Nmbr (neuromedin B receptor) - Rat Genome Database

Name: Nmbr
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Nmbr (neuromedin B receptor) Rattus norvegicus

Analyze

Symbol:

Nmbr

Name:

neuromedin B receptor

RGD ID:

3181

Description:

Enables neuropeptide receptor activity. Predicted to be involved in several processes, including antiviral innate immune response; positive regulation of osteoclast proliferation; and regulation of cytokine production. Predicted to be located in cytosol and plasma membrane. Orthologous to human NMBR (neuromedin B receptor); INTERACTS WITH 2-methyl-4-chlorophenoxybutyric acid; 6-propyl-2-thiouracil; bisphenol A.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

hypothetical protein LOC681272; LOC100361806; LOC102552086; LOC681272; neuromedin-B receptor; neuromedin-B-preferring bombesin receptor; NMB-R; uncharacterized LOC102552086

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NMBR (neuromedin B receptor)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Nmbr (neuromedin B receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nmbr (neuromedin B receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NMBR (neuromedin B receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NMBR (neuromedin B receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nmbr (neuromedin B receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NMBR (neuromedin B receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NMBR (neuromedin B receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nmbr (neuromedin B receptor)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Nmbr (neuromedin B receptor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	NMBR (neuromedin B receptor)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nmbr (neuromedin B receptor)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CCHa1-R	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CCHa2-R	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nmbr	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	9,115,033 - 9,146,081 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	9,134,889 - 9,145,462 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	8,854,053 - 8,864,609 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	14,855,973 - 14,866,529 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	9,108,728 - 9,119,316 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	8,933,744 - 8,945,850 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	8,933,831 - 8,944,987 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	10,550,181 - 10,560,850 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	9,598,651 - 9,613,018 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	9,614,247 - 9,627,257 (+)	NCBI
Celera	1	7,611,477 - 7,622,026 (+)	NCBI		Celera
RH 3.4 Map	1	128.12	RGD
Cytogenetic Map	1	p13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Breast Neoplasms (ISO)

Familial Behcet-Like Autoinflammatory Syndrome (ISO)

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2-methyl-4-chlorophenoxybutyric acid (EXP)

6-propyl-2-thiouracil (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

bleomycin A2 (EXP)

butanal (ISO)

cadmium dichloride (EXP,ISO)

caffeine (ISO)

CGP 52608 (ISO)

cyromazine (EXP)

dioxygen (ISO)

diuron (EXP)

doxorubicin (ISO)

ethanol (ISO)

flavonoids (EXP)

fonofos (ISO)

furan (EXP)

heptanal (ISO)

hexamethylene diisocyanate (ISO)

hexanal (ISO)

hydrogen peroxide (ISO)

kuwanone H (EXP)

L-mimosine (ISO)

lead diacetate (EXP,ISO)

lipopolysaccharide (ISO)

nonanal (ISO)

octanal (ISO)

paraquat (EXP)

parathion (ISO)

pentanal (ISO)

pirimicarb (EXP)

propanal (ISO)

resveratrol (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sodium arsenite (ISO)

terbufos (ISO)

thiram (EXP)

triptonide (ISO)

ziram (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antiviral innate immune response (ISO,ISS)

bombesin receptor signaling pathway (IEA)

G protein-coupled receptor signaling pathway (IBA)

negative regulation of interleukin-6 production (ISO,ISS)

neuropeptide signaling pathway (IEA)

positive regulation of interferon-alpha production (ISO)

positive regulation of osteoclast proliferation (ISO,ISS)

positive regulation of respiratory gaseous exchange (ISO,ISS)

sneeze reflex (ISO,ISS)

Cellular Component

cytosol (IEA,ISO)

plasma membrane (IEA,ISO)

Molecular Function

bombesin receptor activity (IEA)

neuropeptide receptor activity (IBA,IPI)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
9.	cDNA cloning, characterization, and brain region-specific expression of a neuromedin-B-preferring bombesin receptor.	Wada E, etal., Neuron 1991 Mar;6(3):421-30.

Additional References at PubMed

PMID:8391296	PMID:26855425

Genomics

Comparative Map Data

Nmbr
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	9,115,033 - 9,146,081 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	9,134,889 - 9,145,462 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	1	8,854,053 - 8,864,609 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	1	14,855,973 - 14,866,529 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	1	9,108,728 - 9,119,316 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	1	8,933,744 - 8,945,850 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	8,933,831 - 8,944,987 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	10,550,181 - 10,560,850 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	1	9,598,651 - 9,613,018 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	1	9,614,247 - 9,627,257 (+)	NCBI
Celera	1	7,611,477 - 7,622,026 (+)	NCBI		Celera
RH 3.4 Map	1	128.12	RGD
Cytogenetic Map	1	p13	NCBI

NMBR
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	142,074,484 - 142,147,122 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	142,058,330 - 142,147,122 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	142,395,621 - 142,468,259 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	142,438,438 - 142,451,629 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	142,438,437 - 142,451,629	NCBI
Celera	6	143,137,223 - 143,150,416 (-)	NCBI		Celera
Cytogenetic Map	6	q24.1	NCBI
HuRef	6	139,962,598 - 139,975,792 (-)	NCBI		HuRef
CHM1_1	6	142,658,985 - 142,672,176 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	143,260,409 - 143,339,214 (-)	NCBI		T2T-CHM13v2.0

Nmbr
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	14,634,894 - 14,647,202 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	14,581,335 - 14,646,594 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	14,759,356 - 14,771,458 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	14,705,591 - 14,770,850 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	14,480,095 - 14,490,362 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	14,450,487 - 14,460,754 (+)	NCBI		MGSCv36	mm8
Celera	10	14,666,248 - 14,676,488 (+)	NCBI		Celera
Cytogenetic Map	10	A2	NCBI
cM Map	10	5.5	NCBI

Nmbr
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955436	18,116,274 - 18,127,045 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955436	18,116,274 - 18,127,045 (+)	NCBI	ChiLan1.0	ChiLan1.0

NMBR
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	6	159,928,484 - 160,016,139 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	139,842,329 - 139,915,173 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	143,915,784 - 143,988,667 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	143,917,130 - 143,930,363 (-)	Ensembl	panpan1.1		panPan2

NMBR
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	1	33,772,687 - 33,858,112 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	1	33,772,690 - 33,801,720 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	1	34,671,595 - 34,756,297 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	1	33,947,794 - 34,032,604 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	1	33,947,114 - 33,976,148 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	1	33,818,335 - 33,903,030 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	1	33,700,066 - 33,784,852 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	1	34,011,044 - 34,095,793 (-)	NCBI		UU_Cfam_GSD_1.0

Nmbr
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	128,751,204 - 128,762,908 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936625	3,873,062 - 3,883,172 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936625	3,872,786 - 3,883,478 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NMBR
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	22,972,885 - 22,988,179 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	22,972,049 - 22,989,188 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	25,808,851 - 25,823,914 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NMBR
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	31,170,727 - 31,193,830 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	13	31,171,670 - 31,192,008 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	3,248,199 - 3,315,563 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nmbr
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624753	12,017,711 - 12,028,673 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624753	12,017,650 - 12,029,360 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Nmbr
285 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	22
Count of miRNA genes:	20
Interacting mature miRNAs:	22
Transcripts:	ENSRNOT00000016215
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354647	Despr8	Despair related QTL 8		0.0000341	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	1	1	24744506	Rat
2298546	Neuinf4	Neuroinflammation QTL 4	5.1		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	1	1	28736750	Rat
2313053	Bss51	Bone structure and strength QTL 51	3.8	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	1	32356093	Rat
2313070	Bss52	Bone structure and strength QTL 52	4.4	0.0001	body length (VT:0001256)	body length (CMO:0000013)	1	1	32356093	Rat
2313090	Bmd69	Bone mineral density QTL 69	4.4	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	1	1	32356093	Rat
738020	Pia8	Pristane induced arthritis QTL 8	4.7		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	1	1	65833076	Rat
1578650	Bmd6	Bone mineral density QTL 6	12.2		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	1	509108	43284926	Rat
1578651	Bmd7	Bone mineral density QTL 7	14.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	1	509108	43284926	Rat
1578669	Bss9	Bone structure and strength QTL 9	6.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	1	509108	43284926	Rat
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
1600360	Mcs16	Mammary carcinoma susceptibility QTL 16	2.4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	1	2244390	43433040	Rat
1300170	Rf6	Renal function QTL 6	3.14		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	1	4162807	11481482	Rat
7421626	Bp360	Blood pressure QTL 360		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	4393289	49393289	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
4889451	Eae29	Experimental allergic encephalomyelitis QTL 29	5.51		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	1	5925877	24697545	Rat

Markers in Region

D1Arb44

Rat Assembly	Chr	Position (strand)	Source
Celera	1	7,618,203 - 7,618,331	UniSTS
RH 2.0 Map	1	47.1	RGD
SHRSP x BN Map	1	8.0799	RGD
Cytogenetic Map	1	p13	UniSTS

RH94761

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	9,145,279 - 9,145,458 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	8,945,058 - 8,945,236	NCBI	Rnor6.0
Rnor_5.0	1	10,560,668 - 10,560,846	UniSTS	Rnor5.0
RGSC_v3.4	1	9,627,075 - 9,627,253	UniSTS	RGSC3.4
Celera	1	7,621,844 - 7,622,022	UniSTS
RH 3.4 Map	1	128.12	UniSTS
Cytogenetic Map	1	p13	UniSTS

BF389161

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	1	10,550,509 - 10,550,632	NCBI	Rnor5.0
RGSC_v3.4	1	9,614,577 - 9,614,699	UniSTS	RGSC3.4
Celera	1	7,611,806 - 7,611,928	UniSTS
RH 3.4 Map	1	128.34	UniSTS
Cytogenetic Map	1	p13	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium
Low							1	1	58	24	17		1
Below cutoff	2	22	14	7	6	7	5	7	16	10	23	10	5

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012799	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017588815	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039101530	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039101531	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473994	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U37058	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000016215 ⟹ ENSRNOP00000016215

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	9,134,889 - 9,145,462 (+)	Ensembl
Rnor_6.0 Ensembl	1	8,933,901 - 8,944,961 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000076049 ⟹ ENSRNOP00000067986

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	9,134,950 - 9,145,209 (+)	Ensembl
Rnor_6.0 Ensembl	1	8,933,831 - 8,944,987 (+)	Ensembl

RefSeq Acc Id:

NM_012799 ⟹ NP_036931

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	9,134,889 - 9,145,462 (+)	NCBI
Rnor_6.0	1	8,933,770 - 8,945,240 (+)	NCBI
Rnor_5.0	1	10,550,181 - 10,560,850 (+)	NCBI
Celera	1	7,611,477 - 7,622,026 (+)	RGD

Sequence:

show sequence

GGTGGCTCAGTTCCAGGAGCCACAAACTTGCCAGGATCAGAGACAATCAACTAAACCCAGGTCG
TACTCACCGCACTTTCGAGACGCGCGAGTGCAGGAAAACTCCCGCGAATCCCCTGGGAAAGGAC
ACCATGCCCCCCAGGTCTCTCCCCAACCTCTCCTTGCCCACCGAGGCGAGCGAGAGCGAGTTGG
AACCCGAGGTGTGGGAAAATGATTTCCTGCCTGACTCAGACGGGACCACCGCGGAGTTGGTAAT
CCGCTGTGTGATACCATCCCTCTACCTAATCATCATCTCGGTGGGCTTGCTGGGCAACATCATG
CTGGTGAAGATATTCCTCACCAACAGCACCATGCGGAGTGTCCCCAACATCTTCATCTCTAACC
TGGCTGCGGGAGACCTGCTGCTGCTGCTGACCTGCGTCCCAGTGGATGCCTCCCGATACTTCTT
TGATGAATGGGTGTTCGGCAAGCTGGGCTGCAAACTCATCCCAGCCATCCAGCTCACCTCGGTG
GGGGTTTCCGTGTTCACTCTCACGGCCCTCAGCGCTGACAGGTACAGAGCTATCGTGAACCCCA
TGGACATGCAGACGTCTGGTGTGGTGCTGTGGACCAGTTTGAAGGCCGTGGGCATCTGGGTGGT
CTCTGTGCTGTTGGCTGTCCCTGAGGCTGTGTTTTCGGAAGTAGCACGCATCGGTAGCTCGGAT
AACAGCAGTTTCACAGCATGCATACCCTACCCACAAACAGATGAGTTACATCCAAAGATCCACT
CAGTGCTCATTTTTCTTGTCTATTTCCTCATACCCCTTGTTATCATCAGCATTTATTATTATCA
CATTGCGAAGACTTTAATTAGAAGTGCACACAATCTTCCTGGAGAATACAATGAACATACCAAA
AAGCAGATGGAGACACGGAAACGCCTGGCCAAGATCGTTCTGGTGTTTGTGGGCTGCTTTGTCT
TCTGCTGGTTTCCCAACCACATCCTCTACTTGTATAGGTCTTTCAACTACAAGGAGATCGATCC
TTCTCTTGGACACATGATTGTCACCTTAGTGGCCCGGGTTCTGAGTTTCAGCAACTCCTGTGTC
AACCCGTTTGCTCTTTACCTGCTCAGTGAAAGCTTCAGGAAGCATTTCAACAGCCAGCTCTGTT
GTGGGCAGAAGTCCTATCCTGAGAGGTCTACCAGCTACCTCCTCAGCTCTTCAGCAGTAAGAAT
GACTTCTCTGAAAAGCAACGCGAAGAATGTGGTGACCAATTCTGTCCTGCTCAACGGACATAGC
ACAAAGCAAGAAATAGCACTGTGATCGGAGACCATCCAATTCATCCTCGGGAAATACCATTTTC
ACAACTTTTCCATTATTATTGAGCGAAGCAGAGCTAAATAATCACCACATTTACACTGCTCCCC
AGCTAATTCATGATTGACTCAAGCGCAAGGCACGCACTTTTGTCTGAATAGAAAGAATTTTACC
TTACACCACCACACATCTAACTCACACGTAATTCACATATATCTCCTGCTAACATCGGTTTACA
CATTCCCTTGGGATTTAAGACATTCCAACAAGCAAATGTGGCATATTG

hide sequence

RefSeq Acc Id:

XM_039101530 ⟹ XP_038957458

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	9,115,033 - 9,146,081 (+)	NCBI

RefSeq Acc Id:

XM_039101531 ⟹ XP_038957459

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	9,116,849 - 9,146,081 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_036931	(Get FASTA)	NCBI Sequence Viewer
	XP_038957458	(Get FASTA)	NCBI Sequence Viewer
	XP_038957459	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA79881	(Get FASTA)	NCBI Sequence Viewer
	EDL93748	(Get FASTA)	NCBI Sequence Viewer
	P24053	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_036931 ⟸ NM_012799

- UniProtKB:

P24053 (UniProtKB/Swiss-Prot), A6JP76 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MPPRSLPNLSLPTEASESELEPEVWENDFLPDSDGTTAELVIRCVIPSLYLIIISVGLLGNIML
VKIFLTNSTMRSVPNIFISNLAAGDLLLLLTCVPVDASRYFFDEWVFGKLGCKLIPAIQLTSVG
VSVFTLTALSADRYRAIVNPMDMQTSGVVLWTSLKAVGIWVVSVLLAVPEAVFSEVARIGSSDN
SSFTACIPYPQTDELHPKIHSVLIFLVYFLIPLVIISIYYYHIAKTLIRSAHNLPGEYNEHTKK
QMETRKRLAKIVLVFVGCFVFCWFPNHILYLYRSFNYKEIDPSLGHMIVTLVARVLSFSNSCVN
PFALYLLSESFRKHFNSQLCCGQKSYPERSTSYLLSSSAVRMTSLKSNAKNVVTNSVLLNGHST
KQEIAL

hide sequence

RefSeq Acc Id:

ENSRNOP00000016215 ⟸ ENSRNOT00000016215

RefSeq Acc Id:

ENSRNOP00000067986 ⟸ ENSRNOT00000076049

RefSeq Acc Id:	XP_038957458 ⟸ XM_039101530
- Peptide Label:	isoform X1
- UniProtKB:	P24053 (UniProtKB/Swiss-Prot), A6JP76 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_038957459 ⟸ XM_039101531
- Peptide Label:	isoform X1
- UniProtKB:	P24053 (UniProtKB/Swiss-Prot), A6JP76 (UniProtKB/TrEMBL)

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P24053-F1-model_v2	AlphaFold	P24053	1-390	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3181	AgrOrtholog
BioCyc Gene	G2FUF-62339	BioCyc
Ensembl Genes	ENSRNOG00000012103	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000016215	ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOP00000067986.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000016215	ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ENSRNOT00000076049.2	UniProtKB/TrEMBL
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Bombsn_rcpt-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NeuroB_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25264	UniProtKB/Swiss-Prot
NCBI Gene	25264	ENTREZGENE
PANTHER	LEUCOKININ RECEPTOR-RELATED	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NEUROMEDIN-B RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	7tm_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Nmbr	PhenoGen
PRINTS	BOMBESINR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCRRHODOPSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NEUROMEDINBR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	7TM_GPCR_Srsx	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC228092
UniProt	A0A096MJ45_RAT	UniProtKB/TrEMBL
	A6JP76	ENTREZGENE, UniProtKB/TrEMBL
	F1M5M1_RAT	UniProtKB/TrEMBL
	NMBR_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Nmbr	neuromedin B receptor	LOC102552086	uncharacterized LOC102552086	Data Merged	737654	PROVISIONAL
2015-07-29	LOC102552086	uncharacterized LOC102552086	LOC681272	hypothetical protein LOC681272	Data Merged	737654	PROVISIONAL
2013-12-18	LOC102552086	uncharacterized LOC102552086			Symbol and Name status set to provisional	70820	PROVISIONAL
2013-03-29	Nmbr	neuromedin B receptor	LOC100361806	neuromedin B receptor	Data Merged	737654	PROVISIONAL
2010-05-05	LOC100361806	neuromedin B receptor			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	LOC681272	hypothetical protein LOC681272			Symbol and Name status set to provisional	70820	PROVISIONAL
2002-06-10	Nmbr	Neuromedin B receptor			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_function	higher affinity binding to neuromedin-B than to gastrin-releasing peptide (GRP)	69905

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD