Cxcr1 (C-X-C motif chemokine receptor 1)

Advanced Search (OLGA)

Gene: Cxcr1 (C-X-C motif chemokine receptor 1) Rattus norvegicus

Analyze

Symbol:

Cxcr1

Name:

C-X-C motif chemokine receptor 1

RGD ID:

2905

Description:

Predicted to enable chemokine binding activity and chemokine receptor activity. Predicted to be involved in several processes, including calcium-mediated signaling; neutrophil chemotaxis; and receptor internalization. Predicted to be active in external side of plasma membrane. Biomarker of membranoproliferative glomerulonephritis. Human ortholog(s) of this gene implicated in human immunodeficiency virus infectious disease; pyelonephritis; and urinary tract infection. Orthologous to human CXCR1 (C-X-C motif chemokine receptor 1); INTERACTS WITH ammonium chloride; benzamide; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

C-X-C chemokine receptor type 1; chemokine (C-X-C motif) receptor 1; CXC-R1; CXCR-1; high affinity interleukin-8 receptor A; IL-8R A; Il8ra; interleukin 8 receptor, alpha

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	83,216,040 - 83,220,225 (-)	NCBI		GRCr8
mRatBN7.2	9	75,766,894 - 75,771,079 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	75,766,770 - 75,771,084 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	84,221,913 - 84,222,962 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	89,350,842 - 89,351,891 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	87,737,061 - 87,738,110 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	81,466,430 - 81,469,299 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	81,466,332 - 81,469,274 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	81,232,019 - 81,235,417 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	73,510,488 - 73,511,537 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	73,657,469 - 73,658,519 (-)	NCBI
Celera	9	73,345,732 - 73,346,781 (-)	NCBI		Celera
Cytogenetic Map	9	q33	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

alacrima, achalasia, and impaired intellectual development syndrome (ISO)

cerebrotendinous xanthomatosis (ISO)

cholangiocarcinoma (ISO)

COVID-19 (ISO)

end stage renal disease (ISO)

human immunodeficiency virus infectious disease (ISO)

membranoproliferative glomerulonephritis (IEP)

Neurodevelopmental Disorders (ISO)

paroxysmal nonkinesigenic dyskinesia 1 (ISO)

pyelonephritis (ISO)

Transplant Rejection (ISO)

ulcerative colitis (ISO)

urinary tract infection (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1-chloro-2,4-dinitrobenzene (ISO)

1-octadec-9-enoylglycero-3-phosphate (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

3-phenylprop-2-enal (ISO)

5-fluorouracil (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

benzalkonium chloride (ISO)

benzamide (EXP,ISO)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

bleomycin A2 (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

calcium atom (ISO)

calcium(0) (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

celecoxib (ISO)

CGP 52608 (ISO)

Cuprizon (EXP)

curcumin (ISO)

cytochalasin D (ISO)

decabromodiphenyl ether (EXP)

deoxynivalenol (ISO)

Dibutyl phosphate (ISO)

dichloroacetic acid (ISO)

doramapimod (ISO)

doxorubicin (EXP)

ginsenoside C-K (ISO)

hydroxyurea (ISO)

indirubin (ISO)

inulin (ISO)

lipopolysaccharide (ISO)

N-methyl-N-nitrosourea (ISO)

nickel atom (ISO)

nickel dichloride (ISO)

oleandrin (ISO)

oxaliplatin (ISO)

ozone (ISO)

perfluorooctane-1-sulfonic acid (ISO)

phorbol 13-acetate 12-myristate (ISO)

pirinixic acid (EXP)

reparixin (ISO)

resorcinol (ISO)

riddelliine (EXP)

silicon dioxide (EXP,ISO)

Soman (EXP)

sphingosine 1-phosphate (ISO)

staurosporine (EXP)

tamoxifen (ISO)

teriflunomide (ISO)

tetrachloromethane (ISO)

thalidomide (ISO)

Tolmetin glucuronide (ISO)

triphenyl phosphate (ISO)

triptonide (ISO)

vinclozolin (EXP)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

calcium-mediated signaling (IBA)

cell surface receptor signaling pathway (ISO)

chemokine-mediated signaling pathway (IEA)

immune response (IBA)

interleukin-8-mediated signaling pathway (IEA)

neutrophil chemotaxis (IBA)

positive regulation of cytosolic calcium ion concentration (IBA)

receptor internalization (ISO)

Cellular Component

external side of plasma membrane (IBA)

Molecular Function

C-C chemokine binding (IBA)

C-C chemokine receptor activity (IBA)

interleukin-8 binding (ISO)

interleukin-8 receptor activity (ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Identification of two rat genes orthologous to the human interleukin-8 receptors.	Dunstan CA, etal., J Biol Chem 1996 Dec 20;271(51):32770-6.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Genetic variations of interleukin-8, CXCR1 and CXCR2 genes and risk of acute pyelonephritis in children.	Javor J, etal., Int J Immunogenet. 2012 Aug;39(4):338-45. doi: 10.1111/j.1744-313X.2012.01096.x. Epub 2012 Feb 10.
5.	A genetic basis of susceptibility to acute pyelonephritis.	Lundstedt AC, etal., PLoS One. 2007 Sep 5;2(9):e825.
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
8.	Role of CXCR1 (CKR-1) in Inflammation of Experimental Mesangioproliferative Glomerulonephritis.	Ozaltin F, etal., Ren Fail. 2013 Jan 22.
9.	Neutrophil and monocyte activation in chronic kidney disease patients under hemodialysis and its relationship with resistance to recombinant human erythropoietin and to the hemodialysis procedure.	Pereira R, etal., Hemodial Int. 2010 Jul;14(3):295-301. doi: 10.1111/j.1542-4758.2010.00450.x.
10.	GOA pipeline	RGD automated data pipeline
11.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
12.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
13.	Association of polymorphisms of interleukin-8, CXCR1, CXCR2, and selectin with allograft outcomes in kidney transplantation.	Ro H, etal., Transplantation. 2011 Jan 15;91(1):57-64.
14.	Association of Toll-like receptor 4 gene polymorphism and expression with urinary tract infection types in adults.	Yin X, etal., PLoS One. 2010 Dec 3;5(12):e14223. doi: 10.1371/journal.pone.0014223.

Additional References at PubMed

PMID:10734056	PMID:11564821	PMID:20877331	PMID:22361324	PMID:24496685	PMID:27769935	PMID:36227008	PMID:36796675

Genomics

Comparative Map Data

Cxcr1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	9	83,216,040 - 83,220,225 (-)	NCBI		GRCr8
mRatBN7.2	9	75,766,894 - 75,771,079 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	75,766,770 - 75,771,084 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	84,221,913 - 84,222,962 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	9	89,350,842 - 89,351,891 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	9	87,737,061 - 87,738,110 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	9	81,466,430 - 81,469,299 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	81,466,332 - 81,469,274 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	81,232,019 - 81,235,417 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	73,510,488 - 73,511,537 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	73,657,469 - 73,658,519 (-)	NCBI
Celera	9	73,345,732 - 73,346,781 (-)	NCBI		Celera
Cytogenetic Map	9	q33	NCBI

CXCR1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	218,162,841 - 218,166,962 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	218,162,841 - 218,166,962 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	219,027,564 - 219,031,685 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	218,735,813 - 218,739,961 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	218,853,075 - 218,857,222	NCBI
Celera	2	212,794,153 - 212,798,301 (-)	NCBI		Celera
Cytogenetic Map	2	q35	NCBI
HuRef	2	210,880,311 - 210,884,459 (-)	NCBI		HuRef
CHM1_1	2	219,034,054 - 219,038,202 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	218,648,531 - 218,652,652 (-)	NCBI		T2T-CHM13v2.0

Cxcr1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	74,228,862 - 74,233,867 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	74,230,944 - 74,233,790 (-)	Ensembl		GRCm39 Ensembl
GRCm38	1	74,191,785 - 74,194,708 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	74,191,785 - 74,194,631 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	74,238,359 - 74,241,205 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	74,124,992 - 74,126,442 (-)	NCBI		MGSCv36	mm8
Celera	1	74,753,154 - 74,755,998 (-)	NCBI		Celera
Cytogenetic Map	1	C3	NCBI
cM Map	1	38.44	NCBI

Cxcr1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955453	15,194,205 - 15,195,272 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955453	15,181,027 - 15,196,224 (+)	NCBI	ChiLan1.0	ChiLan1.0

CXCR1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	13	120,802,384 - 120,862,522 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	2B	120,817,351 - 120,877,489 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2B	105,429,576 - 105,433,243 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2B	224,027,533 - 224,031,675 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2B	224,028,838 - 224,029,890 (-)	Ensembl	panpan1.1		panPan2

Cxcr1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	174,371,818 - 174,373,425 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936569	715,129 - 716,181 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936569	715,129 - 716,187 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

CXCR1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	10	104,052,709 - 104,056,388 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	10	104,053,544 - 104,054,620 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666040	95,344,477 - 95,348,616 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cxcr1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624823	6,859,356 - 6,860,426 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624823	6,857,649 - 6,861,219 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cxcr1
19 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	27
Count of miRNA genes:	25
Interacting mature miRNAs:	27
Transcripts:	ENSRNOT00000070827
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7411571	Bw138	Body weight QTL 138	14.3	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	9	32535505	77535505	Rat
11353957	Bmd92	Bone mineral density QTL 92		0.01	tibia mineral mass (VT:1000283)	volumetric bone mineral density (CMO:0001553)	9	46114199	91114199	Rat
61385	Edpm9	Estrogen-dependent pituitary mass QTL 9	3.43	0.05	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	9	63869687	108869687	Rat
70218	Cm28	Cardiac mass QTL 28	8.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	25268044	79271759	Rat
724544	Uae9	Urinary albumin excretion QTL 9	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	9	25268044	114175309	Rat
1578760	Cm53	Cardiac mass QTL 53	3.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	56771635	101771635	Rat
1581580	Uae34	Urinary albumin excretion QTL 34			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	62072275	96470995	Rat
12879506	Pur33	Proteinuria QTL 33			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	44649921	89649921	Rat
1354626	Bvd1	Brain ventricular dilatation QTL 1	3.73	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	9	75712843	111552878	Rat
731164	Uae25	Urinary albumin excretion QTL 25	3.5	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	25661188	100929786	Rat
10058949	Gmadr5	Adrenal mass QTL 5	2	0.014	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	9	42791513	87976209	Rat
1578757	Pur6	Proteinuria QTL 6	3.3	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	62072275	96470995	Rat
631656	Bp108	Blood pressure QTL 108	5.97	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	48598251	93598251	Rat
2303170	Bp332	Blood pressure QTL 332	3.73	0.027	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	55847841	77026453	Rat
8662828	Vetf6	Vascular elastic tissue fragility QTL 6	3.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	9	36962359	92058970	Rat
61352	Bp34	Blood pressure QTL 34	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	42495343	79271511	Rat
724515	Uae16	Urinary albumin excretion QTL 16	8		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	58163035	100929646	Rat
731171	Glom6	Glomerulus QTL 6	2.8	0.0003	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli not directly contacting the kidney surface (CMO:0001002)	9	64573531	109573531	Rat
1598834	Memor11	Memory QTL 11	2.5		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	9	36962359	77814038	Rat
70186	Niddm26	Non-insulin dependent diabetes mellitus QTL 26	3.87		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	9	22071169	86369743	Rat
7207814	Bmd91	Bone mineral density QTL 91	3.5		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	9	23754144	83851531	Rat
6903941	Pur31	Proteinuria QTL 31		0.036	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	9	40194188	85194188	Rat
2303180	Bp333	Blood pressure QTL 333		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	56627713	78595166	Rat
2290450	Scl57	Serum cholesterol level QTL 57	4.15		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	9	36962359	95410867	Rat
11353949	Bp393	Blood pressure QTL 393			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	40194188	85194188	Rat
11353951	Bp394	Blood pressure QTL 394			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	44649921	89649921	Rat
10054125	Srcrt7	Stress Responsive Cort QTL 7	3.33	0.0011	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	9	1	87073594	Rat
1300134	Bp185	Blood pressure QTL 185	3.73		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	61381434	104821652	Rat
7411656	Foco26	Food consumption QTL 26	9.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	32535505	77535505	Rat

Markers in Region

D9Wox31

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	75,768,191 - 75,768,344 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	81,466,410 - 81,466,562	NCBI	Rnor6.0
Rnor_5.0	9	81,232,006 - 81,232,158	UniSTS	Rnor5.0
RGSC_v3.4	9	73,510,366 - 73,510,519	RGD	RGSC3.4
RGSC_v3.4	9	73,510,367 - 73,510,519	UniSTS	RGSC3.4
Celera	9	73,345,611 - 73,345,763	UniSTS
Cytogenetic Map	9	q33	UniSTS

PMC310709P2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	9	75,768,679 - 75,769,125 (+)	MAPPER	mRatBN7.2
Rnor_6.0	9	81,466,898 - 81,467,343	NCBI	Rnor6.0
Rnor_5.0	9	81,232,494 - 81,232,939	UniSTS	Rnor5.0
RGSC_v3.4	9	73,510,855 - 73,511,300	UniSTS	RGSC3.4
Celera	9	73,346,099 - 73,346,544	UniSTS
Cytogenetic Map	9	q33	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	reproductive system	respiratory system
8	2	7	37	30	37	13	10	13	6	51	29	25	22	24

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019310	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474004	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000009	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U71089	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000070827 ⟹ ENSRNOP00000066188

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	9	81,466,513 - 81,469,274 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000090868 ⟹ ENSRNOP00000070273

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	75,766,770 - 75,771,084 (-)	Ensembl
Rnor_6.0 Ensembl	9	81,466,332 - 81,467,760 (-)	Ensembl

RefSeq Acc Id:

NM_019310 ⟹ NP_062183

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	9	83,216,040 - 83,220,225 (-)	NCBI
mRatBN7.2	9	75,766,894 - 75,771,079 (-)	NCBI
Rnor_6.0	9	81,466,531 - 81,467,580 (-)	NCBI
Rnor_5.0	9	81,232,019 - 81,235,417 (-)	NCBI
RGSC_v3.4	9	73,510,488 - 73,511,537 (-)	RGD
Celera	9	73,345,732 - 73,346,781 (-)	RGD

Sequence:

show sequence

ATGGCCGAGGCTGAGTATTTCATCTGGATTGCTCCTGAGGGTGACTTTGAGGAAGAATTTGGAA
ATATCACCCGAATGCTGCCCACTGGAGAGTATTTCAGCCCCTGTAAGAGGGTTCCAATGACCAA
CAGGCAGGCTGTAGTTGTCTTCTATGCACTGGTGTTCCTTCTTAGCTTGCTGGGAAACTCGCTG
GTGATGCTGGTCATCTTATACAGGCGAAGGACCCGATCCGTCACCGATGTCTACGTGCTGAACC
TAGCCATTGCTGATCTACTCTTTTCATTGACTCTGCCCTTCTTGGCTGTCTCCAAATGGAAGGG
CTGGATTTTTGGCACACCCCTGTGCAAGATGGTCTCACTCCTGAAGGAAGTCAACTTCTTCAGT
GGTATCTTGCTGCTGGCCTGCATCAGTGTGGATCGATACCTGGCCATCGTCCATGCCACCCGCA
CACTGACCCGAAAGCGCTACTTGGTTAAATTCGTATGCATGGGCACCTGGGGTCTATCCTTGGT
TCTGTCTCTGCCTTTTGCCATCTTCCGCCAGGCATATAAACCATACCGTTCTGGAACAGTCTGC
TATGAGGTCCTGGGTGAAGCCACAGCAGATCTTAGGATAACATTGCGTGGTCTGTCCCACATAT
TTGGCTTCCTCTTGCCGCTGTTCATCATGCTGGTCTGCTACGGGCTCACACTGCGCACGCTCTT
TAAGGCCCACATGAGACAGAAACGCCGGGCCATGTGGGTGATCTTTGCTGTTGTGTTGGTCTTC
CTGCTCTGTTGTCTGCCCTACAATCTGGTTCTGCTCTCGGACACTCTCTTAGGAGCCCACTTGA
TTCAAGATACTTGCGAGCGCCGCAATAACATTGACCAGGCCTTGTATATTACCGAGATCCTGGG
CTTTTCTCACAGTTGTCTTAACCCCGTCATCTATGCCTTTGTTGGCCAAAGTTTTCGCCATGAA
TTCCTCAAGATCCTTGCTAACCTGGTTCACAAGGAGGTTTTGACACACCACTCTGCTTCCTTTC
GCACGTCTCTCACCACTATCTATTAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_062183	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC52962	(Get FASTA)	NCBI Sequence Viewer
	EDL75336	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000070273.1
GenBank Protein	P70612	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_062183 ⟸ NM_019310

- UniProtKB:

P70612 (UniProtKB/Swiss-Prot), A6JVS8 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAEAEYFIWIAPEGDFEEEFGNITRMLPTGEYFSPCKRVPMTNRQAVVVFYALVFLLSLLGNSL
VMLVILYRRRTRSVTDVYVLNLAIADLLFSLTLPFLAVSKWKGWIFGTPLCKMVSLLKEVNFFS
GILLLACISVDRYLAIVHATRTLTRKRYLVKFVCMGTWGLSLVLSLPFAIFRQAYKPYRSGTVC
YEVLGEATADLRITLRGLSHIFGFLLPLFIMLVCYGLTLRTLFKAHMRQKRRAMWVIFAVVLVF
LLCCLPYNLVLLSDTLLGAHLIQDTCERRNNIDQALYITEILGFSHSCLNPVIYAFVGQSFRHE
FLKILANLVHKEVLTHHSASFRTSLTTIY

hide sequence

Ensembl Acc Id:

ENSRNOP00000066188 ⟸ ENSRNOT00000070827

Ensembl Acc Id:

ENSRNOP00000070273 ⟸ ENSRNOT00000090868

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P70612-F1-model_v2	AlphaFold	P70612	1-349	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2905	AgrOrtholog
BioCyc Gene	G2FUF-27148	BioCyc
Ensembl Genes	ENSRNOG00000048239	Ensembl, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000090868.2	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Chemokine_CXCR_1/2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:54258	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	54258	ENTREZGENE
PANTHER	C-X-C CHEMOKINE RECEPTOR TYPE 1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CELL ADHESION MOLECULE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	7tm_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Cxcr1	PhenoGen
PRINTS	GPCRRHODOPSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	INTRLEUKIN8R	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000048239	RatGTEx
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6JVS8	ENTREZGENE, UniProtKB/TrEMBL
	CXCR1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-22	Cxcr1	C-X-C motif chemokine receptor 1	Cxcr1	chemokine (C-X-C motif) receptor 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2011-08-02	Cxcr1	chemokine (C-X-C motif) receptor 1	Il8ra	interleukin 8 receptor, alpha	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Il8ra	interleukin 8 receptor, alpha			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in lung, spleen, and neutrophils	69860

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM