids (EXP)

folic acid (ISO)

furan (EXP)

glafenine (EXP)

hydrogen peroxide (ISO)

indole-3-methanol (EXP)

linalool (EXP)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

mercury dibromide (ISO)

methamphetamine (EXP)

methidathion (ISO)

methylmercury chloride (ISO)

N-nitrosodimethylamine (EXP)

nickel atom (ISO)

O-methyleugenol (ISO)

okadaic acid (ISO)

oxaliplatin (EXP)

ozone (ISO)

panobinostat (ISO)

paracetamol (ISO)

PCB138 (EXP)

pentachlorophenol (ISO)

pentanal (ISO)

phenobarbital (ISO)

phenylmercury acetate (ISO)

pioglitazone (ISO)

pirinixic acid (ISO)

potassium dichromate (ISO)

progesterone (EXP,ISO)

quercetin (ISO)

reserpine (EXP)

resveratrol (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenate (ISO)

sodium dichromate (EXP)

Soman (EXP)

sulforaphane (ISO)

sunitinib (ISO)

tamoxifen (ISO)

tetrachloroethene (ISO)

tetrachloromethane (EXP,ISO)

thapsigargin (ISO)

toluene (EXP)

topotecan (EXP)

trichostatin A (ISO)

triphenyl phosphate (ISO)

tunicamycin (ISO)

undecane (EXP)

valproic acid (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of signal transduction (IEA)

negative regulation of vascular associated smooth muscle cell proliferation (IDA)

signal transduction (IDA)

Cellular Component

cytoplasm (IEA)

cytosol (IEA,ISO)

intracellular membrane-bounded organelle (IEA,ISO)

membrane (IEA)

Molecular Function

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

calcium signaling pathway via the calcium-sensing receptor (ISO)

G protein mediated signaling pathway via Galphai family (ISO)

G protein mediated signaling pathway via Galphaq family (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
2.	Impact of Genetic Variation in MicroRNA-binding Site on Susceptibility to Colorectal Cancer.	Kang BW, etal., Anticancer Res. 2016 Jul;36(7):3353-61.
3.	EGL-10 regulates G protein signaling in the C. elegans nervous system and shares a conserved domain with many mammalian proteins.	Koelle MR and Horvitz HR, Cell 1996 Jan 12;84(1):115-25.
4.	Regulator of G protein signaling 5 is highly expressed in parathyroid tumors and inhibits signaling by the calcium-sensing receptor.	Koh J, etal., Mol Endocrinol. 2011 May;25(5):867-76. doi: 10.1210/me.2010-0277. Epub 2011 Mar 10.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Receptor-selective effects of endogenous RGS3 and RGS5 to regulate mitogen-activated protein kinase activation in rat vascular smooth muscle cells.	Wang Q, etal., J Biol Chem 2002 Jul 12;277(28):24949-58.
12.	RGS5, RGS4, and RGS2 expression and aortic contractibility are dynamically co-regulated during aortic banding-induced hypertrophy.	Wang X, etal., J Mol Cell Cardiol. 2008 Mar;44(3):539-50. doi: 10.1016/j.yjmcc.2007.11.019. Epub 2007 Dec 8.
13.	Antihypertensive effects of peroxisome proliferator-activated receptor-beta activation in spontaneously hypertensive rats.	Zarzuelo MJ, etal., Hypertension. 2011 Oct;58(4):733-43. doi: 10.1161/HYPERTENSIONAHA.111.174490. Epub 2011 Aug 8.

Additional References at PubMed

PMID:17939118	PMID:17986358	PMID:21054999	PMID:21593453	PMID:24489801	PMID:25842189	PMID:29061726

Genomics

Comparative Map Data

Rgs5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	13	81,848,254 - 81,885,053 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	81,836,304 - 81,885,518 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	84,476,082 - 84,512,900 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	13	85,768,861 - 85,805,669 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	13	83,001,335 - 83,038,141 (+)	NCBI	Rnor_WKY
Rnor_6.0	13	87,966,820 - 88,002,831 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	87,966,758 - 88,003,035 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	92,595,346 - 92,631,357 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	85,445,325 - 85,482,294 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	85,459,512 - 85,496,482 (+)	NCBI
Celera	13	81,513,956 - 81,550,630 (+)	NCBI		Celera
Cytogenetic Map	13	q24	NCBI

RGS5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	163,142,299 - 163,321,735 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	1	163,111,121 - 163,321,791 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh38.p13 Ensembl	1	163,244,505 - 163,321,894 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	163,112,089 - 163,291,525 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	161,378,716 - 161,439,496 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	159,843,754 - 159,904,530	NCBI
Celera	1	136,216,406 - 136,277,298 (-)	NCBI		Celera
Cytogenetic Map	1	q23.3	NCBI
HuRef	1	134,357,419 - 134,536,920 (-)	NCBI		HuRef
CHM1_1	1	164,534,977 - 164,714,483 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	162,487,178 - 162,666,666 (-)	NCBI		T2T-CHM13v2.0

Rgs5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	169,483,070 - 169,523,382 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	169,483,070 - 169,523,382 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	169,655,501 - 169,695,813 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	169,655,501 - 169,695,813 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	171,585,632 - 171,623,657 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	171,492,176 - 171,530,201 (+)	NCBI		MGSCv36	mm8
Celera	1	172,079,009 - 172,116,960 (+)	NCBI		Celera
Cytogenetic Map	1	H2.3	NCBI
cM Map	1	76.84	NCBI

Rgs5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955462	13,228,002 - 13,283,034 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955462	13,228,110 - 13,288,063 (+)	NCBI	ChiLan1.0	ChiLan1.0

RGS5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	1	142,357,626 - 142,418,583 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	142,362,663 - 142,387,291 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	1	138,561,940 - 138,622,698 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

RGS5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	38	19,683,396 - 19,730,514 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	38	19,683,485 - 19,725,778 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	38	19,739,840 - 19,786,792 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	38	19,767,480 - 19,814,881 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	38	19,767,312 - 19,812,214 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	38	19,742,970 - 19,790,108 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	38	20,094,362 - 20,141,746 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	38	20,385,842 - 20,433,074 (+)	NCBI		UU_Cfam_GSD_1.0

Rgs5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409344	103,574,526 - 103,636,359 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936481	21,421,277 - 21,483,132 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936481	21,421,319 - 21,483,108 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RGS5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	87,286,953 - 87,342,088 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	87,286,953 - 87,340,816 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	94,999,826 - 95,053,683 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RGS5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	25	65,608,384 - 65,667,811 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	25	65,608,303 - 65,662,772 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666055	67,398,522 - 67,458,157 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rgs5
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624826	1,648,891 - 1,699,353 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624826	1,644,874 - 1,698,855 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rgs5
166 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	86
Count of miRNA genes:	74
Interacting mature miRNAs:	80
Transcripts:	ENSRNOT00000003705
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	1	101056920	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	1	101056920	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	101056920	Rat
1581570	Eae17	Experimental allergic encephalomyelitis QTL 17	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	13	8897350	101631289	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	20605871	101339738	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	30395351	101056920	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	31241331	93395974	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	31241331	93395974	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	31241331	93395974	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	31241331	93395974	Rat
12879477	Bp401	Blood pressure QTL 401			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	37262092	82262092	Rat
61349	Bp31	Blood pressure QTL 31	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	37374509	82374509	Rat
70220	Bp55	Blood pressure QTL 55	5.75		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	13	37374509	82374509	Rat
1331750	Bp220	Blood pressure QTL 220	2.98		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	37415584	82415584	Rat
1549897	Stresp12	Stress response QTL 12	3.35		stress-related behavior trait (VT:0010451)	number of approaches toward negative stimulus before onset of defensive burying response (CMO:0001960)	13	38433408	83433408	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	39754544	84754544	Rat
12879444	Bp397	Blood pressure QTL 397			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45049404	90049404	Rat
12879471	Bp398	Blood pressure QTL 398			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45514719	90514719	Rat
12879441	Bp396	Blood pressure QTL 396			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45699983	90699983	Rat
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	46088046	91088046	Rat
71119	Thym2	Thymus enlargement QTL 2	3.8		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	13	46197976	84753113	Rat
1641901	Alcrsp6	Alcohol response QTL 6			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	13	52362171	97362171	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	56056920	101056920	Rat
738026	Lnnr5	Liver neoplastic nodule remodeling QTL 5	3.29		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	59874408	85581182	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	61825626	106807694	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	65103704	106807694	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	65103704	106807694	Rat
8655945	Rf61	Renal function QTL 61	3.6		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	13	69060519	86800898	Rat
1331783	Bp221	Blood pressure QTL 221	3.72886		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	69060519	86800898	Rat
1300166	Kidm6	Kidney mass QTL 6	3.93		kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	13	69060519	86800898	Rat
8655959	Pur32	Proteinuria QTL 32	8.4		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	74023918	97213863	Rat
738027	Lnnr6	Liver neoplastic nodule remodeling QTL 6	3.3		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	74862117	85581182	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	74862117	101339893	Rat
4889606	Gluco63	Glucose level QTL 63	2.86	0.003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	80753256	106807694	Rat

Markers in Region

AA817884

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	81,884,990 - 81,885,208 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	88,002,769 - 88,002,986	NCBI	Rnor6.0
Rnor_5.0	13	92,631,295 - 92,631,512	UniSTS	Rnor5.0
RGSC_v3.4	13	85,482,232 - 85,482,449	UniSTS	RGSC3.4
Celera	13	81,550,568 - 81,550,785	UniSTS
RH 3.4 Map	13	514.8	UniSTS
Cytogenetic Map	13	q24	UniSTS

UniSTS:495957

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	81,883,212 - 81,883,305 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	88,000,991 - 88,001,083	NCBI	Rnor6.0
Rnor_5.0	13	92,629,517 - 92,629,609	UniSTS	Rnor5.0
RGSC_v3.4	13	85,480,455 - 85,480,545	UniSTS	RGSC3.4
Celera	13	81,548,790 - 81,548,882	UniSTS
Cytogenetic Map	13	q24	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	27	11	19	11	8	11	68	35	35	11	8
Low			30	30		30			6		6
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019341	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF241259	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473958	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	EF568934	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ234716	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000244	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U32435	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000003705 ⟹ ENSRNOP00000003705

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	81,836,304 - 81,885,518 (+)	Ensembl
Rnor_6.0 Ensembl	13	87,986,240 - 88,002,831 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000079593 ⟹ ENSRNOP00000069463

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	81,848,137 - 81,885,518 (+)	Ensembl
Rnor_6.0 Ensembl	13	87,966,758 - 88,003,035 (+)	Ensembl

RefSeq Acc Id:

NM_019341 ⟹ NP_062214

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	13	81,848,254 - 81,885,053 (+)	NCBI
Rnor_6.0	13	87,966,820 - 88,002,831 (+)	NCBI
Rnor_5.0	13	92,595,346 - 92,631,357 (+)	NCBI
RGSC_v3.4	13	85,445,325 - 85,482,294 (+)	RGD
Celera	13	81,513,956 - 81,550,630 (+)	RGD

Sequence:

show sequence

ATGTGTAAGGGACTGGCAGCTCTGCCACACTCATGCCTGGAAAGGGCCAAAGAGATCAAGATCA
AATTGGGTATTCTTCTCCAGAAGCCAGACTCTGCTGTTGACCTTGTCATTCCATATAATGAGAA
GCCAGAGAAGCCTGCCAAGGCGCACAAGCCCTCGCTGGAGGAGGTCCTGCAATGGCGCCAATCC
CTGGACAAACTTCTCCAGAGCAACTACGGATTTGCCAGCTTCAAAAGTTTCCTGAAGTCTGAAT
TCAGTGAGGAAAACCTTGAGTTCTGGGTTGCCTGTGAGAATTACAAGAAGATCAAGTCCCCCAT
CAAAATGGCAGAGAAGGCAAAGCAAATCTATGAAGAATTCATCCAGACAGAGGCCCCTAAAGAG
GTGAACATTGACCACTTCACTAAAGACATCACCATGAAGAACCTGGTGGAACCTTCCCCTCACA
GCTTTGACCTGGCCCAGAAAAGGATCTACGCCCTGATGGAGAAGGATTCTCTGCCCCGCTTCGT
GCGCTCTGAGTTTTATAAGGAGTTAATCAACTAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_062214	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC52372	(Get FASTA)	NCBI Sequence Viewer
	AAF73424	(Get FASTA)	NCBI Sequence Viewer
	ABQ63081	(Get FASTA)	NCBI Sequence Viewer
	EDM09269	(Get FASTA)	NCBI Sequence Viewer
	EDM09270	(Get FASTA)	NCBI Sequence Viewer
	P49800	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_062214 ⟸ NM_019341
- UniProtKB:	Q9JKD7 (UniProtKB/Swiss-Prot), P49800 (UniProtKB/Swiss-Prot), A5YN34 (UniProtKB/TrEMBL)
- Sequence:	show sequence MCKGLAALPHSCLERAKEIKIKLGILLQKPDSAVDLVIPYNEKPEKPAKAHKPSLEEVLQWRQS LDKLLQSNYGFASFKSFLKSEFSEENLEFWVACENYKKIKSPIKMAEKAKQIYEEFIQTEAPKE VNIDHFTKDITMKNLVEPSPHSFDLAQKRIYALMEKDSLPRFVRSEFYKELIN hide sequence

RefSeq Acc Id:

ENSRNOP00000069463 ⟸ ENSRNOT00000079593

RefSeq Acc Id:

ENSRNOP00000003705 ⟸ ENSRNOT00000003705

Protein Domains

RGS

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P49800-F1-model_v2	AlphaFold	P49800	1-181	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13698979

Promoter ID:

EPDNEW_R9504

Type:

multiple initiation site

Name:

Rgs5_1

Description:

regulator of G-protein signaling 5

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	13	87,966,734 - 87,966,794	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3568	AgrOrtholog
BioCyc Gene	G2FUF-17492	BioCyc
Ensembl Genes	ENSRNOG00000002730	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000003705.7	UniProtKB/TrEMBL
	ENSRNOP00000069463	ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000003705.7	UniProtKB/TrEMBL
	ENSRNOT00000079593	ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Gene3D-CATH	1.10.167.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	1.10.196.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	RGS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RGS5	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RGS_RGS5	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RGS_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RGS_subdom1/3	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	RGS_subdomain_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:54294	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	54294	ENTREZGENE
PANTHER	PTHR10845:SF42	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	RGS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Rgs5	PhenoGen
PRINTS	RGSPROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	RGS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	RGS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF48097	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2JVF3_RAT	UniProtKB/TrEMBL
	A5YN34	ENTREZGENE, UniProtKB/TrEMBL
	F1LP00_RAT	UniProtKB/TrEMBL
	P49800	ENTREZGENE
	Q9JKD7	ENTREZGENE
	RGS5_RAT	UniProtKB/Swiss-Prot
UniProt Secondary	Q9JKD7	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Rgs5	regulator of G-protein signaling 5			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_function	binds directly to the activated Ga subunits and promotes GTP hydrolysis	625585
gene_process	serves as a GTPase-activating protein (GAP) and inhibits G protein signaling; inhibits angiotensin AT1a receptor signaling through Gq/11	625585

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations