Nbl1 (NBL1, DAN family BMP antagonist)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Community Projects Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Nbl1 (NBL1, DAN family BMP antagonist) Rattus norvegicus

Analyze

Symbol:

Nbl1

Name:

NBL1, DAN family BMP antagonist

RGD ID:

3151

Description:

Predicted to enable BMP binding activity; identical protein binding activity; and morphogen activity. Predicted to be involved in several processes, including determination of dorsal identity; negative regulation of BMP signaling pathway; and negative regulation of monocyte chemotaxis. Predicted to act upstream of or within neuron projection morphogenesis and positive regulation of neuron differentiation. Predicted to be located in extracellular region and membrane. Predicted to be active in extracellular space. Orthologous to several human genes including NBL1 (NBL1, DAN family BMP antagonist); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 4,4'-sulfonyldiphenol; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

N03; neuroblastoma 1; neuroblastoma 1, DAN family BMP antagonist; neuroblastoma suppression of tumorigenicity 1; Neuroblastoma suppression of tumorigenicity 1 (DNA segment human D1S1733E); neuroblastoma suppressor of tumorigenicity 1; neuroblastoma, suppression of tumorigenicity 1; Neuroblastoma, suppression of tumorigenicity 1 (DNA segment human D1S1733E); zinc finger protein DAN

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	NBL1 (NBL1, DAN family BMP antagonist)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, OMA, Panther
Mus musculus (house mouse):	Nbl1 (NBL1, DAN family BMP antagonist)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Nbl1 (NBL1, DAN family BMP antagonist)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	NBL1 (NBL1, DAN family BMP antagonist)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	NBL1 (NBL1, DAN family BMP antagonist)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Nbl1 (NBL1, DAN family BMP antagonist)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	NBL1 (NBL1, DAN family BMP antagonist)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	NBL1 (NBL1, DAN family BMP antagonist)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Nbl1 (NBL1, DAN family BMP antagonist)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	MICOS10-NBL1 (MICOS10-NBL1 readthrough)	HGNC	HomoloGene
Homo sapiens (human):	ZNF526 (zinc finger protein 526)	HGNC	OMA
Alliance orthologs ³
Homo sapiens (human):	NBL1 (NBL1, DAN family BMP antagonist)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Nbl1 (NBL1, DAN family BMP antagonist)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	MICOS10-NBL1 (MICOS10-NBL1 readthrough)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	nbl1 (NBL1, DAN family BMP antagonist)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	nbl1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	151,318,752 - 151,329,948 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	151,318,754 - 151,338,719 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	154,015,980 - 154,027,177 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	155,790,290 - 155,801,487 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	155,772,293 - 155,783,465 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	157,524,569 - 157,535,701 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	157,524,513 - 157,535,664 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	161,263,765 - 161,274,897 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	5	149,703,598 - 149,714,771 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

3-Hydroxy-3-Methylglutaryl-CoA Lyase Deficiency (ISO)

chromosome 1p36 deletion syndrome (ISO)

congenital disorder of glycosylation Ir (ISO)

genetic disease (ISO)

hyperprolinemia type 2 (ISO)

Parkinson's disease 6 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

14-Deoxy-11,12-didehydroandrographolide (ISO)

17beta-estradiol (ISO)

17beta-hydroxy-5alpha-androstan-3-one (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-methylcholine (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

4-hydroxyphenyl retinamide (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP,ISO)

aflatoxin B1 (EXP,ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

ammonium chloride (EXP)

amphetamine (EXP)

Aroclor 1254 (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP,ISO)

cadmium dichloride (EXP)

calcitriol (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

carmustine (ISO)

choline (ISO)

chromium(6+) (ISO)

cisplatin (EXP,ISO)

cobalt dichloride (ISO)

dexamethasone (EXP)

diazinon (ISO)

dibutyl phthalate (EXP,ISO)

dimethylarsinic acid (EXP)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

entinostat (ISO)

folic acid (ISO)

furan (EXP)

gentamycin (EXP)

glycine betaine (EXP)

L-methionine (ISO)

lead(0) (ISO)

methimazole (EXP)

methotrexate (ISO)

methylmercury chloride (ISO)

N-methyl-N'-nitro-N-nitrosoguanidine (ISO)

nitrofen (EXP)

O-methyleugenol (ISO)

paracetamol (EXP,ISO)

raloxifene (EXP)

SB 431542 (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (ISO)

sulfadimethoxine (EXP)

temozolomide (ISO)

testosterone (EXP,ISO)

trichloroethene (ISO)

trichostatin A (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

animal organ morphogenesis (IBA)

determination of dorsal identity (ISO)

negative regulation of BMP signaling pathway (ISO,ISS)

negative regulation of monocyte chemotaxis (ISO)

nervous system development (ISO)

neuron differentiation (ISO)

neuron projection morphogenesis (ISO)

positive regulation of neuron differentiation (ISO)

sequestering of BMP from receptor via BMP binding (IBA,IEA,ISO)

sequestering of BMP in extracellular matrix (ISO)

signal transduction (IEA)

Cellular Component

extracellular region (IEA)

extracellular space (IBA,IEA,ISO,ISS)

membrane (IEA)

Molecular Function

BMP binding (IBA,ISO)

identical protein binding (IEA,ISO)

morphogen activity (ISO)

protein binding (ISO)

receptor ligand activity (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
4.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
5.	Molecular cloning and characterization of a cDNA showing negative regulation in v-src-transformed 3Y1 rat fibroblasts.	Ozaki T and Sakiyama S, Proc Natl Acad Sci U S A 1993 Apr 1;90(7):2593-7.
6.	GOA pipeline	RGD automated data pipeline
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.

Additional References at PubMed

PMID:7942277	PMID:9268694	PMID:9660951	PMID:10390159	PMID:11594460	PMID:15528323	PMID:16325379	PMID:22357543	PMID:23063586	PMID:23676271	PMID:25561725

Genomics

Comparative Map Data

Nbl1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	151,318,752 - 151,329,948 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	151,318,754 - 151,338,719 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	154,015,980 - 154,027,177 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	155,790,290 - 155,801,487 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	155,772,293 - 155,783,465 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	157,524,569 - 157,535,701 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	157,524,513 - 157,535,664 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	161,263,765 - 161,274,897 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	5	149,703,598 - 149,714,771 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

NBL1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	19,643,229 - 19,658,452 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	19,596,979 - 19,658,456 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	19,969,723 - 19,984,945 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	19,842,313 - 19,857,532 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	19,715,031 - 19,730,251	NCBI
Celera	1	18,296,492 - 18,311,717 (+)	NCBI		Celera
Cytogenetic Map	1	p36.13	NCBI
HuRef	1	18,215,821 - 18,231,031 (+)	NCBI		HuRef
CHM1_1	1	20,078,997 - 20,094,228 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	19,466,606 - 19,481,830 (+)	NCBI		T2T-CHM13v2.0

Nbl1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	138,809,602 - 138,820,437 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	138,809,595 - 138,820,304 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	139,082,291 - 139,093,126 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	139,082,284 - 139,092,993 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	138,638,207 - 138,648,885 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	138,354,368 - 138,364,941 (-)	NCBI		MGSCv36	mm8
Celera	4	140,868,231 - 140,871,576 (-)	NCBI		Celera
Cytogenetic Map	4	D3	NCBI
cM Map	4	70.57	NCBI

Nbl1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955452	308,573 - 319,989 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955452	316,867 - 319,883 (+)	NCBI	ChiLan1.0	ChiLan1.0

NBL1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	1	206,577,562 - 206,591,747 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	18,599,121 - 18,613,305 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	19,652,853 - 19,656,431 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	19,641,279 - 19,656,431 (+)	Ensembl	panpan1.1		panPan2

NBL1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	79,040,206 - 79,102,792 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	79,041,105 - 79,102,820 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	75,554,895 - 75,582,497 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	79,607,161 - 79,634,902 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	79,608,223 - 79,610,312 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	76,425,235 - 76,452,808 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	77,434,195 - 77,461,836 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	78,503,885 - 78,531,526 (-)	NCBI		UU_Cfam_GSD_1.0

Nbl1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	39,996,034 - 40,018,509 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	5,840,240 - 5,859,749 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936474	5,820,798 - 5,843,291 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

NBL1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	78,059,392 - 78,071,604 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	78,046,084 - 78,071,609 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	72,138,765 - 72,142,022 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

NBL1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	112,893,928 - 112,908,041 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	112,893,633 - 112,897,355 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666033	3,253,483 - 3,267,595 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Nbl1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	4,764,903 - 4,775,707 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624764	4,771,334 - 4,774,462 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Nbl1
34 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	138
Count of miRNA genes:	99
Interacting mature miRNAs:	114
Transcripts:	ENSRNOT00000072299
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	132717196	165560427	Rat
631562	Apr2	Acute phase response QTL 2	3.7		blood murinoglobulin 1 amount (VT:0010597)	plasma murinoglobulin 1 level (CMO:0001931)	5	135927956	166875058	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	135929696	166875058	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	143069996	166846814	Rat
2302369	Scl60	Serum cholesterol level QTL 60	3.13		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	143608201	161165651	Rat
631263	Cm24	Cardiac mass QTL 24	3.5		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	143799107	158428037	Rat
1300119	Bp180	Blood pressure QTL 180	3.82		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	144358090	157869054	Rat
2313096	Bmd78	Bone mineral density QTL 78	3.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	5	144377876	161317411	Rat
1298090	Bp155	Blood pressure QTL 155	3.8		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	151006154	161165494	Rat
1354631	Swd2	Spike wave discharge measurement QTL 2	3.64	0.0002	brain electrophysiology trait (VT:0010557)	brain total spike-and-wave discharge duration (CMO:0001740)	5	151113452	164465185	Rat
631272	Lanf1	Left ventricular atrial natriuretic factor QTL 1	12		heart left ventricle natriuretic peptide A amount (VT:0010596)	heart left ventricle natriuretic peptide A level (CMO:0002165)	5	151113452	166875058	Rat

Markers in Region

AA963347

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	151,318,773 - 151,318,925 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	157,524,591 - 157,524,742	NCBI	Rnor6.0
Rnor_5.0	5	161,263,787 - 161,263,938	UniSTS	Rnor5.0
Celera	5	149,703,620 - 149,703,771	UniSTS
RH 3.4 Map	5	1032.4	UniSTS
Cytogenetic Map	5	q36.13	UniSTS

AU047985

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	151,326,895 - 151,327,192 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	157,532,649 - 157,532,945	NCBI	Rnor6.0
Rnor_5.0	5	161,271,845 - 161,272,141	UniSTS	Rnor5.0
Cytogenetic Map	5	q36.13	UniSTS

UniSTS:224311

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	151,319,532 - 151,319,694 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	157,525,350 - 157,525,511	NCBI	Rnor6.0
Rnor_5.0	5	161,264,546 - 161,264,707	UniSTS	Rnor5.0
Celera	5	149,704,379 - 149,704,540	UniSTS
Cytogenetic Map	5	q36.13	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	26	10		8		8	11	72	35	35	11	8
Low		17	47	41	11	41			2		6
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_031609	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008764284	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC061833	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	S72637	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X66872	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000072299 ⟹ ENSRNOP00000064345

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	151,318,754 - 151,329,948 (-)	Ensembl
Rnor_6.0 Ensembl	5	157,524,513 - 157,535,664 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000101272 ⟹ ENSRNOP00000079581

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	151,318,754 - 151,338,719 (-)	Ensembl

RefSeq Acc Id:

NM_031609 ⟹ NP_113797

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	151,318,752 - 151,329,948 (-)	NCBI
Rnor_6.0	5	157,524,569 - 157,535,701 (-)	NCBI
Rnor_5.0	5	161,263,765 - 161,274,897 (-)	NCBI
Celera	5	149,703,598 - 149,714,771 (-)	RGD

Sequence:

show sequence

GCGCCTCGCCCCGCCCGGGGCCGCAGACGGCCAGCAGCGACAGACAGCCGAGCCTCGCGGGGCC
GTCCCAGCCCGAGGACCCCGGGCCTGCGACCCCCGCGGCTCGCATCCCACTTTCTAAGACCTCT
AAGAGGACGCGCCGGCCTCTTCGCGGCCACCGCGCGCGTTCCAGGGCTCCGGAGGTGACAGGCA
CAATGCTTTGGGTCCTGGTGGGGACTGTTCTCCCTGTCATGTTGCTGGCTGCCCCACCACCCAT
CAACAAGCTGGCCCTGTTTCCGGACAAGAGTGCCTGGTGCGAAGCCAAGAACATCACGCAGATT
GTGGGCCACAGCGGCTGTGAGGCCAAGTCTATCCAGAACAGGGCGTGCCTAGGACAATGCTTCA
GTTACAGCGTCCCCAACACCTTCCCGCAGTCCACAGAGTCCCTGGTGCACTGTGACTCCTGCAT
GCCGGCCCAGTCCATGTGGGAGATTGTGACCTTGGAGTGCCCCGGCCACGAGGAGGTGCCCAGG
GTGGACAAGCTGGTTGAGAAGATTGTACACTGCAGCTGCCAAGCCTGCGGCAAGGAACCCAGTC
ATGAGGGCCTGAACGTCTACATGCAGGGTGAAGATGGGCCAGGCTCCCAGCCAGGATCGCACTC
CCACTCCCATCCCCACCCTGGGTGCCAGACCCCTGAACCTGAAGAACCTCCTGGAGCCCCTCAA
GTTGAGGAAGAGGGGGCTGAGGACTGAGGGCCCCCAACTCTTCCTCCCCTCTTGTCCCCTGTGG
AATGTCTGGTCCCACCCTCCAGGGAAGAGGGAGGGGAGAGGCAGAGGCCCCCCTCCCCCTCTGG
CACTAGATGGACTTGGAATGTTGCCTGGTTGCCATGGAGATCTGAAGGGAGGGGCTGGAGCCAA
GCTGCACGATTTAATATATGCAAGATGAGGGGAGGAAGCAGACATCTTTGGGACTTTTCTTTTG
GAAGGTGAAGTGTGGTCTTTCCTTTCAGCCTTCTGGAGAGGAGCCCTCTGGATAGAGAGGAAGC
AGGTTGAGCTGCTGAGGATGACTGAGATCCTCAGATAGGGCAGGCCCAGGTCAGGACCCAGACA
ACGGATGGGGCAGGATCCCCAGTGACGGGCAGAGGGTGGGTATCATGTCAGCATCCCCTTTGCA
GGAGGATCTAGGTAGGAAGACAGCTGGCAGAAGTCGGAAACTCCAGCCCCATAGGTTTCCCTAA
AGGCCTCCCCTCATGTAACCCCTTCAATGGAGTGGCTTAGGAGTCAGGCTGGGGCAGGACCCTG
CTGACTCAGGTGCCAGAGTGTCACTGAAGAAGAAAGAAGATCCCTCTCCCCCACACCCTGTCCC
TCCCTCCAGAGATCTTAGCTCTTTGCTCTCCCCAAGTTCTGGACTCTTCTGAAAACAGCTGCAA
CCGGTCCTGCCGTCCTTGGGGCTGGTCTTTCTGAAAGAGGTGACAGTTTATCCCCATCACCTGG
GACCGTAGTGGACAGGAGGCCCCTGCCTAGGGCCCCTGCTGACCTCAGCTTTCTCTAGCTCCTT
ATTCTATCCACTCCTTCTTCCCAGCTGCACTTTAACCTTAGGGCAGGGCAGGTGGCGAGGAAGG
GCCCTCTGTCTCCTTATCTGCTGGCACCATTGTGTCCAGGGGGTTGCCAGCTCACCCCCTCCCT
GGGGGTGCCCCAGCCCATGGCTGTTTGACGAGAGCCTTAGAGCTTGTAACTAGTAGCCATCTCC
CCTGAACCTGAGTGTTTCCATGAATAAAATGCCTTCAACGCCTCTACAAAAAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_113797	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB32215	(Get FASTA)	NCBI Sequence Viewer
	AAH61833	(Get FASTA)	NCBI Sequence Viewer
	CAA47344	(Get FASTA)	NCBI Sequence Viewer
	EDL80903	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000064345
	ENSRNOP00000064345.1
	ENSRNOP00000079581.1
GenBank Protein	Q06880	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_113797 ⟸ NM_031609
- Peptide Label:	precursor
- UniProtKB:	Q6P750 (UniProtKB/Swiss-Prot), Q06880 (UniProtKB/Swiss-Prot), A0A0G2JSZ3 (UniProtKB/TrEMBL), A6ITK2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLWVLVGTVLPVMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFS YSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKIVHCSCQACGKEPSH EGLNVYMQGEDGPGSQPGSHSHSHPHPGCQTPEPEEPPGAPQVEEEGAED hide sequence

RefSeq Acc Id:

ENSRNOP00000064345 ⟸ ENSRNOT00000072299

RefSeq Acc Id:

ENSRNOP00000079581 ⟸ ENSRNOT00000101272

Protein Domains

CTCK

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q06880-F1-model_v2	AlphaFold	Q06880	1-178	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694199

Promoter ID:

EPDNEW_R4724

Type:

multiple initiation site

Name:

Nbl1_1

Description:

neuroblastoma 1, DAN family BMP antagonist

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	157,535,676 - 157,535,736	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:3151	AgrOrtholog
BioCyc Gene	G2FUF-39429	BioCyc
Ensembl Genes	ENSRNOG00000049402	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000072299	ENTREZGENE
	ENSRNOT00000072299.3	UniProtKB/TrEMBL
	ENSRNOT00000101272.1	UniProtKB/TrEMBL
Gene3D-CATH	2.10.90.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:5599381	IMAGE-MGC_LOAD
InterPro	Cys_knot_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Cystine-knot_cytokine	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	DAN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Neuroblast_suppress_tumour_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:50594	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72398	IMAGE-MGC_LOAD
NCBI Gene	50594	ENTREZGENE
PANTHER	GREMLIN 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NEUROBLASTOMA SUPPRESSOR OF TUMORIGENICITY 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	DAN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Nbl1	PhenoGen
PIRSF	DAN_sub	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000049402	RatGTEx
SMART	SM00041	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0G2JSZ3	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I5ZMZ3_RAT	UniProtKB/TrEMBL
	A6ITK2	ENTREZGENE, UniProtKB/TrEMBL
	NBL1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q6P750	ENTREZGENE
UniProt Secondary	Q6P750	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2018-05-18	Nbl1	NBL1, DAN family BMP antagonist	Nbl1	neuroblastoma 1, DAN family BMP antagonist	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-03-07	Nbl1	neuroblastoma 1, DAN family BMP antagonist	Nbl1	neuroblastoma 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-03-06	Nbl1	neuroblastoma 1	Nbl1	neuroblastoma, suppression of tumorigenicity 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-02-26	Nbl1	neuroblastoma, suppression of tumorigenicity 1		neuroblastoma, suppression of tumorigenicity 1	Symbol and Name status set to approved	625702	APPROVED
2002-06-10	Nbl1	neuroblastoma, suppression of tumorigenicity 1			Name updated	70585	PROVISIONAL

RGD Curation Notes

Note Type	Note	Reference
gene_domains	contains a putative zinc-finger domain and a proline-rich domain	729039
gene_protein	178 amino acid residues	729039

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar