S100a4 (S100 calcium-binding protein A4)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: S100a4 (S100 calcium-binding protein A4) Rattus norvegicus

Analyze

Symbol:

S100a4

Name:

S100 calcium-binding protein A4

RGD ID:

3245

Description:

Enables actin binding activity; calcium ion binding activity; and calcium-dependent protein binding activity. Predicted to be involved in positive regulation of canonical NF-kappaB signal transduction. Predicted to be located in cytosol and nucleoplasm. Predicted to be active in extracellular space; nucleus; and perinuclear region of cytoplasm. Orthologous to human S100A4 (S100 calcium binding protein A4); PARTICIPATES IN calcium/calcium-mediated signaling pathway; INTERACTS WITH 1,3,5-trinitro-1,3,5-triazinane; 17alpha-ethynylestradiol; 17beta-estradiol.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

18A2; 42A; calvasculin; CAPL; metastasin; MTS1; nerve growth factor-induced protein 42A; P9K; P9ka; PEL98; placental calcium-binding protein; protein 9 Ka homologous to calcium-binding protein; protein S100-A4; RNP9KA

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	176,090,951 - 176,093,258 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	176,091,804 - 176,093,254 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	183,231,137 - 183,233,459 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	181,253,405 - 181,255,727 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	175,853,265 - 175,855,593 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	189,997,278 - 189,999,587 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	189,997,129 - 189,999,604 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	209,431,373 - 209,433,680 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	182,885,070 - 182,887,380 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	182,835,175 - 182,837,486 (+)	NCBI
Celera	2	170,025,678 - 170,027,982 (+)	NCBI		Celera
RH 3.4 Map	2	1164.6	RGD
Cytogenetic Map	2	q34	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adult respiratory distress syndrome (ISO)

Breast Neoplasms (TAS)

Colonic Neoplasms (ISO)

gastrointestinal stromal tumor (ISO)

genetic disease (ISO)

immunodeficiency 42 (ISO)

intracranial vasospasm (ISO)

ischemia (ISO)

Keloid (ISO)

medulloblastoma (ISO)

melanoma (ISO)

MHC class II deficiency (ISO)

Neoplasm Invasiveness (ISO)

Neoplasm Metastasis (ISO)

nephrosclerosis (ISO)

osteoarthritis (ISO)

parathyroid carcinoma (ISO)

severe congenital neutropenia 3 (ISO)

severe congenital neutropenia 5 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

1,2-dichloroethane (ISO)

1,3,5-trinitro-1,3,5-triazinane (EXP)

1,4-dithiothreitol (ISO)

17alpha-ethynylestradiol (EXP)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-nitrotoluene (ISO)

4,4'-diaminodiphenylmethane (EXP)

4,4'-sulfonyldiphenol (ISO)

4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acetylsalicylic acid (ISO)

acrolein (ISO)

aflatoxin B1 (EXP)

all-trans-retinoic acid (EXP,ISO)

amitrole (EXP)

ammonium chloride (EXP)

amphetamine (EXP)

andrographolide (EXP)

anthra[1,9-cd]pyrazol-6(2H)-one (ISO)

antimycin A (ISO)

apocynin (ISO)

aristolochic acid A (ISO)

arsenous acid (ISO)

ATP (ISO)

atrazine (ISO)

azoxystrobin (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[b]fluoranthene (ISO)

beta-naphthoflavone (ISO)

bilirubin IXalpha (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bleomycin A2 (EXP)

calcitriol (ISO)

capsaicin (ISO)

carbon nanotube (ISO)

chloroprene (ISO)

choline (ISO)

cisplatin (ISO)

cobalt dichloride (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) sulfate (ISO)

cycloheximide (ISO)

cyclosporin A (EXP,ISO)

cytarabine (ISO)

D-penicillamine (EXP)

deoxynivalenol (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

Diosbulbin B (ISO)

dioxygen (ISO)

diuron (EXP,ISO)

dopamine (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (ISO)

entinostat (ISO)

epoxiconazole (ISO)

ethanol (ISO)

ethylenediaminetetraacetic acid (ISO)

fenoldopam (EXP)

fenpyroximate (ISO)

fluoranthene (ISO)

folic acid (ISO)

fonofos (ISO)

formaldehyde (ISO)

furan (EXP)

geldanamycin (ISO)

gentamycin (EXP)

glycidol (EXP)

glycidyl methacrylate (ISO)

graphene oxide (ISO)

homocysteine (ISO)

hydrogen peroxide (ISO)

indole-3-methanol (EXP)

iohexol (ISO)

iopamidol (ISO)

isoprenaline (EXP)

isotretinoin (ISO)

ivermectin (ISO)

ketamine (EXP)

L-1,4-dithiothreitol (ISO)

L-ascorbic acid (ISO)

L-methionine (ISO)

lipopolysaccharide (ISO)

lithium atom (EXP)

lithium hydride (EXP)

losartan (ISO)

Malonoben (ISO)

mercury atom (ISO)

mercury(0) (ISO)

methimazole (EXP)

methotrexate (ISO)

methyl carbamate (ISO)

methyl methanesulfonate (ISO)

methylmercury chloride (ISO)

methylseleninic acid (ISO)

Miglitol (EXP,ISO)

milrinone (EXP)

mitomycin C (ISO)

N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO)

N-acetyl-L-cysteine (EXP)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodiethylamine (EXP,ISO)

niclosamide (ISO)

oxaliplatin (ISO)

ozone (EXP,ISO)

Pachymic acid (ISO)

paclitaxel (ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

paraquat (EXP,ISO)

parathion (ISO)

pentetic acid (ISO)

phenytoin (ISO)

phorbol 13-acetate 12-myristate (ISO)

picoxystrobin (ISO)

pirinixic acid (ISO)

pravastatin (EXP,ISO)

pyrimidifen (ISO)

quercetin (ISO)

resveratrol (EXP,ISO)

rotenone (ISO)

SB 203580 (ISO)

SB 431542 (ISO)

scopolamine (EXP)

senecionine (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sirolimus (EXP)

sodium arsenite (ISO)

sodium tungstate (ISO)

sulforaphane (ISO)

sunitinib (ISO)

tamibarotene (ISO)

tebufenpyrad (ISO)

temozolomide (ISO)

terbufos (ISO)

tert-butyl hydroperoxide (ISO)

testosterone (EXP)

tetrachloromethane (EXP,ISO)

thapsigargin (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

toluene (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

Triptolide (EXP)

tunicamycin (ISO)

valproic acid (ISO)

vancomycin (ISO)

vinclozolin (EXP)

vincristine (ISO)

vorinostat (ISO)

xanthohumol (ISO)

zaragozic acid A (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

positive chemotaxis (IEA)

positive regulation of canonical NF-kappaB signal transduction (IBA,ISO)

Cellular Component

cytosol (IEA,ISO)

extracellular space (IBA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA,ISO)

perinuclear region of cytoplasm (IBA,ISO)

Molecular Function

actin binding (IDA)

calcium ion binding (IBA,IDA,ISO,TAS)

calcium-dependent protein binding (IBA,IDA,IMP)

chemoattractant activity (ISO)

identical protein binding (ISO)

protein binding (IPI,ISO)

protein-containing complex binding (TAS)

RAGE receptor binding (IBA,ISO)

transition metal ion binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

calcium/calcium-mediated signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Calcium-ion binding by the potential calcium-ion-binding protein, p9Ka.	Barraclough R, etal., Biochem Biophys Res Commun. 1990 Jun 15;169(2):660-6.
2.	Molecular cloning and sequence of the gene for p9Ka. A cultured myoepithelial cell protein with strong homology to S-100, a calcium-binding protein.	Barraclough R, etal., J Mol Biol 1987 Nov 5;198(1):13-20.
3.	Transformation of normal rat kidney cells by v-K-ras enhances expression of transin 2 and an S-100-related calcium-binding protein.	De Vouge MW and Mukherjee BB, Oncogene 1992 Jan;7(1):109-19.
4.	Protein interactions between S100A4 (p9Ka) and other cellular proteins identified using in vitro methods.	Flynn AM, etal., Biochem Soc Trans. 1996 Aug;24(3):341S.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
7.	Gene expression profile of rat adipose tissue at the onset of high-fat-diet obesity.	Li J, etal., Am J Physiol Endocrinol Metab 2002 Jun;282(6):E1334-41.
8.	Nerve growth factor induces the genes for two proteins related to a family of calcium-binding proteins in PC12 cells.	Masiakowski P and Shooter EM, Proc Natl Acad Sci U S A 1988 Feb;85(4):1277-81.
9.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
10.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
11.	An integrated rat genetic map: analysis of linkage conservation with the mouse and human maps.	Remmers EF, etal., Transplant Proc 1999 May;31(3):1549-54.
12.	GOA pipeline	RGD automated data pipeline
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Metastasis-associated S100A4 (Mts1) protein is expressed in subpopulations of sensory and autonomic neurons and in Schwann cells of the adult rat.	Sandelin M, etal., J Comp Neurol 2004 May 24;473(2):233-43.
15.	Calcium, troponin, calmodulin, S100 proteins: from myocardial basics to new therapeutic strategies.	Schaub MC and Heizmann CW, Biochem Biophys Res Commun. 2008 Apr 25;369(1):247-64. Epub 2007 Oct 25.
16.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
17.	The C-terminal region of S100A4 is important for its metastasis-inducing properties.	Zhang S, etal., Oncogene 2005 Jun 23;24(27):4401-11.

Additional References at PubMed

PMID:9242709	PMID:10869553	PMID:11914069	PMID:12118070	PMID:15033494	PMID:15665453	PMID:16265672	PMID:17223348	PMID:19056867	PMID:20421509	PMID:21975553	PMID:22483112
PMID:22561747	PMID:22658674	PMID:22664934	PMID:23222508	PMID:23352991	PMID:23376485	PMID:23469180	PMID:23580065	PMID:25253987	PMID:26499072	PMID:26721462	PMID:27068509
PMID:28235243	PMID:30083275

Genomics

Comparative Map Data

S100a4
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	2	176,090,951 - 176,093,258 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	2	176,091,804 - 176,093,254 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	2	183,231,137 - 183,233,459 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	2	181,253,405 - 181,255,727 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	2	175,853,265 - 175,855,593 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	2	189,997,278 - 189,999,587 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	2	189,997,129 - 189,999,604 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	2	209,431,373 - 209,433,680 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	2	182,885,070 - 182,887,380 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	2	182,835,175 - 182,837,486 (+)	NCBI
Celera	2	170,025,678 - 170,027,982 (+)	NCBI		Celera
RH 3.4 Map	2	1164.6	RGD
Cytogenetic Map	2	q34	NCBI

S100A4
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	153,543,621 - 153,545,806 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	153,543,613 - 153,550,136 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	153,516,097 - 153,518,282 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	151,782,719 - 151,784,906 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	150,329,170 - 150,331,355	NCBI
Celera	1	126,587,355 - 126,589,542 (-)	NCBI		Celera
Cytogenetic Map	1	q21.3	NCBI
HuRef	1	124,879,355 - 124,881,542 (-)	NCBI		HuRef
CHM1_1	1	154,912,044 - 154,914,231 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	152,680,877 - 152,683,062 (-)	NCBI		T2T-CHM13v2.0

S100a4
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	3	90,511,077 - 90,513,349 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	3	90,511,078 - 90,513,352 (+)	Ensembl		GRCm39 Ensembl
GRCm38	3	90,603,770 - 90,606,045 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	3	90,603,771 - 90,606,045 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	3	90,407,692 - 90,409,967 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	3	90,689,697 - 90,691,968 (+)	NCBI		MGSCv36	mm8
Celera	3	90,645,174 - 90,647,449 (+)	NCBI		Celera
Cytogenetic Map	3	F1	NCBI
cM Map	3	39.27	NCBI

S100a4
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955545	192,116 - 195,394 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955545	192,236 - 194,468 (-)	NCBI	ChiLan1.0	ChiLan1.0

S100A4
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	1	96,023,251 - 96,025,528 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	128,898,765 - 128,901,042 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	132,527,846 - 132,530,125 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	132,527,846 - 132,530,122 (-)	Ensembl	panpan1.1		panPan2

S100A4
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	7	43,494,007 - 43,496,021 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	7	42,986,972 - 42,988,993 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	7	43,443,738 - 43,445,759 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	7	43,440,733 - 43,445,796 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	7	43,146,014 - 43,148,039 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	7	43,199,907 - 43,201,928 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	7	43,483,524 - 43,485,545 (+)	NCBI		UU_Cfam_GSD_1.0

S100a4
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	24,325,369 - 24,327,658 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936580	3,355,699 - 3,358,242 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936580	3,355,751 - 3,358,030 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

S100A4
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	96,088,201 - 96,091,156 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	96,088,102 - 96,091,160 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	104,908,141 - 104,911,151 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

S100A4
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	10,258,142 - 10,260,390 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	10,258,070 - 10,260,871 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	9,649,628 - 9,651,911 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

S100a4
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624885	3,586,909 - 3,592,914 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624885	3,589,323 - 3,591,463 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in S100a4
8 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	38
Count of miRNA genes:	38
Interacting mature miRNAs:	38
Transcripts:	ENSRNOT00000015958
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1358913	Cm41	Cardiac mass QTL 41	2.73		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
1358917	Cm42	Cardiac mass QTL 42	2.82		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	2	25413423	203928301	Rat
2293843	Kiddil6	Kidney dilation QTL 6	3.1		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	2	42804607	182042367	Rat
1298074	Bp164	Blood pressure QTL 164		0.003	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
1298085	Bp165	Blood pressure QTL 165		0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	42804607	202447032	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	43154682	202446871	Rat
61467	Bp14	Blood pressure QTL 14	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	43154682	202446871	Rat
1354601	Slep1	Serum leptin concentration QTL 1	5.39		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	2	43171017	184114403	Rat
631266	Bp132	Blood pressure QTL 132		0.0005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	46123260	202447032	Rat
1331760	Bp206	Blood pressure QTL 206	3.62454		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	56043031	202447032	Rat
1298080	Bp163	Blood pressure QTL 163		0.02	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118275	202447032	Rat
1354648	Bp239	Blood pressure QTL 239		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	66118463	226797303	Rat
1354605	Rf48	Renal function QTL 48	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	2	74786664	206665859	Rat
61374	Edpm2	Estrogen-dependent pituitary mass QTL 2	4.42	0.86	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	2	76539322	202447032	Rat
1581569	Uae32	Urinary albumin excretion QTL 32		0.0001	urine protein amount (VT:0005160)	urine albumin excretion rate (CMO:0000757)	2	78665619	219826953	Rat
724534	Uae6	Urinary albumin excretion QTL 6	10		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	2	78665619	249053267	Rat
8662832	Vetf7	Vascular elastic tissue fragility QTL 7	3.5		aorta elastin amount (VT:0003905)	aorta wall extracellular elastin dry weight to aorta wall dry weight ratio (CMO:0002002)	2	81689826	221035911	Rat
1354622	Kidm16	Kidney mass QTL 16	3		kidney mass (VT:0002707)	left kidney wet weight (CMO:0000083)	2	81754530	222436696	Rat
1354649	Kidm17	Kidney mass QTL 17	2.9		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	2	81754530	227146641	Rat
631507	Bp105	Blood pressure QTL 105		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	112456140	212696837	Rat
634308	Sach6	Saccharin preference QTL 6	4.9		taste sensitivity trait (VT:0001986)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	2	112456140	212696837	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	114837527	185876470	Rat
1359030	Bp277	Blood pressure QTL 277			arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	114837527	185876470	Rat
1578648	Bss11	Bone structure and strength QTL 11	4.7		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	2	114837527	211674221	Rat
1554319	Bmd2	Bone mineral density QTL 2	13.4	0.0001	lumbar vertebra area (VT:0010570)	lumbar vertebra cross-sectional area (CMO:0001689)	2	114837675	212549332	Rat
1300165	Rf9	Renal function QTL 9	3.28		kidney glomerulus integrity trait (VT:0010546)	index of glomerular damage (CMO:0001135)	2	133914684	202447032	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	2	135552573	202446871	Rat
70175	BpQTLCluster3	Blood pressure QTL cluster 3	4.128		arterial blood pressure trait (VT:2000000)	absolute change in systolic blood pressure (CMO:0000607)	2	135552573	202446871	Rat
1298076	Bp166	Blood pressure QTL 166		0.0009	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	136445150	202447032	Rat
1581502	Esta3	Estrogen-induced thymic atrophy QTL 3			thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	2	136916935	189599348	Rat
1359022	Ppulsi1	Prepulse inhibition QTL 1	3.63		prepulse inhibition trait (VT:0003088)	acoustic startle response measurement (CMO:0001519)	2	136916935	213594495	Rat
1331794	Bp202	Blood pressure QTL 202	3.66819		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	141194931	223265385	Rat
1331805	Cm29	Cardiac mass QTL 29	3.50746		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	2	141194931	223265385	Rat
71113	Cari2	Carrageenan-induced inflammation QTL 2	2.7	0.009	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	2	141596551	202447032	Rat
724568	Uae13	Urinary albumin excretion QTL 13	4.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	2	143157029	210020885	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	143657411	190602963	Rat
10043136	Iddm54	Insulin dependent diabetes mellitus QTL 54	3.4	0.0001	blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	2	143657411	190602963	Rat
6903312	Bw112	Body weight QTL 112	3.2	0.0013	body mass (VT:0001259)	body weight (CMO:0000012)	2	143657569	184114274	Rat
61401	Niddm2	Non-insulin dependent diabetes mellitus QTL 2	4.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	144599348	189599348	Rat
1598833	Bp295	Blood pressure QTL 295	3.5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	147798556	192798556	Rat
1641925	Alcrsp2	Alcohol response QTL 2			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	221167075	Rat
1641891	Alcrsp17	Alcohol response QTL 17			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	2	149559561	249053267	Rat
1598805	Memor8	Memory QTL 8	3		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	2	150341585	189039377	Rat
631501	Bp101	Blood pressure QTL 101	2.4		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150341684	202446871	Rat
2301966	Bp322	Blood pressure QTL 322	3.58		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	150540301	202447032	Rat
1354609	Niddm62	Non-insulin dependent diabetes mellitus QTL 62	4.72	0.000006	insulin secretion trait (VT:0003564)	plasma insulin level (CMO:0000342)	2	150540301	202447032	Rat
12879836	Kidm61	Kidney mass QTL 61		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	2	152413072	185122374	Rat
12879837	Am2	Aortic mass QTL 2		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	2	152413072	185122374	Rat
12879838	Cm86	Cardiac mass QTL 86		0.002	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	2	152413072	185122374	Rat
12879839	Cm85	Cardiac mass QTL 85		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	2	152413072	185122374	Rat
12879840	Bw179	Body weight QTL 179		0.005	body mass (VT:0001259)	body weight (CMO:0000012)	2	152413072	185122374	Rat
1359032	Hrtrt18	Heart rate QTL 18			heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	2	157142078	192625452	Rat
1358900	Bw48	Body weight QTL 48	4.88		body mass (VT:0001259)	body weight (CMO:0000012)	2	157142078	211086598	Rat
8662843	Vetf9	Vascular elastic tissue fragility QTL 9	2.05		thoracic aorta molecular composition trait (VT:0010568)	aorta wall extracellular elastin dry weight to aorta wall extracellular collagen weight ratio (CMO:0002003)	2	157142078	226277316	Rat
1302793	Bw16	Body weight QTL 16	5	0.0001	body mass (VT:0001259)	body weight (CMO:0000012)	2	157142209	202446871	Rat
7488925	Bp364	Blood pressure QTL 364		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	160564068	205564068	Rat
1358356	Srcrt1	Stress Responsive Cort QTL1	3.66		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	2	161699179	222436696	Rat
7488927	Bp365	Blood pressure QTL 365		0.008	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	162765032	207765032	Rat
2306901	Bp337	Blood pressure QTL 337		0.01	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	164073756	227146641	Rat
1598838	Bp290	Blood pressure QTL 290	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	166539266	211539266	Rat
1549833	Bp257	Blood pressure QTL 257		0.003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168354880	185122374	Rat
1331734	Bp204	Blood pressure QTL 204	3.61192		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	2	168358098	223265385	Rat
2307174	Activ3	Activity QTL 3	4.83	0.000058	locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	2	168594495	213594495	Rat
61469	Bp16	Blood pressure QTL 16	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
70162	Bp63	Blood pressure QTL 63	5.64		arterial blood pressure trait (VT:2000000)	blood pressure measurement (CMO:0000003)	2	169745596	214745596	Rat
631522	Bp74	Blood pressure QTL 74		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	2	172710921	184114403	Rat
2293084	Iddm26	Insulin dependent diabetes mellitus QTL 26	2.9		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	2	174930955	213594495	Rat

Markers in Region

D2Mit13

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	56,794,419 - 56,794,475 (+)	MAPPER	mRatBN7.2
mRatBN7.2	2	176,092,339 - 176,092,546 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	189,998,667 - 189,998,875	NCBI	Rnor6.0
Rnor_5.0	2	209,432,762 - 209,432,968	UniSTS	Rnor5.0
RGSC_v3.4	2	182,886,458 - 182,886,669	RGD	RGSC3.4
RGSC_v3.4	2	182,886,459 - 182,886,669	UniSTS	RGSC3.4
RGSC_v3.1	2	182,836,564 - 182,836,775	RGD
Celera	2	170,027,065 - 170,027,271	UniSTS
SHRSP x BN Map	2	70.0198	UniSTS
SHRSP x BN Map	2	70.0198	RGD
Cytogenetic Map	2	q34	UniSTS

D2Wox23

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	176,091,092 - 176,091,187 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	189,997,420 - 189,997,514	NCBI	Rnor6.0
Rnor_5.0	2	209,431,515 - 209,431,609	UniSTS	Rnor5.0
RGSC_v3.4	2	182,885,212 - 182,885,306	UniSTS	RGSC3.4
RGSC_v3.1	2	182,835,317 - 182,835,412	RGD
Celera	2	170,025,820 - 170,025,912	UniSTS
Cytogenetic Map	2	q34	UniSTS

D2Arb37

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	176,092,313 - 176,092,591 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	189,998,641 - 189,998,920	NCBI	Rnor6.0
Rnor_5.0	2	209,432,736 - 209,433,013	UniSTS	Rnor5.0
RGSC_v3.4	2	182,886,432 - 182,886,714	RGD	RGSC3.4
RGSC_v3.4	2	182,886,433 - 182,886,714	UniSTS	RGSC3.4
RGSC_v3.1	2	182,836,538 - 182,836,820	RGD
Celera	2	170,027,039 - 170,027,316	UniSTS
SHRSP x BN Map	2	70.0198	UniSTS
SHRSP x BN Map	2	70.0198	RGD
Cytogenetic Map	2	q34	UniSTS

RH132651

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	176,089,314 - 176,089,508 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	189,995,642 - 189,995,835	NCBI	Rnor6.0
Rnor_5.0	2	209,429,737 - 209,429,930	UniSTS	Rnor5.0
RGSC_v3.4	2	182,883,434 - 182,883,627	UniSTS	RGSC3.4
Celera	2	170,024,042 - 170,024,235	UniSTS
RH 3.4 Map	2	1165.4	UniSTS
Cytogenetic Map	2	q34	UniSTS

RH94503

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	2	176,093,136 - 176,093,239 (+)	MAPPER	mRatBN7.2
Rnor_6.0	2	189,999,466 - 189,999,568	NCBI	Rnor6.0
Rnor_5.0	2	209,433,559 - 209,433,661	UniSTS	Rnor5.0
RGSC_v3.4	2	182,887,260 - 182,887,362	UniSTS	RGSC3.4
Celera	2	170,027,862 - 170,027,964	UniSTS
RH 3.4 Map	2	1164.6	UniSTS
Cytogenetic Map	2	q34	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	33	14	2	19	2	8	11		23	16	11	8
Low		10	43	39		39			62	12	24
Below cutoff									8		1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012618	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_006232592	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039101725	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC097705	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473976	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ215053	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220722	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221062	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221355	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221406	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221428	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221508	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221699	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221706	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221757	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221860	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222027	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222069	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222186	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222219	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222585	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222875	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222962	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223047	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223108	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223128	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ223234	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228364	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228506	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228607	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229874	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J03628	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000069	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U94663	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X06916	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X64022	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X64023	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000015958 ⟹ ENSRNOP00000015958

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	176,091,804 - 176,093,254 (+)	Ensembl
Rnor_6.0 Ensembl	2	189,997,129 - 189,999,604 (+)	Ensembl

RefSeq Acc Id:

NM_012618 ⟹ NP_036750

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	176,090,951 - 176,093,257 (+)	NCBI
Rnor_6.0	2	189,997,278 - 189,999,586 (+)	NCBI
Rnor_5.0	2	209,431,373 - 209,433,680 (+)	NCBI
RGSC_v3.4	2	182,885,070 - 182,887,380 (+)	RGD
Celera	2	170,025,678 - 170,027,982 (+)	RGD

Sequence:

show sequence

AAACCTCTCTGTTCAGCACTTCCTCTCTCTTGGTCTGGTCTCAACGGTCACCATGGCGAGACCC
TTGGAGGAGGCCCTGGATGTAATAGTGTCCACCTTCCACAAATACTCAGGCAACGAGGGTGACA
AGTTCAAGCTGAACAAGACAGAGCTCAAGGAGCTACTGACCAGGGAGCTGCCTAGCTTCCTGGG
GAGAAGGACAGACGAAGCTGCATTCCAGAAGCTGATGAACAACTTGGACAGCAACAGGGACAAT
GAAGTTGACTTCCAGGAGTACTGTGTCTTCCTGTCCTGCATTGCCATGATGTGCAATGAATTCT
TTGAGGGCTGCCCAGATAAGGAGCCCCGGAAGAAGTGAAGACTCCTCAGATGAAGTGTTGGGCC
AGTGGGGGAATCTTCCATGTTGGCTGTGAGCATAGTGCCTTACTCTGGCTTCTTCATACATGTG
CACAGTGCTGAGCAAGTTTAATAAAGAGTTTTGAAACT

hide sequence

RefSeq Acc Id:

XM_006232592 ⟹ XP_006232654

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	176,091,780 - 176,093,258 (+)	NCBI
Rnor_6.0	2	189,998,123 - 189,999,587 (+)	NCBI
Rnor_5.0	2	209,431,373 - 209,433,680 (+)	NCBI

Sequence:

show sequence

GAGTTGGGGAGTGAGTAAGCTGAGTGAGGGATGGAAAACTGCTGTTGTTGAGGCCAGGCCTGGG
GGGGAGGCACAGAAGGCTGCTGGCATGAATTTCTAGAGTTTGAGTGGTCTCAACGGTCACCATG
GCGAGACCCTTGGAGGAGGCCCTGGATGTAATAGTGTCCACCTTCCACAAATACTCAGGCAACG
AGGGTGACAAGTTCAAGCTGAACAAGACAGAGCTCAAGGAGCTACTGACCAGGGAGCTGCCTAG
CTTCCTGGGGAGAAGGACAGACGAAGCTGCATTCCAGAAGCTGATGAACAACTTGGACAGCAAC
AGGGACAATGAAGTTGACTTCCAGGAGTACTGTGTCTTCCTGTCCTGCATTGCCATGATGTGCA
ATGAATTCTTTGAGGGCTGCCCAGATAAGGAGCCCCGGAAGAAGTGAAGACTCCTCAGATGAAG
TGTTGGGCCAGTGGGGGAATCTTCCATGTTGGCTGTGAGCATAGTGCCTTACTCTGGCTTCTTC
ATACATGTGCACAGTGCTGAGCAAGTTTAATAAAGAGTTTTGAAACTA

hide sequence

RefSeq Acc Id:

XM_039101725 ⟹ XP_038957653

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	2	176,091,901 - 176,093,258 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_036750	(Get FASTA)	NCBI Sequence Viewer
	XP_006232654	(Get FASTA)	NCBI Sequence Viewer
	XP_038957653	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA42098	(Get FASTA)	NCBI Sequence Viewer
	CAA30014	(Get FASTA)	NCBI Sequence Viewer
	EDM00542	(Get FASTA)	NCBI Sequence Viewer
	P05942	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_036750 ⟸ NM_012618
- UniProtKB:	P05942 (UniProtKB/Swiss-Prot), A6J6P7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MARPLEEALDVIVSTFHKYSGNEGDKFKLNKTELKELLTRELPSFLGRRTDEAAFQKLMNNLDS NRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK hide sequence

RefSeq Acc Id:	XP_006232654 ⟸ XM_006232592
- Peptide Label:	isoform X1
- UniProtKB:	P05942 (UniProtKB/Swiss-Prot), A6J6P7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MARPLEEALDVIVSTFHKYSGNEGDKFKLNKTELKELLTRELPSFLGRRTDEAAFQKLMNNLDS NRDNEVDFQEYCVFLSCIAMMCNEFFEGCPDKEPRKK hide sequence

RefSeq Acc Id:

ENSRNOP00000015958 ⟸ ENSRNOT00000015958

RefSeq Acc Id:	XP_038957653 ⟸ XM_039101725
- Peptide Label:	isoform X1
- UniProtKB:	P05942 (UniProtKB/Swiss-Prot), A6J6P7 (UniProtKB/TrEMBL)

Protein Domains

EF-hand

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P05942-F1-model_v2	AlphaFold	P05942	1-101	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3245	AgrOrtholog
BioCyc Gene	G2FUF-52328	BioCyc
Ensembl Genes	ENSRNOG00000011821	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000015958	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000015958	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	EF-hand	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	EF-hand-dom_pair	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EF_Hand_1_Ca_BS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EF_hand_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	S-100_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	S100/CaBP-9k_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	S100_Ca-bd_sub	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:24615	UniProtKB/Swiss-Prot
NCBI Gene	24615	ENTREZGENE
PANTHER	PROTEIN S100-A4	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
	S100 CALCIUM-BINDING PROTEIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	S_100	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	S100a4	PhenoGen
PROSITE	EF_HAND_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	EF_HAND_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	S100_CABP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	EFh	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	S_100	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	EF-hand	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
TIGR	TC228997
UniProt	A6J6P7	ENTREZGENE, UniProtKB/TrEMBL
	P05942	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Description	Reference	Status
2002-06-10	S100a4	S100 calcium-binding protein A4	Symbol and Name status set to approved	70586	APPROVED
2001-04-19	P9ka	Protein 9 Ka homologous to calcium-binding protein	Symbol and name withdrawn	61478	WITHDRAWN
2001-04-19	S100a4	S100 calcium-binding protein A4	Symbol and name updated to reflect Human and Mouse nomenclature	61478	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_disease	has metastasis-inducing capabilities
gene_process	involved in the regulation of cell cycle progression, modulating intercellular adhesion, and invasive and metastatic properties of cancer cells
gene_regulation	expression increases at the onset of high-fat-diet obesity	625747
gene_regulation	expression is induced by nerve growth factor (NGF)	729699

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations