Advanced Search (OLGA)

Gene: Pgm1 (phosphoglucomutase 1) Rattus norvegicus

Analyze

Symbol:

Pgm1

Name:

phosphoglucomutase 1

RGD ID:

3316

Description:

Enables phosphoglucomutase activity. Involved in cellular response to magnetism and glucose metabolic process. Located in Z disc. Human ortholog(s) of this gene implicated in congenital disorder of glycosylation It; endometrial cancer; and teratoma. Orthologous to human PGM1 (phosphoglucomutase 1); PARTICIPATES IN congenital sucrase-isomaltase deficiency pathway; fructose-1,6-bisphosphatase deficiency pathway; galactokinase deficiency pathway; INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2-methoxyethanol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

glucose phosphomutase 1; PGM 1; phosphoglucomutase-1

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PGM1 (phosphoglucomutase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OrthoDB, OrthoMCL, Panther
Mus musculus (house mouse):	Pgm1 (phosphoglucomutase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pgm1 (phosphoglucomutase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PGM1 (phosphoglucomutase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PGM1 (phosphoglucomutase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pgm1 (phosphoglucomutase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PGM1 (phosphoglucomutase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PGM1 (phosphoglucomutase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pgm1 (phosphoglucomutase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Pgm1 (phosphoglucomutase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	PGM1 (phosphoglucomutase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	pgm1 (phosphoglucomutase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	R05F9.6	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PGM1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	PGM2	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Pgm1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	pgm1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	119,710,734 - 119,770,159 (+)	NCBI		GRCr8
mRatBN7.2	5	114,595,298 - 114,654,728 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	114,595,293 - 114,654,728 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	117,151,682 - 117,211,109 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	118,877,005 - 118,936,428 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	118,939,539 - 118,998,971 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	118,743,632 - 118,803,055 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	118,743,632 - 118,803,055 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	122,648,579 - 122,708,212 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	120,595,650 - 120,655,915 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	113,142,712 - 113,202,105 (+)	NCBI		Celera
RH 3.4 Map	5		RGD
Cytogenetic Map	5	q33	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pgm1	Rat	endometrial cancer		ISO	RGD:734179	2299870		RGD
Pgm1	Rat	teratoma		ISO	RGD:734179	2299871		RGD

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pgm1	Rat	congenital disorder of glycosylation		ISO	RGD:734179	8554872	ClinVar Annotator: match by term: Congenital disorder of glycosylation \| ClinVar Annotator: match by term: more ...	ClinVar	PMID:25741868\|PMID:28492532\|PMID:33342467
Pgm1	Rat	congenital disorder of glycosylation It		ISO	RGD:734179	8554872	ClinVar Annotator: match by term: Congenital disorder of glycosylation type 1t \| ClinVar Annotator: match more ...	ClinVar	PMID:16199547\|PMID:17576681\|PMID:19625727\|PMID:22492991\|PMID:22976764\|PMID:24499211\|PMID:25288802\|PMID:25741868\|PMID:26768186\|PMID:27206562\|PMID:28117557\|PMID:28492532\|PMID:28617415\|PMID:28820871\|PMID:29858906\|PMID:30122451\|PMID:33342467\|PMID:33413482\|PMID:33473337\|PMID:34782754\|PMID:9536098
Pgm1	Rat	Craniosynostosis Syndrome, Autosomal Recessive		ISO	RGD:734179	8554872	ClinVar Annotator: match by term: Craniosynostosis syndrome	ClinVar	PMID:25741868
Pgm1	Rat	genetic disease		ISO	RGD:734179	8554872	ClinVar Annotator: match by term: Inborn genetic diseases	ClinVar	PMID:24499211\|PMID:25741868\|PMID:28117557\|PMID:28492532\|PMID:30122451
Pgm1	Rat	intellectual disability		ISO	RGD:734179	8554872	ClinVar Annotator: match by term: Intellectual disability, severe	ClinVar	PMID:25741868

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pgm1	Rat	Chemical and Drug Induced Liver Injury		ISO	RGD:734179	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:25231249
Pgm1	Rat	Colorectal Neoplasms		ISO	RGD:734179	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:25944804
Pgm1	Rat	congenital disorder of glycosylation It		ISO	RGD:734179	11554173	CTD Direct Evidence: marker/mechanism	CTD
Pgm1	Rat	Myocardial Ischemia		ISO	RGD:734179	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:16214533

Imported Disease Annotations - OMIM

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pgm1	Rat	congenital disorder of glycosylation It		ISO	RGD:734179	7240710		OMIM

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pgm1	Rat	(-)-demecolcine	decreases expression	ISO	RGD:734179	6480464	Demecolcine results in decreased expression of PGM1 mRNA	CTD	PMID:23649840
Pgm1	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	RGD:11091	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PGM1 mRNA	CTD	PMID:36331819
Pgm1	Rat	1,2-dimethylhydrazine	decreases expression	ISO	RGD:11091	6480464	1,2-Dimethylhydrazine results in decreased expression of PGM1 mRNA	CTD	PMID:22206623
Pgm1	Rat	17alpha-ethynylestradiol	increases expression	ISO	RGD:11091	6480464	Ethinyl Estradiol results in increased expression of PGM1 mRNA	CTD	PMID:17942748
Pgm1	Rat	17alpha-ethynylestradiol	multiple interactions	ISO	RGD:11091	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PGM1 mRNA	CTD	PMID:17942748
Pgm1	Rat	17beta-estradiol	decreases expression	EXP		6480464	Estradiol results in decreased expression of PGM1 protein	CTD	PMID:32145629
Pgm1	Rat	17beta-estradiol	decreases expression	ISO	RGD:11091	6480464	Estradiol results in decreased expression of PGM1 mRNA	CTD	PMID:39298647
Pgm1	Rat	1H-pyrazole	increases expression	ISO	RGD:11091	6480464	pyrazole results in increased expression of PGM1 mRNA	CTD	PMID:17945193
Pgm1	Rat	2,2',4,4'-Tetrabromodiphenyl ether	affects expression	ISO	RGD:11091	6480464	2,2',4,4'-tetrabromodiphenyl ether affects the expression of PGM1 mRNA	CTD	PMID:30294300
Pgm1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:11091	6480464	[Tetrachlorodibenzodioxin co-treated with Ethinyl Estradiol] results in increased expression of PGM1 mRNA	CTD	PMID:17942748
Pgm1	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:11091	6480464	Tetrachlorodibenzodioxin results in increased expression of PGM1 mRNA	CTD	PMID:27562557
Pgm1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:734179	6480464	Tetrachlorodibenzodioxin results in decreased expression of PGM1 mRNA	CTD	PMID:23152189
Pgm1	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:734179	6480464	2-methyl-2H-pyrazole-3-carboxylic acid (2-methyl-4-o-tolylazophenyl)amide inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of PGM1 mRNA]; alpha-naphthoflavone more ...	CTD	PMID:23152189
Pgm1	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	EXP		6480464	Tetrachlorodibenzodioxin affects the expression of PGM1 mRNA	CTD	PMID:22298810
Pgm1	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	EXP		6480464	Tetrachlorodibenzodioxin results in decreased expression of PGM1 mRNA	CTD	PMID:18796159\|PMID:21215274\|PMID:32109520
Pgm1	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	RGD:11091	6480464	2,2',4,4',5-brominated diphenyl ether affects the expression of PGM1 mRNA	CTD	PMID:38648751
Pgm1	Rat	2,6-dimethoxyphenol	multiple interactions	ISO	RGD:734179	6480464	[pyrogallol 1,3-dimethyl ether co-treated with Furaldehyde] results in increased expression of and affects the localization more ...	CTD	PMID:38598786
Pgm1	Rat	2-hydroxypropanoic acid	decreases expression	ISO	RGD:734179	6480464	Lactic Acid results in decreased expression of PGM1 mRNA	CTD	PMID:30851411
Pgm1	Rat	2-methoxyethanol	decreases expression	EXP		6480464	methyl cellosolve results in decreased expression of PGM1 protein	CTD	PMID:15928459
Pgm1	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:11091	6480464	bisphenol S results in increased expression of PGM1 mRNA	CTD	PMID:39298647
Pgm1	Rat	4,4'-sulfonyldiphenol	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:36041667
Pgm1	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:734179	6480464	bisphenol S results in increased expression of PGM1 protein	CTD	PMID:34186270
Pgm1	Rat	4-hydroxyphenyl retinamide	decreases expression	ISO	RGD:11091	6480464	Fenretinide results in decreased expression of PGM1 mRNA	CTD	PMID:28973697
Pgm1	Rat	6-propyl-2-thiouracil	decreases expression	EXP		6480464	Propylthiouracil results in decreased expression of PGM1 mRNA	CTD	PMID:36843608
Pgm1	Rat	acrylamide	increases expression	EXP		6480464	Acrylamide results in increased expression of PGM1 mRNA	CTD	PMID:28959563
Pgm1	Rat	acrylamide	decreases expression	ISO	RGD:734179	6480464	Acrylamide results in decreased expression of PGM1 mRNA	CTD	PMID:32763439
Pgm1	Rat	aflatoxin B1	decreases expression	ISO	RGD:734179	6480464	Aflatoxin B1 results in decreased expression of PGM1 mRNA	CTD	PMID:27153756
Pgm1	Rat	all-trans-retinoic acid	increases expression	ISO	RGD:734179	6480464	Tretinoin results in increased expression of PGM1 mRNA	CTD	PMID:21934132\|PMID:33167477
Pgm1	Rat	alpha-naphthoflavone	increases expression	ISO	RGD:734179	6480464	alpha-naphthoflavone results in increased expression of PGM1 mRNA	CTD	PMID:23152189
Pgm1	Rat	alpha-naphthoflavone	multiple interactions	ISO	RGD:734179	6480464	alpha-naphthoflavone inhibits the reaction [Tetrachlorodibenzodioxin results in decreased expression of PGM1 mRNA]	CTD	PMID:23152189
Pgm1	Rat	alpha-Zearalanol	decreases expression	EXP		6480464	Zeranol results in decreased expression of PGM1 mRNA	CTD	PMID:35163327
Pgm1	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PGM1 mRNA	CTD	PMID:35163327
Pgm1	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of PGM1 mRNA	CTD	PMID:16483693
Pgm1	Rat	arsenous acid	increases expression	ISO	RGD:734179	6480464	Arsenic Trioxide results in increased expression of PGM1 mRNA; Arsenic Trioxide results in increased expression more ...	CTD	PMID:20458559\|PMID:25419056
Pgm1	Rat	arsenous acid	decreases expression	ISO	RGD:734179	6480464	Arsenic Trioxide results in decreased expression of PGM1 mRNA; Arsenic Trioxide results in decreased expression more ...	CTD	PMID:38160894
Pgm1	Rat	arsenous acid	multiple interactions	ISO	RGD:734179	6480464	[Ascorbic Acid co-treated with Arsenic Trioxide] results in decreased expression of PGM1 protein; Arsenic Trioxide more ...	CTD	PMID:26598702\|PMID:38160894
Pgm1	Rat	atrazine	affects methylation	EXP		6480464	Atrazine affects the methylation of PGM1 gene	CTD	PMID:35440735
Pgm1	Rat	Azoxymethane	multiple interactions	ISO	RGD:11091	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PGM1 more ...	CTD	PMID:29950665
Pgm1	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:734179	6480464	Benzo(a)pyrene affects the methylation of PGM1 promoter	CTD	PMID:27901495
Pgm1	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:734179	6480464	Benzo(a)pyrene results in decreased expression of PGM1 mRNA	CTD	PMID:32234424
Pgm1	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	RGD:11091	6480464	Diethylhexyl Phthalate results in decreased expression of PGM1 mRNA	CTD	PMID:34319233
Pgm1	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of PGM1 mRNA	CTD	PMID:25181051
Pgm1	Rat	bisphenol A	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:36041667
Pgm1	Rat	bisphenol A	decreases expression	ISO	RGD:734179	6480464	bisphenol A results in decreased expression of PGM1 protein	CTD	PMID:34186270
Pgm1	Rat	bisphenol A	affects expression	ISO	RGD:734179	6480464	bisphenol A affects the expression of PGM1 mRNA	CTD	PMID:30903817
Pgm1	Rat	bisphenol A	increases expression	ISO	RGD:734179	6480464	bisphenol A results in increased expression of PGM1 mRNA; bisphenol A results in increased expression more ...	CTD	PMID:29275510\|PMID:37567409
Pgm1	Rat	bisphenol AF	increases expression	ISO	RGD:734179	6480464	bisphenol AF results in increased expression of PGM1 protein	CTD	PMID:34186270
Pgm1	Rat	Bisphenol B	increases expression	ISO	RGD:734179	6480464	bisphenol B results in increased expression of PGM1 protein	CTD	PMID:34186270
Pgm1	Rat	bisphenol F	increases expression	ISO	RGD:11091	6480464	bisphenol F results in increased expression of PGM1 mRNA	CTD	PMID:38685157
Pgm1	Rat	bisphenol F	increases expression	ISO	RGD:734179	6480464	bisphenol F results in increased expression of PGM1 protein	CTD	PMID:34186270
Pgm1	Rat	bisphenol F	multiple interactions	EXP		6480464	[bisphenol A co-treated with bisphenol F co-treated with bisphenol S] results in increased expression of more ...	CTD	PMID:36041667
Pgm1	Rat	Brodifacoum	increases expression	EXP		6480464	bromfenacoum results in increased expression of PGM1 protein	CTD	PMID:28903499
Pgm1	Rat	cadmium dichloride	increases expression	EXP		6480464	Cadmium Chloride results in increased expression of PGM1 mRNA	CTD	PMID:33453195
Pgm1	Rat	cadmium dichloride	decreases expression	ISO	RGD:734179	6480464	Cadmium Chloride results in decreased expression of PGM1 mRNA	CTD	PMID:38568856
Pgm1	Rat	caffeine	decreases phosphorylation	ISO	RGD:734179	6480464	Caffeine results in decreased phosphorylation of PGM1 protein	CTD	PMID:35688186
Pgm1	Rat	capsaicin	increases expression	ISO	RGD:734179	6480464	Capsaicin results in increased expression of PGM1 mRNA; Capsaicin results in increased expression of PGM1 more ...	CTD	PMID:19891501
Pgm1	Rat	capsaicin	decreases expression	EXP		6480464	Capsaicin results in decreased expression of PGM1 mRNA	CTD	PMID:20349343
Pgm1	Rat	carbon nanotube	increases expression	ISO	RGD:11091	6480464	Nanotubes, Carbon analog results in increased expression of PGM1 mRNA; Nanotubes, Carbon results in increased more ...	CTD	PMID:25554681
Pgm1	Rat	CGP 52608	multiple interactions	ISO	RGD:734179	6480464	CGP 52608 promotes the reaction [RORA protein binds to PGM1 gene]	CTD	PMID:28238834
Pgm1	Rat	chloropicrin	decreases expression	ISO	RGD:734179	6480464	chloropicrin results in decreased expression of PGM1 mRNA	CTD	PMID:26352163
Pgm1	Rat	clofibric acid	affects expression	EXP		6480464	Clofibric Acid affects the expression of PGM1 mRNA	CTD	PMID:17602206
Pgm1	Rat	cobalt dichloride	multiple interactions	ISO	RGD:734179	6480464	zinc chloride inhibits the reaction [cobaltous chloride results in increased expression of PGM1 mRNA]	CTD	PMID:22202117
Pgm1	Rat	cobalt dichloride	increases expression	ISO	RGD:734179	6480464	cobaltous chloride results in increased expression of PGM1 mRNA	CTD	PMID:22202117
Pgm1	Rat	cobalt dichloride	increases expression	EXP		6480464	cobaltous chloride results in increased expression of PGM1 mRNA	CTD	PMID:24386269
Pgm1	Rat	coumarin	increases phosphorylation	ISO	RGD:734179	6480464	coumarin results in increased phosphorylation of PGM1 protein	CTD	PMID:35688186
Pgm1	Rat	cyclosporin A	decreases expression	ISO	RGD:734179	6480464	Cyclosporine results in decreased expression of PGM1 mRNA	CTD	PMID:20106945\|PMID:21632981\|PMID:25562108
Pgm1	Rat	deguelin	increases expression	ISO	RGD:734179	6480464	deguelin results in increased expression of PGM1 mRNA	CTD	PMID:33512557
Pgm1	Rat	dexamethasone	decreases expression	ISO	RGD:11091	6480464	Dexamethasone results in decreased expression of PGM1 protein	CTD	PMID:33567340
Pgm1	Rat	dextran sulfate	multiple interactions	ISO	RGD:11091	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PGM1 more ...	CTD	PMID:29950665
Pgm1	Rat	diarsenic trioxide	increases expression	ISO	RGD:734179	6480464	Arsenic Trioxide results in increased expression of PGM1 mRNA; Arsenic Trioxide results in increased expression more ...	CTD	PMID:20458559\|PMID:25419056
Pgm1	Rat	diarsenic trioxide	decreases expression	ISO	RGD:734179	6480464	Arsenic Trioxide results in decreased expression of PGM1 mRNA; Arsenic Trioxide results in decreased expression more ...	CTD	PMID:38160894
Pgm1	Rat	diarsenic trioxide	multiple interactions	ISO	RGD:734179	6480464	[Ascorbic Acid co-treated with Arsenic Trioxide] results in decreased expression of PGM1 protein; Arsenic Trioxide more ...	CTD	PMID:26598702\|PMID:38160894
Pgm1	Rat	dibutyl phthalate	decreases expression	EXP		6480464	Dibutyl Phthalate results in decreased expression of PGM1 mRNA	CTD	PMID:21266533
Pgm1	Rat	dinophysistoxin 1	decreases expression	ISO	RGD:734179	6480464	dinophysistoxin 1 results in decreased expression of PGM1 mRNA	CTD	PMID:28939011
Pgm1	Rat	dioxygen	increases expression	ISO	RGD:734179	6480464	Oxygen deficiency results in increased expression of PGM1 mRNA	CTD	PMID:24236059\|PMID:26516004
Pgm1	Rat	dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate	increases expression	ISO	RGD:734179	6480464	Antimony Potassium Tartrate results in increased expression of PGM1 mRNA	CTD	PMID:28713220
Pgm1	Rat	disodium selenite	increases expression	ISO	RGD:734179	6480464	Sodium Selenite results in increased expression of PGM1 mRNA	CTD	PMID:18175754
Pgm1	Rat	diuron	decreases expression	EXP		6480464	Diuron results in decreased expression of PGM1 mRNA	CTD	PMID:25152437
Pgm1	Rat	dorsomorphin	multiple interactions	ISO	RGD:734179	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Pgm1	Rat	doxorubicin	increases expression	ISO	RGD:734179	6480464	Doxorubicin results in increased expression of PGM1 mRNA	CTD	PMID:29803840
Pgm1	Rat	entinostat	increases expression	ISO	RGD:734179	6480464	entinostat results in increased expression of PGM1 mRNA	CTD	PMID:26272509
Pgm1	Rat	entinostat	multiple interactions	ISO	RGD:734179	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Pgm1	Rat	ethanol	affects splicing	ISO	RGD:11091	6480464	Ethanol affects the splicing of PGM1 mRNA	CTD	PMID:30319688
Pgm1	Rat	ethyl methanesulfonate	decreases expression	ISO	RGD:734179	6480464	Ethyl Methanesulfonate results in decreased expression of PGM1 mRNA	CTD	PMID:23649840
Pgm1	Rat	fenofibrate	increases expression	ISO	RGD:734179	6480464	Fenofibrate results in increased expression of PGM1 mRNA	CTD	PMID:24752549
Pgm1	Rat	folic acid	decreases expression	ISO	RGD:11091	6480464	Folic Acid results in decreased expression of PGM1 mRNA	CTD	PMID:25629700
Pgm1	Rat	fonofos	increases methylation	ISO	RGD:734179	6480464	Fonofos results in increased methylation of PGM1 promoter	CTD	PMID:22847954
Pgm1	Rat	formaldehyde	decreases expression	ISO	RGD:734179	6480464	Formaldehyde results in decreased expression of PGM1 mRNA	CTD	PMID:23649840
Pgm1	Rat	FR900359	increases phosphorylation	ISO	RGD:734179	6480464	FR900359 results in increased phosphorylation of PGM1 protein	CTD	PMID:37730182
Pgm1	Rat	furfural	multiple interactions	ISO	RGD:734179	6480464	[pyrogallol 1,3-dimethyl ether co-treated with Furaldehyde] results in increased expression of and affects the localization more ...	CTD	PMID:38598786
Pgm1	Rat	gentamycin	decreases expression	EXP		6480464	Gentamicins results in decreased expression of PGM1 protein	CTD	PMID:22061828
Pgm1	Rat	hydralazine	multiple interactions	ISO	RGD:734179	6480464	[Hydralazine co-treated with Valproic Acid] results in increased expression of PGM1 mRNA	CTD	PMID:17183730
Pgm1	Rat	inulin	multiple interactions	ISO	RGD:11091	6480464	[perfluorooctane sulfonic acid co-treated with Inulin] results in decreased expression of PGM1 mRNA	CTD	PMID:36331819
Pgm1	Rat	isotretinoin	decreases expression	ISO	RGD:734179	6480464	Isotretinoin results in decreased expression of PGM1 mRNA	CTD	PMID:20436886
Pgm1	Rat	ivermectin	decreases expression	ISO	RGD:734179	6480464	Ivermectin results in decreased expression of PGM1 protein	CTD	PMID:32959892
Pgm1	Rat	L-ascorbic acid	decreases expression	ISO	RGD:734179	6480464	Ascorbic Acid results in decreased expression of PGM1 mRNA; Ascorbic Acid results in decreased expression more ...	CTD	PMID:38160894
Pgm1	Rat	L-ascorbic acid	multiple interactions	ISO	RGD:734179	6480464	[Ascorbic Acid co-treated with Arsenic Trioxide] results in decreased expression of PGM1 protein; Arsenic Trioxide more ...	CTD	PMID:38160894
Pgm1	Rat	lactucin	affects binding	ISO	RGD:734179	6480464	lactucin binds to PGM1 protein	CTD	PMID:36364182
Pgm1	Rat	lead(0)	affects expression	ISO	RGD:734179	6480464	Lead affects the expression of PGM1 mRNA	CTD	PMID:28903495
Pgm1	Rat	linalool	increases expression	ISO	RGD:734179	6480464	linalool results in increased expression of PGM1 mRNA	CTD	PMID:24752549
Pgm1	Rat	methidathion	decreases expression	ISO	RGD:11091	6480464	methidathion results in decreased expression of PGM1 mRNA	CTD	PMID:34813904
Pgm1	Rat	methoxychlor	affects methylation	EXP		6480464	Methoxychlor affects the methylation of PGM1 gene	CTD	PMID:35440735
Pgm1	Rat	methyl methanesulfonate	decreases expression	ISO	RGD:734179	6480464	Methyl Methanesulfonate results in decreased expression of PGM1 mRNA	CTD	PMID:23649840
Pgm1	Rat	methylmercury chloride	decreases expression	ISO	RGD:734179	6480464	methylmercuric chloride results in decreased expression of PGM1 mRNA	CTD	PMID:23179753\|PMID:27188386
Pgm1	Rat	N-nitrosodiethylamine	increases expression	ISO	RGD:11091	6480464	Diethylnitrosamine results in increased expression of PGM1 mRNA	CTD	PMID:24535843
Pgm1	Rat	N-nitrosomorpholine	affects expression	EXP		6480464	N-nitrosomorpholine affects the expression of PGM1 protein	CTD	PMID:19716841
Pgm1	Rat	nickel dichloride	affects expression	EXP		6480464	nickel chloride affects the expression of PGM1 mRNA	CTD	PMID:22110744
Pgm1	Rat	nickel sulfate	decreases expression	ISO	RGD:734179	6480464	nickel sulfate results in decreased expression of PGM1 mRNA	CTD	PMID:22714537
Pgm1	Rat	obeticholic acid	decreases expression	ISO	RGD:734179	6480464	obeticholic acid results in decreased expression of PGM1 mRNA	CTD	PMID:27939613
Pgm1	Rat	okadaic acid	decreases expression	ISO	RGD:734179	6480464	Okadaic Acid results in decreased expression of PGM1 mRNA; Okadaic Acid results in decreased expression more ...	CTD	PMID:38832940
Pgm1	Rat	ozone	multiple interactions	ISO	RGD:11091	6480464	[Air Pollutants results in increased abundance of Ozone] which results in increased expression of PGM1 more ...	CTD	PMID:34911549
Pgm1	Rat	panobinostat	multiple interactions	ISO	RGD:734179	6480464	[NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Pgm1	Rat	panobinostat	increases expression	ISO	RGD:734179	6480464	panobinostat results in increased expression of PGM1 mRNA	CTD	PMID:26272509
Pgm1	Rat	paracetamol	affects expression	ISO	RGD:11091	6480464	Acetaminophen affects the expression of PGM1 mRNA	CTD	PMID:17562736
Pgm1	Rat	paracetamol	decreases expression	ISO	RGD:734179	6480464	Acetaminophen results in decreased expression of PGM1 mRNA	CTD	PMID:21420995
Pgm1	Rat	parathion	increases methylation	ISO	RGD:734179	6480464	Parathion results in increased methylation of PGM1 promoter	CTD	PMID:22847954
Pgm1	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:11091	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of PGM1 mRNA; [perfluorooctane sulfonic more ...	CTD	PMID:36331819
Pgm1	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in decreased expression of PGM1 mRNA	CTD	PMID:35163327
Pgm1	Rat	perfluorooctanoic acid	increases expression	ISO	RGD:11091	6480464	perfluorooctanoic acid results in increased expression of PGM1 protein	CTD	PMID:37422089
Pgm1	Rat	phenobarbital	decreases expression	ISO	RGD:734179	6480464	Phenobarbital results in decreased expression of PGM1 protein	CTD	PMID:35881160
Pgm1	Rat	phenobarbital	affects expression	ISO	RGD:11091	6480464	Phenobarbital affects the expression of PGM1 protein	CTD	PMID:35881160
Pgm1	Rat	picoxystrobin	increases expression	ISO	RGD:734179	6480464	picoxystrobin results in increased expression of PGM1 mRNA	CTD	PMID:33512557
Pgm1	Rat	propiconazole	increases expression	ISO	RGD:11091	6480464	propiconazole results in increased expression of PGM1 mRNA	CTD	PMID:21278054
Pgm1	Rat	Propiverine	affects binding	EXP		6480464	propiverine binds to PGM1 protein	CTD	PMID:29273565
Pgm1	Rat	prostaglandin A1	increases metabolic processing	ISO	RGD:11091	6480464	prostaglandin A1 analog results in increased metabolism of PGM1 protein	CTD	PMID:19800325
Pgm1	Rat	quercetin	decreases expression	ISO	RGD:734179	6480464	Quercetin results in decreased expression of PGM1 mRNA	CTD	PMID:21632981
Pgm1	Rat	rac-lactic acid	decreases expression	ISO	RGD:734179	6480464	Lactic Acid results in decreased expression of PGM1 mRNA	CTD	PMID:30851411
Pgm1	Rat	rotenone	increases expression	ISO	RGD:734179	6480464	Rotenone results in increased expression of PGM1 mRNA	CTD	PMID:29955902\|PMID:33512557
Pgm1	Rat	rotenone	increases expression	EXP		6480464	Rotenone results in increased expression of PGM1 protein	CTD	PMID:35544339
Pgm1	Rat	SB 431542	multiple interactions	ISO	RGD:734179	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Pgm1	Rat	sodium arsenite	increases expression	ISO	RGD:734179	6480464	sodium arsenite results in increased expression of PGM1 mRNA	CTD	PMID:23648393\|PMID:28713220
Pgm1	Rat	sodium arsenite	decreases expression	ISO	RGD:734179	6480464	sodium arsenite results in decreased expression of PGM1 mRNA	CTD	PMID:38568856
Pgm1	Rat	sodium arsenite	increases expression	EXP		6480464	sodium arsenite results in increased expression of PGM1 protein	CTD	PMID:29459688
Pgm1	Rat	sodium chloride	multiple interactions	ISO	RGD:734179	6480464	[Sodium Chloride co-treated with Furaldehyde] results in increased expression of and affects the localization of more ...	CTD	PMID:38598786
Pgm1	Rat	tamoxifen	increases expression	ISO	RGD:11091	6480464	Tamoxifen results in increased expression of PGM1 mRNA	CTD	PMID:25123088
Pgm1	Rat	terbufos	increases methylation	ISO	RGD:734179	6480464	terbufos results in increased methylation of PGM1 promoter	CTD	PMID:22847954
Pgm1	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of PGM1 mRNA	CTD	PMID:31150632
Pgm1	Rat	tetrachloromethane	decreases expression	ISO	RGD:11091	6480464	Carbon Tetrachloride results in decreased expression of PGM1 mRNA	CTD	PMID:31919559
Pgm1	Rat	thimerosal	decreases expression	ISO	RGD:734179	6480464	Thimerosal results in decreased expression of PGM1 mRNA	CTD	PMID:27188386
Pgm1	Rat	thioacetamide	decreases expression	EXP		6480464	Thioacetamide results in decreased expression of PGM1 mRNA	CTD	PMID:34492290
Pgm1	Rat	thiram	decreases expression	ISO	RGD:734179	6480464	Thiram results in decreased expression of PGM1 mRNA	CTD	PMID:38568856
Pgm1	Rat	titanium dioxide	decreases expression	ISO	RGD:11091	6480464	titanium dioxide results in decreased expression of PGM1 mRNA	CTD	PMID:29264374
Pgm1	Rat	titanium dioxide	increases methylation	ISO	RGD:11091	6480464	titanium dioxide results in increased methylation of PGM1 gene	CTD	PMID:35295148
Pgm1	Rat	titanium dioxide	decreases methylation	ISO	RGD:11091	6480464	titanium dioxide results in decreased methylation of PGM1 gene	CTD	PMID:35295148
Pgm1	Rat	titanium dioxide	multiple interactions	ISO	RGD:11091	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in increased expression of PGM1 more ...	CTD	PMID:29950665
Pgm1	Rat	tolcapone	increases expression	EXP		6480464	tolcapone results in increased expression of PGM1 mRNA	CTD	PMID:24136188
Pgm1	Rat	trichostatin A	increases expression	ISO	RGD:734179	6480464	trichostatin A results in increased expression of PGM1 mRNA	CTD	PMID:24935251\|PMID:26272509
Pgm1	Rat	trichostatin A	multiple interactions	ISO	RGD:734179	6480464	[NOG protein co-treated with trichostatin A co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Pgm1	Rat	triclosan	decreases expression	ISO	RGD:734179	6480464	Triclosan results in decreased expression of PGM1 mRNA	CTD	PMID:30510588
Pgm1	Rat	triphenyl phosphate	affects expression	ISO	RGD:734179	6480464	triphenyl phosphate affects the expression of PGM1 mRNA	CTD	PMID:37042841
Pgm1	Rat	trovafloxacin	decreases expression	EXP		6480464	trovafloxacin results in decreased expression of PGM1 mRNA	CTD	PMID:24136188
Pgm1	Rat	urethane	decreases expression	ISO	RGD:734179	6480464	Urethane results in decreased expression of PGM1 mRNA	CTD	PMID:28818685
Pgm1	Rat	valproic acid	multiple interactions	ISO	RGD:734179	6480464	[Hydralazine co-treated with Valproic Acid] results in increased expression of PGM1 mRNA; [NOG protein co-treated more ...	CTD	PMID:17183730\|PMID:27188386
Pgm1	Rat	valproic acid	increases expression	ISO	RGD:734179	6480464	Valproic Acid results in increased expression of PGM1 mRNA	CTD	PMID:23179753\|PMID:24383497\|PMID:24935251\|PMID:26272509\|PMID:28001369
Pgm1	Rat	valproic acid	affects expression	ISO	RGD:734179	6480464	Valproic Acid affects the expression of PGM1 mRNA	CTD	PMID:25979313
Pgm1	Rat	vancomycin	decreases expression	ISO	RGD:11091	6480464	Vancomycin results in decreased expression of PGM1 mRNA	CTD	PMID:18930951
Pgm1	Rat	vinclozolin	increases expression	EXP		6480464	vinclozolin results in increased expression of PGM1 mRNA	CTD	PMID:20566332
Pgm1	Rat	vincristine	decreases expression	ISO	RGD:734179	6480464	Vincristine results in decreased expression of PGM1 mRNA	CTD	PMID:23649840
Pgm1	Rat	zinc dichloride	multiple interactions	ISO	RGD:734179	6480464	zinc chloride inhibits the reaction [cobaltous chloride results in increased expression of PGM1 mRNA]	CTD	PMID:22202117

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pgm1	Rat	carbohydrate metabolic process	involved_in	IEA	InterPro:IPR005841\|InterPro:IPR005844\|InterPro:IPR005845\|InterPro:IPR005846\|InterPro:IPR016055\|InterPro:IPR045244	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Pgm1	Rat	carbohydrate metabolic process	involved_in	IBA	FB:FBgn0003076\|MGI:97565\|PANTHER:PTN000501426\|RGD:3316\|SGD:S000001610\|SGD:S000004711\|TAIR:locus:2028110\|TAIR:locus:2033583\|TAIR:locus:2165351\|UniProtKB:A0A2R6W0K6\|UniProtKB:P36871	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pgm1	Rat	cellular response to magnetism		IEP		2303012		RGD
Pgm1	Rat	galactose catabolic process via UDP-galactose, Leloir pathway	involved_in	ISO	RGD:734179	1624291	PMID:30982613	RGD	PMID:30982613
Pgm1	Rat	galactose catabolic process via UDP-galactose, Leloir pathway	involved_in	IEA	UniProtKB:P36871\|ensembl:ENSP00000360125	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pgm1	Rat	glucose metabolic process	involved_in	IDA		633702	PMID:8224913	UniProt
Pgm1	Rat	glucose metabolic process	acts_upstream_of_or_within	IEA	UniProtKB:Q9D0F9\|ensembl:ENSMUSP00000061227	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pgm1	Rat	glucose metabolic process	acts_upstream_of_or_within	ISO	RGD:11091	1624291	PMID:4646763, PMID:5392465	RGD	PMID:4646763\|PMID:5392465
Pgm1	Rat	glucose metabolic process	involved_in	IEA	UniProtKB-KW:KW-0313	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pgm1	Rat	glucose metabolic process	involved_in	ISO	RGD:734179	1624291	PMID:25288802	RGD	PMID:25288802
Pgm1	Rat	glucose metabolic process	involved_in	IEA	UniProtKB:P36871\|ensembl:ENSP00000360125	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pgm1	Rat	intracellular calcium ion homeostasis		TAS		724639		RGD

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pgm1	Rat	cytoplasm	located_in	IEA	UniProtKB-SubCell:SL-0086	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Pgm1	Rat	cytoplasm	located_in	IEA	UniProtKB-KW:KW-0963	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pgm1	Rat	cytosol	is_active_in	IBA	PANTHER:PTN000501426\|TAIR:locus:2028110\|TAIR:locus:2033583\|UniProtKB:P36938	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pgm1	Rat	Z disc		IDA		11069392		RGD

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pgm1	Rat	intramolecular phosphotransferase activity	enables	IEA	InterPro:IPR005841\|InterPro:IPR005844\|InterPro:IPR005846\|InterPro:IPR016055\|InterPro:IPR036900	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Pgm1	Rat	isomerase activity	enables	IEA	UniProtKB-KW:KW-0413	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pgm1	Rat	magnesium ion binding	enables	IEA	UniProtKB:P36871\|ensembl:ENSP00000360125	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pgm1	Rat	magnesium ion binding	enables	IEA	InterPro:IPR016066	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Pgm1	Rat	magnesium ion binding	enables	ISO	RGD:734179	1624291	PMID:26972339	RGD	PMID:26972339
Pgm1	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Pgm1	Rat	phosphoglucomutase activity	enables	ISO	RGD:734179	1624291	PMID:1530890, PMID:25288802, PMID:30982613	RGD	PMID:1530890\|PMID:25288802\|PMID:30982613
Pgm1	Rat	phosphoglucomutase activity	enables	IEA	UniProtKB:Q9D0F9\|ensembl:ENSMUSP00000061227	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pgm1	Rat	phosphoglucomutase activity	enables	IEA	RHEA:23536	1600115	GO_REF:0000116	RHEA	GO_REF:0000116
Pgm1	Rat	phosphoglucomutase activity	enables	IBA	FB:FBgn0003076\|MGI:97565\|PANTHER:PTN000501426\|RGD:3316\|SGD:S000001610\|SGD:S000004711\|TAIR:locus:2028110\|TAIR:locus:2033583\|TAIR:locus:2165351\|UniProtKB:P36871\|UniProtKB:P36938\|UniProtKB:P93804\|UniProtKB:Q9P931	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Pgm1	Rat	phosphoglucomutase activity	enables	IEA	EC:5.4.2.2	1600115	GO_REF:0000003	UniProt	GO_REF:0000003
Pgm1	Rat	phosphoglucomutase activity	enables	ISO	RGD:11091	1624291	PMID:31077402, PMID:4646763, PMID:5392465, PMID:6457600, PMID:7323947, PMID:7444718	RGD	PMID:31077402\|PMID:4646763\|PMID:5392465\|PMID:6457600\|PMID:7323947\|PMID:7444718
Pgm1	Rat	phosphoglucomutase activity	enables	IEA	InterPro:IPR045244	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Pgm1	Rat	phosphoglucomutase activity	enables	IDA		633702	PMID:8224913	UniProt
Pgm1	Rat	phosphoglucomutase activity	enables	IEA	UniProtKB:P36871\|ensembl:ENSP00000360125	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Pgm1	Rat	protein binding		IPI	RGD:1564875	11069392		RGD
Pgm1	Rat	protein binding	enables	ISO	RGD:734179	1624291	UniProtKB:Q9BSI4 PMID:21044950	RGD	PMID:21044950

Molecular Pathway Annotations Click to see Annotation Detail View

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pgm1	Rat	glycogen biosynthetic pathway		ISO	RGD:734179	2304188		RGD
Pgm1	Rat	glycogen degradation pathway		ISO	RGD:734179	2304188		RGD

Imported Annotations - SMPDB

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pgm1	Rat	congenital sucrase-isomaltase deficiency pathway		ISO	RGD:734179	10402751		SMPDB	SMP:00557
Pgm1	Rat	fructose-1,6-bisphosphatase deficiency pathway		ISO	RGD:734179	10402751		SMPDB	SMP:00562
Pgm1	Rat	galactokinase deficiency pathway		ISO	RGD:734179	10402751		SMPDB	SMP:00495
Pgm1	Rat	galactose metabolic pathway		ISO	RGD:734179	10402751		SMPDB	SMP:00043
Pgm1	Rat	galactosemia pathway		ISO	RGD:734179	10402751		SMPDB	SMP:00182
Pgm1	Rat	GALE deficiency pathway		ISO	RGD:734179	10402751		SMPDB	SMP:00496
Pgm1	Rat	gluconeogenesis pathway		ISO	RGD:734179	10402751		SMPDB	SMP:00128
Pgm1	Rat	glycogen storage disease type Ia pathway		ISO	RGD:734179	10402751		SMPDB	SMP:00374
Pgm1	Rat	glycogen storage disease type Ia pathway		ISO	RGD:734179	10402751		SMPDB	SMP:00581
Pgm1	Rat	glycogen storage disease type Ib pathway		ISO	RGD:734179	10402751		SMPDB	SMP:00573
Pgm1	Rat	glycogen storage disease type III pathway		ISO	RGD:734179	10402751		SMPDB	SMP:00553
Pgm1	Rat	glycogen storage disease type IV pathway		ISO	RGD:734179	10402751		SMPDB	SMP:00554
Pgm1	Rat	glycogen storage disease type VI pathway		ISO	RGD:734179	10402751		SMPDB	SMP:00555
Pgm1	Rat	nucleotide sugar metabolic pathway		ISO	RGD:734179	10402751		SMPDB	SMP:00010
Pgm1	Rat	pentose phosphate pathway		ISO	RGD:734179	10402751		SMPDB	SMP:00031
Pgm1	Rat	phosphoenolpyruvate carboxykinase deficiency pathway		ISO	RGD:734179	10402751		SMPDB	SMP:00560
Pgm1	Rat	ribose 5-phosphate isomerase deficiency pathway		ISO	RGD:734179	10402751		SMPDB	SMP:00519
Pgm1	Rat	starch and sucrose metabolic pathway		ISO	RGD:734179	10402751		SMPDB	SMP:00058
Pgm1	Rat	transaldolase deficiency pathway		ISO	RGD:734179	10402751		SMPDB	SMP:00520
Pgm1	Rat	triosephosphate isomerase deficiency pathway		ISO	RGD:734179	10402751		SMPDB	SMP:00563

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pgm1	Rat	amino sugar metabolic pathway		IEA		6907045		KEGG	rno:00520
Pgm1	Rat	galactose metabolic pathway		IEA		6907045		KEGG	rno:00052
Pgm1	Rat	gluconeogenesis pathway		IEA		6907045		KEGG	rno:00010
Pgm1	Rat	glycolysis pathway		IEA		6907045		KEGG	rno:00010
Pgm1	Rat	glycolysis/gluconeogenesis pathway		IEA		6907045		KEGG	rno:00010
Pgm1	Rat	nucleotide sugar metabolic pathway		IEA		6907045		KEGG	rno:00520
Pgm1	Rat	pentose phosphate pathway		IEA		6907045		KEGG	rno:00030
Pgm1	Rat	purine metabolic pathway		IEA		6907045		KEGG	rno:00230
Pgm1	Rat	starch and sucrose metabolic pathway		IEA		6907045		KEGG	rno:00500

Imported Annotations - PID (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Pgm1	Rat	hypoxia inducible factor pathway		ISO	RGD:734179	6484113		PID	PID:200202

BioCyc Pathways

glycogen degradation II	UDP-alpha-D-glucose biosynthesis

Disease Annotations Click to see Annotation Detail View

Chemical and Drug Induced Liver Injury (ISO)

Colorectal Neoplasms (ISO)

congenital disorder of glycosylation (ISO)

congenital disorder of glycosylation It (ISO)

Craniosynostosis Syndrome, Autosomal Recessive (ISO)

endometrial cancer (ISO)

genetic disease (ISO)

intellectual disability (ISO)

Myocardial Ischemia (ISO)

teratoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

1H-pyrazole (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,6-dimethoxyphenol (ISO)

2-hydroxypropanoic acid (ISO)

2-methoxyethanol (EXP)

4,4'-sulfonyldiphenol (EXP,ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP,ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-naphthoflavone (ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

arsenous acid (ISO)

atrazine (EXP)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

Brodifacoum (EXP)

cadmium dichloride (EXP,ISO)

caffeine (ISO)

capsaicin (EXP,ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

chloropicrin (ISO)

clofibric acid (EXP)

cobalt dichloride (EXP,ISO)

coumarin (ISO)

cyclosporin A (ISO)

deguelin (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (EXP)

dinophysistoxin 1 (ISO)

dioxygen (ISO)

dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO)

disodium selenite (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

fenofibrate (ISO)

folic acid (ISO)

fonofos (ISO)

formaldehyde (ISO)

FR900359 (ISO)

furfural (ISO)

gentamycin (EXP)

hydralazine (ISO)

inulin (ISO)

isotretinoin (ISO)

ivermectin (ISO)

L-ascorbic acid (ISO)

lactucin (ISO)

lead(0) (ISO)

linalool (ISO)

methidathion (ISO)

methoxychlor (EXP)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

N-nitrosodiethylamine (ISO)

N-nitrosomorpholine (EXP)

nickel dichloride (EXP)

nickel sulfate (ISO)

obeticholic acid (ISO)

okadaic acid (ISO)

ozone (ISO)

panobinostat (ISO)

paracetamol (ISO)

parathion (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP,ISO)

phenobarbital (ISO)

picoxystrobin (ISO)

propiconazole (ISO)

Propiverine (EXP)

prostaglandin A1 (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

rotenone (EXP,ISO)

SB 431542 (ISO)

sodium arsenite (EXP,ISO)

sodium chloride (ISO)

tamoxifen (ISO)

terbufos (ISO)

tetrachloromethane (EXP,ISO)

thimerosal (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

tolcapone (EXP)

trichostatin A (ISO)

triclosan (ISO)

triphenyl phosphate (ISO)

trovafloxacin (EXP)

urethane (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

vincristine (ISO)

zinc dichloride (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

carbohydrate metabolic process (IBA,IEA)

cellular response to magnetism (IEP)

galactose catabolic process via UDP-galactose, Leloir pathway (IEA,ISO)

glucose metabolic process (IDA,IEA,ISO)

intracellular calcium ion homeostasis (TAS)

Cellular Component

cytoplasm (IEA)

cytosol (IBA)

Z disc (IDA)

Molecular Function

intramolecular phosphotransferase activity (IEA)

isomerase activity (IEA)

magnesium ion binding (IEA,ISO)

metal ion binding (IEA)

phosphoglucomutase activity (IBA,IDA,IEA,ISO)

protein binding (IPI,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

amino sugar metabolic pathway (IEA)

congenital sucrase-isomaltase deficiency pathway (ISO)

fructose-1,6-bisphosphatase deficiency pathway (ISO)

galactokinase deficiency pathway (ISO)

galactose metabolic pathway (IEA,ISO)

galactosemia pathway (ISO)

GALE deficiency pathway (ISO)

gluconeogenesis pathway (IEA,ISO)

glycogen biosynthetic pathway (ISO)

glycogen degradation pathway (ISO)

glycogen storage disease type Ia pathway (ISO)

glycogen storage disease type Ib pathway (ISO)

glycogen storage disease type III pathway (ISO)

glycogen storage disease type IV pathway (ISO)

glycogen storage disease type VI pathway (ISO)

glycolysis pathway (IEA)

glycolysis/gluconeogenesis pathway (IEA)

hypoxia inducible factor pathway (ISO)

nucleotide sugar metabolic pathway (IEA,ISO)

pentose phosphate pathway (IEA,ISO)

phosphoenolpyruvate carboxykinase deficiency pathway (ISO)

purine metabolic pathway (IEA)

ribose 5-phosphate isomerase deficiency pathway (ISO)

starch and sucrose metabolic pathway (IEA,ISO)

transaldolase deficiency pathway (ISO)

triosephosphate isomerase deficiency pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Impaired binding of ZASP/Cypher with phosphoglucomutase 1 is associated with dilated cardiomyopathy.	Arimura T, etal., Cardiovasc Res. 2009 Jul 1;83(1):80-8. doi: 10.1093/cvr/cvp119. Epub 2009 Apr 17.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
5.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
6.	Gene loss in human teratomas.	Linder D, Proc Natl Acad Sci U S A. 1969 Jul;63(3):699-704.
7.	Isoenzymes of hexokinase, 6-phosphogluconate dehydrogenase, phosphoglucomutase and lactate dehydrogenase in uterine cancer.	Marshall MJ, etal., Br J Cancer. 1979 Sep;40(3):380-90.
8.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
9.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.	Long-term alcohol intake enhances ADP-ribosylation of the multifunctional enzyme, phosphoglucomutase, in rat liver.	Nomura F, etal., Hepatology 1996 Nov;24(5):1246-9.
11.	Isolation and immunohistochemical localization of a chondroitin sulfate proteoglycan from adult rat brain.	Normand G, etal., J Neurochem. 1988 Sep;51(3):665-76.
12.	Differentiation of chromaffin cells elicited by ELF MF modifies gene expression pattern.	Olivares-Banuelos T, etal., Cell Biol Int. 2004;28(4):273-9.
13.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
14.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
15.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
16.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
17.	GOA pipeline	RGD automated data pipeline
18.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
19.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
20.	Comprehensive gene review and curation	RGD comprehensive gene curation
21.	Isolation and expression of a rat liver cDNA encoding phosphoglucomutase.	Rivera AA, etal., Gene 1993 Nov 15;133(2):261-6.
22.	A phylogenetic approach to the identification of phosphoglucomutase genes.	Whitehouse DB, etal., Mol Biol Evol. 1998 Apr;15(4):456-62.

Additional References at PubMed

PMID:1530890	PMID:1840235	PMID:4646763	PMID:5392465	PMID:7323947	PMID:7444718	PMID:7665162	PMID:12477932	PMID:19056867	PMID:23533145	PMID:25288802	PMID:26945066
PMID:26972339

Genomics

Comparative Map Data

Pgm1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	119,710,734 - 119,770,159 (+)	NCBI		GRCr8
mRatBN7.2	5	114,595,298 - 114,654,728 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	114,595,293 - 114,654,728 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	117,151,682 - 117,211,109 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	118,877,005 - 118,936,428 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	118,939,539 - 118,998,971 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	118,743,632 - 118,803,055 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	118,743,632 - 118,803,055 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	122,648,579 - 122,708,212 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	120,595,650 - 120,655,915 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	113,142,712 - 113,202,105 (+)	NCBI		Celera
RH 3.4 Map	5		RGD
Cytogenetic Map	5	q33	NCBI

PGM1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	63,593,411 - 63,660,245 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	63,593,411 - 63,660,245 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	64,059,082 - 64,125,916 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	63,831,535 - 63,898,504 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	63,770,967 - 63,837,935	NCBI
Celera	1	62,348,856 - 62,415,793 (+)	NCBI		Celera
Cytogenetic Map	1	p31.3	NCBI
HuRef	1	62,166,918 - 62,233,884 (+)	NCBI		HuRef
CHM1_1	1	64,174,737 - 64,241,622 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	63,469,205 - 63,536,042 (+)	NCBI		T2T-CHM13v2.0

Pgm1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	99,786,648 - 99,844,491 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	99,786,611 - 99,844,491 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	99,929,451 - 99,987,294 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	99,929,414 - 99,987,294 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	99,602,056 - 99,659,899 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	99,427,439 - 99,485,223 (+)	NCBI		MGSCv36	mm8
Celera	4	98,273,961 - 98,332,209 (+)	NCBI		Celera
Cytogenetic Map	4	C6	NCBI
cM Map	4	45.71	NCBI

Pgm1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955423	26,408,595 - 26,437,527 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955423	26,408,775 - 26,437,527 (-)	NCBI	ChiLan1.0	ChiLan1.0

PGM1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	163,193,482 - 163,262,694 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	162,344,100 - 162,411,352 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	62,849,451 - 62,916,359 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	64,658,599 - 64,725,496 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	64,658,599 - 64,725,496 (+)	Ensembl	panpan1.1		panPan2

PGM1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	46,444,433 - 46,577,621 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	46,515,295 - 46,577,622 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	46,505,433 - 46,638,431 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	46,624,512 - 46,757,954 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	46,672,266 - 46,757,997 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	46,586,542 - 46,719,720 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	46,532,568 - 46,666,112 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	46,790,338 - 46,923,562 (-)	NCBI		UU_Cfam_GSD_1.0

Pgm1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	76,845,424 - 76,905,846 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936692	1,160,623 - 1,221,746 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936692	1,160,836 - 1,221,270 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PGM1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	148,851,183 - 148,994,952 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	148,851,183 - 148,918,891 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	137,171,270 - 137,233,581 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PGM1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	69,391,487 - 69,495,156 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	69,428,996 - 69,466,191 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	47,968,869 - 48,035,370 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pgm1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624742	30,542,448 - 30,592,162 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624742	30,543,161 - 30,592,117 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pgm1
457 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	72
Count of miRNA genes:	69
Interacting mature miRNAs:	69
Transcripts:	ENSRNOT00000013785
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	97059760	147465714	Rat
7794743	Bp373	Blood pressure QTL 373		0.0058	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	112175546	116047089	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1298070	Scl18	Serum cholesterol level QTL 18	3.7		blood LDL cholesterol amount (VT:0000181)	calculated plasma low density lipoprotein cholesterol level (CMO:0001245)	5	79584860	124584860	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	94858972	143070159	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
7411582	Foco3	Food consumption QTL 3	7.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	87468046	132468046	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
1598859	Cm66	Cardiac mass QTL 66	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	79584860	124584860	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
2317753	Glom24	Glomerulus QTL 24	3.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	5	97570330	136479578	Rat
1582212	Livw2	Liver weight QTL 2	3.5	0.0004	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	5	99016066	119085810	Rat
7411564	Bw135	Body weight QTL 135		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	87468046	132468046	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
7411601	Foco12	Food consumption QTL 12	19.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	87468046	132468046	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	105999803	150999803	Rat
1598846	Bp293	Blood pressure QTL 293	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	79584860	124584860	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
1358909	Kidm25	Kidney mass QTL 25	1.87		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	90067849	128034027	Rat
1578673	Bmd13	Bone mineral density QTL 13	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	5	103689353	148689353	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
631527	Tls1	T-lymphoma susceptibility QTL 1	0	0.001	thymus integrity trait (VT:0010555)	post-insult time to onset of T-cell lymphoma (CMO:0001907)	5	90450144	135450144	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
1298086	Bp156	Blood pressure QTL 156			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	84132602	129132602	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	66174080	124160948	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	58829236	128034027	Rat
6903316	Bw113	Body weight QTL 113	2	0.0103	body mass (VT:0001259)	body weight (CMO:0000012)	5	87765973	132765973	Rat
1358889	Bp261	Blood pressure QTL 261	2.86		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	90067849	128034027	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	99216724	148607142	Rat

Markers in Region

D5Rhm1

No map positions available.

D5Rhm2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	5	119,774,989 - 119,775,157 (+)	Marker Load Pipeline
mRatBN7.2	5	114,659,557 - 114,659,726 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	118,807,885 - 118,808,053	NCBI	Rnor6.0
Rnor_5.0	5	122,713,042 - 122,713,210	UniSTS	Rnor5.0
RGSC_v3.4	5	120,660,745 - 120,660,913	UniSTS	RGSC3.4
Celera	5	113,206,935 - 113,207,103	UniSTS
Cytogenetic Map	5	q33	UniSTS

BF386789

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	114,594,795 - 114,594,990 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	118,743,130 - 118,743,324	NCBI	Rnor6.0
Rnor_5.0	5	122,648,077 - 122,648,271	UniSTS	Rnor5.0
RGSC_v3.4	5	120,595,148 - 120,595,342	UniSTS	RGSC3.4
Celera	5	113,142,210 - 113,142,404	UniSTS
RH 3.4 Map	5	791.3	UniSTS
Cytogenetic Map	5	q33	UniSTS

RH142295

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	5	119,742,627 - 119,743,215 (+)	Marker Load Pipeline
mRatBN7.2	5	114,627,194 - 114,627,782 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	118,775,524 - 118,776,111	NCBI	Rnor6.0
Rnor_5.0	5	122,680,510 - 122,681,097	UniSTS	Rnor5.0
RGSC_v3.4	5	120,628,325 - 120,628,912	UniSTS	RGSC3.4
Celera	5	113,174,572 - 113,175,159	UniSTS
RH 3.4 Map	5	791.3	UniSTS
Cytogenetic Map	5	q33	UniSTS

RH141738

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	114,654,451 - 114,654,660 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	118,802,779 - 118,802,987	NCBI	Rnor6.0
Rnor_5.0	5	122,707,936 - 122,708,144	UniSTS	Rnor5.0
RGSC_v3.4	5	120,655,639 - 120,655,847	UniSTS	RGSC3.4
Celera	5	113,201,829 - 113,202,037	UniSTS
RH 3.4 Map	5	793.1	UniSTS
Cytogenetic Map	5	q33	UniSTS

ha2531

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	136,958,572 - 136,959,506 (+)	MAPPER	mRatBN7.2
mRatBN7.2	5	114,606,869 - 114,607,662 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	118,755,205 - 118,755,997	NCBI	Rnor6.0
Rnor_6.0	2	142,094,995 - 142,095,928	NCBI	Rnor6.0
Rnor_5.0	5	122,660,152 - 122,660,944	UniSTS	Rnor5.0
Rnor_5.0	2	161,781,593 - 161,782,526	UniSTS	Rnor5.0
RGSC_v3.4	2	141,796,704 - 141,797,637	UniSTS	RGSC3.4
RGSC_v3.4	5	120,607,223 - 120,608,015	UniSTS	RGSC3.4
Celera	5	113,154,160 - 113,154,952	UniSTS
Celera	2	131,456,163 - 131,457,096	UniSTS
Cytogenetic Map	5	q33	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001429272	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001429273	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_017033	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006238442	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC121719	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC099807	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC128703	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473998	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220427	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L11694	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U20195	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000013785 ⟹ ENSRNOP00000013785

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	114,595,293 - 114,654,727 (+)	Ensembl
Rnor_6.0 Ensembl	5	118,743,632 - 118,803,055 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103908 ⟹ ENSRNOP00000097832

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	114,619,959 - 114,654,728 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000118798 ⟹ ENSRNOP00000081014

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	114,621,360 - 114,654,728 (+)	Ensembl

RefSeq Acc Id:

NM_017033 ⟹ NP_058729

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	119,710,734 - 119,770,159 (+)	NCBI
mRatBN7.2	5	114,595,298 - 114,654,728 (+)	NCBI
Rnor_6.0	5	118,743,632 - 118,803,055 (+)	NCBI
Rnor_5.0	5	122,648,579 - 122,708,212 (+)	NCBI
RGSC_v3.4	5	120,595,650 - 120,655,915 (+)	RGD
Celera	5	113,142,712 - 113,202,105 (+)	RGD

Sequence:

show sequence

CCTGAGCCCTCTGCAGCAGCCAGAGCCGCAGCTTCTGTCGCCCCGCAGCCCGTCGCCACCATGG
TGAAGATCGTGACAGTGAAGACGCAGGCATATCCGGATCAGAAGCCGGGCACCAGCGGGTTGCG
GAAGCGAGTGAAGGTGTTCCAGGGCAACGCTAACTATGCGGAGAATTTCATCCAAAGCATCGTC
TCCACCGTGGAGCCGGCGTTGAGGCAGGAGGCCACGCTGGTTGTGGGCGGGGACGGTCGCTTCT
ACATGACCGAGGCCATCCAGCTCATCGTACGCATCGCCGCAGCCAACGGGATTGGCCGCCTGGT
TATTGGACAGAATGGAATCCTCTCCACTCCTGCTGTATCCTGCATTATCCGAAAAATCAAAGCC
ATTGGTGGGATCATTCTGACAGCTAGCCACAATCCAGGAGGGCCCAATGGAGATTTTGGAATTA
AATTCAATATTTCTAATGGGGGTCCTGCTCCAGAAGCAATCACGGATAAAATTTTCCAAATCAG
CAAGACAATCGAAGAATATGCCATTTGCCCTGACTTGAAGGTAGACCTCAGTGTTCTGGGGAAG
CAGCAGTTTGACTTGGAAAACAAGTTCAAGCCCTTCACAGTGGAGATCGTGGACTCAGTCGAGG
CCTATGCCACAATGCTGAGAAACATCTTTGATTTCAACGCACTGAAGGAGCTACTCTCTGGCCC
AAACAGACTGAAGATCCGCATCGACGCCATGCACGGAGTTGTGGGACCGTACGTCAAGAAGATC
CTCTGTGAAGAACTTGGTGCCCCCGCAAACTCAGCTGTGAACTGTGTTCCCCTGGAGGATTTTG
GAGGCCACCACCCTGACCCCAACCTCACCTACGCTGCTGACCTGGTGGAAACCATGAAGTCAGG
AGAGCATGATTTCGGGGCTGCCTTTGATGGTGATGGGGATAGGAACATGATTCTGGGCAAGCAC
GGGTTCTTTGTGAACCCTTCTGACTCTGTGGCTGTCATCGCCGCCAACATCTTCAGCATTCCGT
ATTTCCAGCAGACTGGGGTCCGTGGCTTTGCCCGCAGCATGCCCACAAGTGGTGCTCTGGACCG
GGTAGCAAACGCCACAAAGATCGCTTTGTATGAGACCCCAACTGGCTGGAAGTTTTTTGGGAAT
TTGATGGATGCAAGCAAGCTTTCCCTCTGTGGAGAGGAGAGCTTTGGGACTGGTTCAGACCACA
TCCGAGAGAAAGATGGACTGTGGGCCGTCCTGGCCTGGCTCTCCATTCTGGCCACCCGCAAACA
GAGCGTGGAGGACATTCTCAAAGACCACTGGCAGAAGTTTGGTCGGAACTTCTTCACCAGGTAT
GACTACGAGGAGGTGGAAGCCGAGGGTGCAAACAAAATGATGAAGGACCTGGAGGCCCTGATGC
TGGACCGCTCCTTTGTGGGGAAGCAGTTCTCAGCAAACGATAAAGTCTACACGGTGGAGAAAGC
GGATAATTTCGAATATAGTGACCCAGTAGATGGAAGCATTTCAAAAAATCAGGGCTTGCGGCTT
ATTTTTGCAGATGGTTCTCGTATCATCTTCAGACTGAGCGGCACCGGGAGTGCTGGGGCTACCA
TCCGGCTCTATATTGATAGCTACGAGAAGGACGCTGCCAAGATCAACCAGGACCCCCAGGTCAT
GCTGGCGCCCCTGATCTCCATTGCTCTGAAAGTGTCCCAGCTCCAGGAGAGGACAGGCCGCACT
GCGCCCACTGTCATCACCTAGAGAGATGGCTGGATGTGGCACATCCCTCCCCCAGGAACTATCC
ACGCTGCCTGATTGAAGAGCACAGACAGAAACAGTGTATTCGCCTGGGCCTTTTAGGACTCCAT
CTTGATTTTTTTTACTTCCCACTTGATAAACAGCCATTTGGGAGGCACTGCCACTGTTTGGGGG
GGGGTGCGAAGAAGCAGACCTGAGGGCTCGCACCCATGTCTGTCCCTTCTCTTGCCCTATTGGA
TACCCGCTGTGTGAGCCTTTGTCTCCCAGCATCAGGTACAGTACACTACACTGTAAAGATTTGG
AGGCCATCTCCTGTCCCTGGGTGTGCGCCTGTAGAGTGATACTGAAGTTCCTGCTTCACTGTGA
AAGTCTCCCCATTAATGTTTACATGCAATCCAGCAGAAGACAGTTTCTGGTGCCTTCTCTCTAA
TCAATTTTTCTCCGAGTGAGATGCGCTTGTCTTCAGATCTGTGTTATTTCTCATCTCTCATCTG
CACAGATAGTTGAGGTATTAAAGCAGAATGTGCCCCTGTTAAAAAAAAAAAAAAAAAAAAAAAA
AAA

hide sequence

RefSeq Acc Id:

XM_006238442 ⟹ XP_006238504

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	119,736,187 - 119,770,159 (+)	NCBI
mRatBN7.2	5	114,620,858 - 114,654,728 (+)	NCBI
Rnor_6.0	5	118,769,155 - 118,803,055 (+)	NCBI
Rnor_5.0	5	122,648,579 - 122,708,212 (+)	NCBI

Sequence:

show sequence

GCTTGACCTTTTATTTGCTCAGTGGCTCCAAGCAACTTTAGCTGCAGACAGCCCAGCGGCTCCA
GTTCAAGGGGCAGCAGGAACAGTGAGAGCCATTACCAGGACACTGTGGCAGCTCCAGGTCCGAT
AGAGAATTTGGGGGACCCTCAGCTACTTCCTGGACACCCTCACAGAGCCAAGTGTTGGATATGA
AAGATGAGCGACTTTGAAGAATGGATTTCTGGGACATACAGGAGAACAGAAGAGGGTCCACTCC
CACTGCTGACGTTTGCCACAGTTCCTTACCACGACCAGAAACCAGGAACAAGTGGATTGCGGAA
GAACACCTATTACTTTGAGGAGAAGCCTTGCTATCTGGAGAATTTCATCCAGAGCATATTCTTT
TCCATAGACCTAAAAGATCGCCAGGGATCGTCACTGGTGGTCGGTGGAGACGGGCGGTATTTTA
ACAAGTCAGCCATAGAGACAGTAGTGCAGATGGCAGCTGCCAATGGGATTGGCCGCCTGGTTAT
TGGACAGAATGGAATCCTCTCCACTCCTGCTGTATCCTGCATTATCCGAAAAATCAAAGCCATT
GGTGGGATCATTCTGACAGCTAGCCACAATCCAGGAGGGCCCAATGGAGATTTTGGAATTAAAT
TCAATATTTCTAATGGGGGTCCTGCTCCAGAAGCAATCACGGATAAAATTTTCCAAATCAGCAA
GACAATCGAAGAATATGCCATTTGCCCTGACTTGAAGGTAGACCTCAGTGTTCTGGGGAAGCAG
CAGTTTGACTTGGAAAACAAGTTCAAGCCCTTCACAGTGGAGATCGTGGACTCAGTCGAGGCCT
ATGCCACAATGCTGAGAAACATCTTTGATTTCAACGCACTGAAGGAGCTACTCTCTGGCCCAAA
CAGACTGAAGATCCGCATCGACGCCATGCACGGAGTTGTGGGACCGTACGTCAAGAAGATCCTC
TGTGAAGAACTTGGTGCCCCCGCAAACTCAGCTGTGAACTGTGTTCCCCTGGAGGATTTTGGAG
GCCACCACCCTGACCCCAACCTCACCTACGCTGCTGACCTGGTGGAAACCATGAAGTCAGGAGA
GCATGATTTCGGGGCTGCCTTTGATGGTGATGGGGATAGGAACATGATTCTGGGCAAGCACGGG
TTCTTTGTGAACCCTTCTGACTCTGTGGCTGTCATCGCCGCCAACATCTTCAGCATTCCGTATT
TCCAGCAGACTGGGGTCCGTGGCTTTGCCCGCAGCATGCCCACAAGTGGTGCTCTGGACCGGGT
AGCAAACGCCACAAAGATCGCTTTGTATGAGACCCCAACTGGCTGGAAGTTTTTTGGGAATTTG
ATGGATGCAAGCAAGCTTTCCCTCTGTGGAGAGGAGAGCTTTGGGACTGGTTCAGACCACATCC
GAGAGAAAGATGGACTGTGGGCCGTCCTGGCCTGGCTCTCCATTCTGGCCACCCGCAAACAGAG
CGTGGAGGACATTCTCAAAGACCACTGGCAGAAGTTTGGTCGGAACTTCTTCACCAGGTATGAC
TACGAGGAGGTGGAAGCCGAGGGTGCAAACAAAATGATGAAGGACCTGGAGGCCCTGATGCTGG
ACCGCTCCTTTGTGGGGAAGCAGTTCTCAGCAAACGATAAAGTCTACACGGTGGAGAAAGCGGA
TAATTTCGAATATAGTGACCCAGTAGATGGAAGCATTTCAAAAAATCAGGGCTTGCGGCTTATT
TTTGCAGATGGTTCTCGTATCATCTTCAGACTGAGCGGCACCGGGAGTGCTGGGGCTACCATCC
GGCTCTATATTGATAGCTACGAGAAGGACGCTGCCAAGATCAACCAGGACCCCCAGGTCATGCT
GGCGCCCCTGATCTCCATTGCTCTGAAAGTGTCCCAGCTCCAGGAGAGGACAGGCCGCACTGCG
CCCACTGTCATCACCTAGAGAGATGGCTGGATGTGGCACATCCCTCCCCCAGGAACTATCCACG
CTGCCTGATTGAAGAGCACAGACAGAAACAGTGTATTCGCCTGGGCCTTTTAGGACTCCATCTT
GATTTTTTTTACTTCCCACTTGATAAACAGCCATTTGGGAGGCACTGCCACTGTTTGGGGGGGG
GTGCGAAGAAGCAGACCTGAGGGCTCGCACCCATGTCTGTCCCTTCTCTTGCCCTATTGGATAC
CCGCTGTGTGAGCCTTTGTCTCCCAGCATCAGGTACAGTACACTACACTGTAAAGATTTGGAGG
CCATCTCCTGTCCCTGGGTGTGCGCCTGTAGAGTGATACTGAAGTTCCTGCTTCACTGTGAAAG
TCTCCCCATTAATGTTTACATGCAATCCAGCAGAAGACAGTTTCTGGTGCCTTCTCTCTAATCA
ATTTTTCTCCGAGTGAGATGCGCTTGTCTTCAGATCTGTGTTATTTCTCATCTCTCATCTGCAC
AGATAGTTGAGGTATTAAAGCAGAATGTGCCCCTGTT

hide sequence

Protein Sequences


Protein RefSeqs	NP_001416201	(Get FASTA)	NCBI Sequence Viewer
	NP_001416202	(Get FASTA)	NCBI Sequence Viewer
	NP_058729	(Get FASTA)	NCBI Sequence Viewer
	XP_006238504	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA16862	(Get FASTA)	NCBI Sequence Viewer
	AAA82891	(Get FASTA)	NCBI Sequence Viewer
	AAH99807	(Get FASTA)	NCBI Sequence Viewer
	AAI28704	(Get FASTA)	NCBI Sequence Viewer
	EDL97817	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000013785
	ENSRNOP00000097832
GenBank Protein	P38652	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_058729 ⟸ NM_017033

- UniProtKB:

P38652 (UniProtKB/Swiss-Prot), Q499Q4 (UniProtKB/TrEMBL), A6JRM5 (UniProtKB/TrEMBL), F7F2L9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MVKIVTVKTQAYPDQKPGTSGLRKRVKVFQGNANYAENFIQSIVSTVEPALRQEATLVVGGDGR
FYMTEAIQLIVRIAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFG
IKFNISNGGPAPEAITDKIFQISKTIEEYAICPDLKVDLSVLGKQQFDLENKFKPFTVEIVDSV
EAYATMLRNIFDFNALKELLSGPNRLKIRIDAMHGVVGPYVKKILCEELGAPANSAVNCVPLED
FGGHHPDPNLTYAADLVETMKSGEHDFGAAFDGDGDRNMILGKHGFFVNPSDSVAVIAANIFSI
PYFQQTGVRGFARSMPTSGALDRVANATKIALYETPTGWKFFGNLMDASKLSLCGEESFGTGSD
HIREKDGLWAVLAWLSILATRKQSVEDILKDHWQKFGRNFFTRYDYEEVEAEGANKMMKDLEAL
MLDRSFVGKQFSANDKVYTVEKADNFEYSDPVDGSISKNQGLRLIFADGSRIIFRLSGTGSAGA
TIRLYIDSYEKDAAKINQDPQVMLAPLISIALKVSQLQERTGRTAPTVIT

hide sequence

RefSeq Acc Id:

XP_006238504 ⟸ XM_006238442

- Peptide Label:

isoform X1

- Sequence:

show sequence

MSDFEEWISGTYRRTEEGPLPLLTFATVPYHDQKPGTSGLRKNTYYFEEKPCYLENFIQSIFFS
IDLKDRQGSSLVVGGDGRYFNKSAIETVVQMAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIG
GIILTASHNPGGPNGDFGIKFNISNGGPAPEAITDKIFQISKTIEEYAICPDLKVDLSVLGKQQ
FDLENKFKPFTVEIVDSVEAYATMLRNIFDFNALKELLSGPNRLKIRIDAMHGVVGPYVKKILC
EELGAPANSAVNCVPLEDFGGHHPDPNLTYAADLVETMKSGEHDFGAAFDGDGDRNMILGKHGF
FVNPSDSVAVIAANIFSIPYFQQTGVRGFARSMPTSGALDRVANATKIALYETPTGWKFFGNLM
DASKLSLCGEESFGTGSDHIREKDGLWAVLAWLSILATRKQSVEDILKDHWQKFGRNFFTRYDY
EEVEAEGANKMMKDLEALMLDRSFVGKQFSANDKVYTVEKADNFEYSDPVDGSISKNQGLRLIF
ADGSRIIFRLSGTGSAGATIRLYIDSYEKDAAKINQDPQVMLAPLISIALKVSQLQERTGRTAP
TVIT

hide sequence

Ensembl Acc Id:

ENSRNOP00000013785 ⟸ ENSRNOT00000013785

Ensembl Acc Id:

ENSRNOP00000097832 ⟸ ENSRNOT00000103908

Ensembl Acc Id:

ENSRNOP00000081014 ⟸ ENSRNOT00000118798

Protein Domains

Alpha-D-phosphohexomutase alpha/beta/alpha

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P38652-F1-model_v2	AlphaFold	P38652	1-562	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13693856

Promoter ID:

EPDNEW_R4381

Type:

initiation region

Name:

Pgm1_1

Description:

phosphoglucomutase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	118,743,600 - 118,743,660	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3316	AgrOrtholog
BioCyc Gene	G2FUF-40563	BioCyc
BioCyc Pathway	PWY-5941 [glycogen degradation II]	BioCyc
	PWY-7343 [UDP-alpha-D-glucose biosynthesis]	BioCyc
BioCyc Pathway Image	PWY-5941	BioCyc
	PWY-7343	BioCyc
Ensembl Genes	ENSRNOG00000009889	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000013785	ENTREZGENE
	ENSRNOT00000103908	ENTREZGENE
Gene3D-CATH	Alpha-D-Glucose-1,6-Bisphosphate, subunit A, domain 3	UniProtKB/Swiss-Prot
	Alpha-D-phosphohexomutase, C-terminal domain	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7937943	IMAGE-MGC_LOAD
	IMAGE:8367784	IMAGE-MGC_LOAD
InterPro	A-D-PHexomutase_a/b/a-I	UniProtKB/Swiss-Prot
	A-D-PHexomutase_a/b/a-I/II/III	UniProtKB/Swiss-Prot
	A-D-PHexomutase_a/b/a-II	UniProtKB/Swiss-Prot
	A-D-PHexomutase_a/b/a-III	UniProtKB/Swiss-Prot
	A-D-PHexomutase_C_sf	UniProtKB/Swiss-Prot
	A-D-PHexomutase_CS	UniProtKB/Swiss-Prot
	Alpha-D-phosphohexomutase_SF	UniProtKB/Swiss-Prot
	PGM	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:124624	IMAGE-MGC_LOAD
	MGC:156500	IMAGE-MGC_LOAD
NCBI Gene	24645	ENTREZGENE
PANTHER	PHOSPHOGLUCOMUTASE-1	UniProtKB/Swiss-Prot
	PTHR22573	UniProtKB/Swiss-Prot
Pfam	PGM_PMM_I	UniProtKB/Swiss-Prot
	PGM_PMM_II	UniProtKB/Swiss-Prot
	PGM_PMM_III	UniProtKB/Swiss-Prot
PhenoGen	Pgm1	PhenoGen
PRINTS	PGMPMM	UniProtKB/Swiss-Prot
PROSITE	PGM_PMM	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000009889	RatGTEx
Superfamily-SCOP	SSF53738	UniProtKB/Swiss-Prot
	SSF55957	UniProtKB/Swiss-Prot
UniProt	A0A8I5ZRI9	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AV00	ENTREZGENE, UniProtKB/TrEMBL
	A1A5L2_RAT	UniProtKB/TrEMBL
	A6JRM5	ENTREZGENE, UniProtKB/TrEMBL
	F7F2L9	ENTREZGENE, UniProtKB/TrEMBL
	P38652	ENTREZGENE, UniProtKB/Swiss-Prot
	Q499Q4	ENTREZGENE
	Q62752_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Pgm1	Phosphoglucomutase 1			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_protein	58 kDa	724639
gene_regulation	substrate for Ca2+/calmodulindependent protein kinase; ADP-ribosylation increased in liver by long-term alcohol intake	724639

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

BioCyc Pathways