Nedd8 (NEDD8 ubiquitin like modifier)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Nedd8 (NEDD8 ubiquitin like modifier) Rattus norvegicus

Analyze

Symbol:

Nedd8

Name:

NEDD8 ubiquitin like modifier

RGD ID:

3158

Description:

Predicted to enable protein tag and ubiquitin protein ligase binding activity. Involved in protein neddylation and response to organic cyclic compound. Predicted to be located in cytosol and nucleoplasm. Predicted to be active in cytoplasm and nucleus. Orthologous to human NEDD8 (NEDD8 ubiquitin like modifier); PARTICIPATES IN neddylation pathway; p53 signaling pathway; proteasome degradation pathway involving cullin-dependent ubiquitin ligases; INTERACTS WITH 17alpha-ethynylestradiol; 2,3,7,8-tetrachlorodibenzodioxine; 2,6-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

CDK8; MGC105320; neddylin; neural precursor cell expressed, developmentally down-regulated 8; neural precursor cell expressed, developmentally down-regulated gene 8; ubiquitin-like protein Nedd8

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NEDD8 (NEDD8 ubiquitin like modifier)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Nedd8 (neural precursor cell expressed, developmentally down-regulated gene 8)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nedd8 (NEDD8 ubiquitin like modifier)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NEDD8 (NEDD8 ubiquitin like modifier)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NEDD8 (NEDD8 ubiquitin like modifier)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nedd8 (NEDD8 ubiquitin like modifier)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NEDD8 (NEDD8 ubiquitin like modifier)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NEDD8 (NEDD8 ubiquitin like modifier)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nedd8 (NEDD8 ubiquitin like modifier)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Nedd8 (neural precursor cell expressed, developmentally down-regulated gene 8)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	NEDD8 (NEDD8 ubiquitin like modifier)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nedd8l (neural precursor cell expressed, developmentally down-regulated 8, like)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	nedd8 (neural precursor cell expressed, developmentally down-regulated 8)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	ned-8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Nedd8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RUB1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nedd8	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	15	29,153,556 - 29,165,575 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	29,153,556 - 29,166,160 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	30,999,240 - 31,011,260 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	15	32,146,461 - 32,158,481 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	15	30,388,805 - 30,400,824 (-)	NCBI	Rnor_WKY
Rnor_6.0	15	34,340,607 - 34,352,673 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	34,340,607 - 34,352,673 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	38,230,806 - 38,242,650 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	33,797,457 - 33,820,624 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	33,813,156 - 33,836,123 (-)	NCBI
Celera	15	28,729,741 - 28,741,968 (-)	NCBI		Celera
Cytogenetic Map	15	p13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Alcoholic Liver Diseases (ISO)

Brain-Lung-Thyroid Syndrome (ISO)

lysinuric protein intolerance (ISO)

malignant astrocytoma (ISO)

Parkinson's disease (ISO)

Specific Granule Deficiency (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,6-dinitrotoluene (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (EXP)

acetohydrazide (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

Benzo[ghi]perylene (ISO)

beryllium sulfate (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (EXP,ISO)

cadmium atom (ISO)

CGP 52608 (ISO)

chloropicrin (ISO)

clofibric acid (EXP)

cobalt dichloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dibutyl phthalate (ISO)

dieldrin (EXP)

elemental selenium (ISO)

flutamide (EXP)

folic acid (ISO)

indometacin (ISO)

ivermectin (ISO)

nimesulide (EXP)

pirinixic acid (ISO)

quercetin (ISO)

selenium atom (ISO)

sodium arsenite (ISO)

tetrachloromethane (ISO)

tungsten (ISO)

vitamin E (ISO)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

modification-dependent protein catabolic process (IBA)

protein localization (ISO)

protein neddylation (IBA,IDA,ISO)

protein ubiquitination (IBA)

regulation of proteolysis (IBA)

regulation of transcription by RNA polymerase II (ISO)

response to organic cyclic compound (IDA)

Cellular Component

cytosol (ISO)

nucleoplasm (ISO)

nucleus (ISO)

Molecular Function

protein binding (ISO)

protein tag (IBA)

ubiquitin protein ligase binding (IBA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

neddylation pathway (ISS)

p53 signaling pathway (ISO)

proteasome degradation pathway involving cullin-dependent ubiquitin ligases (ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Expression of VACM-1/cul5 mutant in endothelial cells induces MAPK phosphorylation and maspin degradation and converts cells to the angiogenic phenotype.	Buchwalter A, etal., Microvasc Res. 2008 Mar;75(2):155-68. Epub 2007 Sep 4.
2.	APP-BP1 mediates APP-induced apoptosis and DNA synthesis and is increased in Alzheimer's disease brain.	Chen Y, etal., J Cell Biol. 2003 Oct 13;163(1):27-33.
3.	Cullin-based ubiquitin ligase and its control by NEDD8-conjugating system.	Chiba T and Tanaka K, Curr Protein Pept Sci 2004 Jun;5(3):177-84.
4.	NEDD8 protein is involved in ubiquitinated inclusion bodies.	Dil Kuazi A, etal., J Pathol 2003 Feb;199(2):259-66.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	Comparative expressed-sequence-tag analysis of differential gene expression profiles in PC-12 cells before and after nerve growth factor treatment.	Lee NH, etal., Proc Natl Acad Sci U S A 1995 Aug 29;92(18):8303-7.
8.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
9.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
11.	GOA pipeline	RGD automated data pipeline
12.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:9125149	PMID:10500095	PMID:12215427	PMID:12477932	PMID:15489334	PMID:15694336	PMID:20458337	PMID:21808025	PMID:22871113	PMID:23376485

Genomics

Comparative Map Data

Nedd8
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	15	29,153,556 - 29,165,575 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	15	29,153,556 - 29,166,160 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	15	30,999,240 - 31,011,260 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	15	32,146,461 - 32,158,481 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	15	30,388,805 - 30,400,824 (-)	NCBI	Rnor_WKY
Rnor_6.0	15	34,340,607 - 34,352,673 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	15	34,340,607 - 34,352,673 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	15	38,230,806 - 38,242,650 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	15	33,797,457 - 33,820,624 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	15	33,813,156 - 33,836,123 (-)	NCBI
Celera	15	28,729,741 - 28,741,968 (-)	NCBI		Celera
Cytogenetic Map	15	p13	NCBI

NEDD8
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	24,216,857 - 24,232,367 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	14	24,216,857 - 24,232,367 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	24,686,063 - 24,701,573 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	23,755,897 - 23,771,416 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	23,755,911 - 23,771,412	NCBI
Celera	14	4,550,695 - 4,566,214 (-)	NCBI		Celera
Cytogenetic Map	14	q12	NCBI
HuRef	14	4,801,062 - 4,816,345 (-)	NCBI		HuRef
CHM1_1	14	24,684,707 - 24,700,199 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	14	18,415,233 - 18,430,739 (-)	NCBI		T2T-CHM13v2.0

Nedd8
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	14	55,899,720 - 55,909,337 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	14	55,899,720 - 55,909,581 (-)	Ensembl		GRCm39 Ensembl
GRCm38	14	55,662,263 - 55,671,880 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	14	55,662,263 - 55,672,124 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	14	56,281,104 - 56,290,743 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	14	54,616,338 - 54,625,977 (-)	NCBI		MGSCv36	mm8
Celera	14	53,467,340 - 53,476,979 (-)	NCBI		Celera
Cytogenetic Map	14	C3	NCBI
cM Map	14	28.19	NCBI

Nedd8
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955409	36,173,533 - 36,182,444 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955409	36,173,533 - 36,182,444 (+)	NCBI	ChiLan1.0	ChiLan1.0

NEDD8
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	14	24,787,569 - 24,803,136 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	14	4,993,011 - 5,008,620 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	14	23,117,271 - 23,132,249 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	14	23,117,271 - 23,132,249 (-)	Ensembl	panpan1.1		panPan2

NEDD8
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	4,202,621 - 4,213,090 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	4,202,621 - 4,213,049 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	4,124,303 - 4,134,768 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	4,313,388 - 4,323,857 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	4,313,388 - 4,323,818 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	4,003,790 - 4,014,244 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	4,065,590 - 4,076,046 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	4,327,911 - 4,338,370 (-)	NCBI		UU_Cfam_GSD_1.0

Nedd8
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	36,050,496 - 36,058,043 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936722	331,136 - 338,496 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936722	331,116 - 338,496 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NEDD8
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	75,070,161 - 75,085,899 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	75,069,947 - 75,085,905 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	80,340,870 - 80,353,291 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NEDD8
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	1,199,974 - 1,215,079 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666036	12,884,384 - 12,899,520 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nedd8
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624820	8,319,832 - 8,329,748 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624820	8,319,763 - 8,329,748 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Nedd8
48 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	48
Count of miRNA genes:	40
Interacting mature miRNAs:	47
Transcripts:	ENSRNOT00000064916
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354657	Despr13	Despair related QTL 13		0.0022	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	15	1	29912054	Rat
8552920	Pigfal8	Plasma insulin-like growth factor 1 level QTL 8	3		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	15	1	34723002	Rat
8694361	Abfw6	Abdominal fat weight QTL 6	10.2	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	15	1	34723002	Rat
9589149	Insul29	Insulin level QTL 29	9.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	15	1	34723002	Rat
731170	Pur3	Proteinuria QTL 3	2.3	0.0005	urine protein amount (VT:0005160)	urine protein excretion rate (CMO:0000759)	15	1	41686771	Rat
1641887	Alcrsp14	Alcohol response QTL 14			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	15	1	42356671	Rat
2298549	Neuinf12	Neuroinflammation QTL 12	3.5		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	15	1	55302115	Rat
10401805	Kidm51	Kidney mass QTL 51			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	15	306329	45306329	Rat
738017	Hcas7	Hepatocarcinoma susceptibility QTL 7	2.91		liver integrity trait (VT:0010547)	liver nonremodeling tumorous lesion volume to total liver volume ratio (CMO:0001464)	15	2266368	46921453	Rat
1582251	Gluco24	Glucose level QTL 24	3.2	0.0008	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	15	5530756	50530756	Rat
631273	Lecl2	Lens clarity QTL 2		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	15	10596089	55596089	Rat
2300167	Bmd63	Bone mineral density QTL 63	5.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	15	11111142	56111142	Rat
2300173	Bmd62	Bone mineral density QTL 62	12.8	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	15	11111142	56111142	Rat
2293688	Bss29	Bone structure and strength QTL 29	5.31	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	15	11111142	56111142	Rat
2317750	Glom26	Glomerulus QTL 26	4.3		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	15	12496141	65205939	Rat
61424	Scl1	Serum cholesterol level QTL 1	7.7	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	15	16725528	80672115	Rat
1331729	Rf42	Renal function QTL 42	3.071		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	15	17362897	73690657	Rat
631550	Bw7	Body weight QTL 7	3.6		body mass (VT:0001259)	body weight (CMO:0000012)	15	19856566	34924750	Rat
2324620	Coatc3	Coat color QTL 3			coat/hair pigmentation trait (VT:0010463)	pigmented coat/hair area to total coat/hair area ratio (CMO:0001810)	15	19856566	46187442	Rat
10054130	Srcrt8	Stress Responsive Cort QTL 8	2.18	0.0085	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	15	22117933	67117933	Rat
1578646	Bmd18	Bone mineral density QTL 18	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	15	22806240	98288169	Rat
1578647	Bmd17	Bone mineral density QTL 17	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	15	22806240	98288169	Rat
1578660	Bss19	Bone structure and strength QTL 19	4.3		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	15	22806240	98288169	Rat
1582214	Stl21	Serum triglyceride level QTL 21	3.1	0.022	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	15	28030665	82262678	Rat
1582227	Gluco30	Glucose level QTL 30	3.6	0.0003	blood glucose amount (VT:0000188)	absolute change in blood glucose level area under curve (CMO:0002034)	15	28030665	82262678	Rat
1582228	Epfw3	Epididymal fat weight QTL 3	4.1	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	28030665	82262678	Rat
1582242	Gluco28	Glucose level QTL 28	3.3	0.0008	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	15	28030665	82262678	Rat
1582244	Bw79	Body weight QTL 79	4	0.0002	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	15	28030665	82262678	Rat

Markers in Region

RH129220

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	15	29,153,591 - 29,153,782 (+)	MAPPER	mRatBN7.2
Rnor_6.0	15	34,340,643 - 34,340,833	NCBI	Rnor6.0
Rnor_5.0	15	38,230,842 - 38,231,032	UniSTS	Rnor5.0
RGSC_v3.4	15	33,797,493 - 33,797,683	UniSTS	RGSC3.4
Celera	15	28,729,777 - 28,729,967	UniSTS
Cytogenetic Map	15	p13	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_138878	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC116083	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF095740	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC084728	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CB581170	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474049	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230524	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000268	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X89819	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000064916 ⟹ ENSRNOP00000061284

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	29,153,557 - 29,165,611 (-)	Ensembl
Rnor_6.0 Ensembl	15	34,340,607 - 34,352,673 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000080232 ⟹ ENSRNOP00000073032

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	15	34,340,872 - 34,342,373 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000104192 ⟹ ENSRNOP00000091841

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	15	29,153,556 - 29,166,160 (-)	Ensembl

RefSeq Acc Id:

NM_138878 ⟹ NP_620233

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	15	29,153,556 - 29,165,575 (-)	NCBI
Rnor_6.0	15	34,340,607 - 34,352,673 (-)	NCBI
Rnor_5.0	15	38,230,806 - 38,242,650 (-)	NCBI
RGSC_v3.4	15	33,797,457 - 33,820,624 (-)	RGD
Celera	15	28,729,741 - 28,741,968 (-)	RGD

Sequence:

show sequence

GACACGTGCGGGGTCTCAGGTGTCGTCTGGCTCTTCCTAAATCGGTTTTCCTTTCTCTTTACAA
CCCAACTGACACAAAATCCGAGGGCACTCCTGAGCGTTTCGGGAACCGGCTGGAAAGAGGAGCG
GGTGGGTCCGGAGAGTGACCCGGAAGCAGAAGTGTTCCTCGCCGTGGAGTGCTGGGAAGCGGCA
GCGGCAGTAGCGACCACAGCGGGAGAAGCAGCACTCTAGCCGCCTGTAACCCCAACCTGGGAGG
AAGATGCTAATTAAAGTGAAGACGCTGACTGGAAAGGAGATTGAGATTGACATCGAACCCACAG
ACAAGGTGGAACGAATCAAGGAGCGTGTGGAAGAAAAAGAAGGAATTCCCCCACAACAGCAGCG
GCTCATCTACAGTGGCAAACAAATGAATGATGAGAAGACAGCAGCTGATTACAAGATTCTAGGT
GGTTCCGTCCTCCACCTGGTGTTGGCTCTTAGAGGAGGTGGTGGTCTTGGGCAATGAAGAAACT
TGATTCTGTTTTACCTCCTTGTCCTGCCGCTCATAATGTGGCATCACATATCCTCTCACTCTCT
GGGACACCAGAGCTACTGCCCCCTTCCTTGGATGCCCAATCTTGTGTGTCTACTGGTGGGAGAA
TGTGAGGACCCCAGGATGCAGTGTTCCTGGCCCAAATGGCCCTTGCTGGCCATTGGGTTTTAGT
TTGCAGTCCTGTGTGCTTCCCTCTCTTATGGCTATATCCTTGGTTGTCAATAAAATATTTCCTG
GCAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_620233	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC64189	(Get FASTA)	NCBI Sequence Viewer
	AAH84728	(Get FASTA)	NCBI Sequence Viewer
	EDM14262	(Get FASTA)	NCBI Sequence Viewer
	EDM14263	(Get FASTA)	NCBI Sequence Viewer
	EDM14264	(Get FASTA)	NCBI Sequence Viewer
	Q71UE8	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_620233 ⟸ NM_138878
- UniProtKB:	Q71UE8 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MLIKVKTLTGKEIEIDIEPTDKVERIKERVEEKEGIPPQQQRLIYSGKQMNDEKTAADYKILGG SVLHLVLALRGGGGLGQ hide sequence

RefSeq Acc Id:

ENSRNOP00000073032 ⟸ ENSRNOT00000080232

RefSeq Acc Id:

ENSRNOP00000061284 ⟸ ENSRNOT00000064916

RefSeq Acc Id:

ENSRNOP00000091841 ⟸ ENSRNOT00000104192

Protein Domains

Ubiquitin-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q71UE8-F1-model_v2	AlphaFold	Q71UE8	1-81	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699681

Promoter ID:

EPDNEW_R10204

Type:

initiation region

Name:

Nedd8_1

Description:

neural precursor cell expressed, developmentally down-regulated8

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R10205

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	15	34,352,482 - 34,352,542	EPDNEW

RGD ID:

13699682

Promoter ID:

EPDNEW_R10205

Type:

initiation region

Name:

Nedd8_2

Description:

neural precursor cell expressed, developmentally down-regulated8

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Alternative Promoters:

null; see alsoEPDNEW_R10204

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	15	34,352,714 - 34,352,774	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3158	AgrOrtholog
BioCyc Gene	G2FUF-13699	BioCyc
Ensembl Genes	ENSRNOG00000019895	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000061284	ENTREZGENE
	ENSRNOP00000061284.1	UniProtKB/Swiss-Prot
	ENSRNOP00000091841.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000064916	ENTREZGENE
	ENSRNOT00000064916.3	UniProtKB/Swiss-Prot
	ENSRNOT00000104192.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7315541	IMAGE-MGC_LOAD
InterPro	Nedd8-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ubiquitin	UniProtKB/Swiss-Prot
	Ubiquitin-like_dom	UniProtKB/TrEMBL
	Ubiquitin-like_domsf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ubiquitin_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ubiquitin_dom	UniProtKB/Swiss-Prot
	Ubiquitin_dom	UniProtKB/TrEMBL
KEGG Report	rno:25490	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:105320	IMAGE-MGC_LOAD
NCBI Gene	25490	ENTREZGENE
PANTHER	NEDD8	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UBIQUITIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	ubiquitin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Nedd8	PhenoGen
PRINTS	UBIQUITIN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	UBIQUITIN_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	UBIQUITIN_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	UBQ	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF54236	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6AG01_RAT	UniProtKB/TrEMBL
	NEDD8_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-08-08	Nedd8	NEDD8 ubiquitin like modifier	Nedd8	neural precursor cell expressed, developmentally down-regulated 8	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Nedd8	neural precursor cell expressed, developmentally down-regulated 8	Nedd8	neural precursor cell expressed, developmentally down-regulated gene 8	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Nedd8	Neural precursor cell expressed, developmentally down-regulated gene 8			Symbol and Name status set to approved	70586	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations

Imported Annotations - PID (archival)