Ifnb1 (interferon beta 1) - Rat Genome Database

Name: Ifnb1
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Ifnb1 (interferon beta 1) Rattus norvegicus

Analyze

Symbol:

Ifnb1

Name:

interferon beta 1

RGD ID:

2865

Description:

Predicted to enable chloramphenicol O-acetyltransferase activity; cytokine activity; and type I interferon receptor binding activity. Involved in macrophage activation involved in immune response. Predicted to be active in extracellular space. Human ortholog(s) of this gene implicated in COVID-19. Orthologous to human IFNB1 (interferon beta 1); PARTICIPATES IN Chagas disease pathway; cytokine mediated signaling pathway; hepatitis C pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; ammonium chloride; bisphenol A.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

If1da1; IFN-beta; Ifnb; interferon 1da1; interferon beta; Interferon beta 1 fibroblast; interferon beta 1, fibroblast; interferon, beta 1; Interferon, beta 1, fibroblast

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	IFNB1 (interferon beta 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Ifnb1 (interferon beta 1, fibroblast)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Ifnb1 (interferon beta 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	IFNB1 (interferon beta 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	IFNB1 (interferon beta 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ifnb1 (interferon beta 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	IFNB1 (interferon beta 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ifnb1 (interferon beta 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	IFNB1 (interferon beta 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Ifnb1 (interferon beta 1, fibroblast)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ifnphi4 (interferon phi 4)	Alliance	DIOPT (Hieranoid\|PANTHER)
Danio rerio (zebrafish):	ifnphi1 (interferon phi 1)	Alliance	DIOPT (Hieranoid\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	103,020,969 - 103,021,523 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	103,020,969 - 103,021,523 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	105,375,610 - 105,376,164 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	107,166,057 - 107,166,611 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	107,226,739 - 107,227,293 (-)	NCBI	Rnor_WKY
Rnor_6.0	5	106,865,192 - 106,865,746 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	106,865,192 - 106,865,746 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	110,843,902 - 110,844,456 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	107,837,628 - 107,838,182 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	107,842,853 - 107,843,408 (-)	NCBI
Celera	5	100,095,218 - 100,095,772 (+)	NCBI		Celera
RH 3.4 Map	5	746.3	RGD
Cytogenetic Map	5	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

amelanotic melanoma (ISO)

anus benign neoplasm (ISO)

brain disease (ISO)

Breast Neoplasms (ISO)

Coronavirus infectious disease (ISO)

COVID-19 (ISO)

Experimental Melanoma (ISO)

Experimental Neoplasms (ISO)

genetic disease (ISO)

hepatitis B (ISO)

herpes simplex virus keratitis (ISO)

melanoma (ISO)

Middle East respiratory syndrome (ISO)

multiple sclerosis (ISO)

multisystem inflammatory syndrome in children (ISO)

neuroblastoma (ISO)

schizophrenia (ISO)

severe acute respiratory syndrome (ISO)

transitional cell carcinoma (ISO)

urinary bladder cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrobenzenesulfonic acid (ISO)

2-aminopurine (ISO)

3-acetyldeoxynivalenol (ISO)

3-methylcholanthrene (ISO)

3-phenylprop-2-enal (ISO)

4-hydroxynon-2-enal (ISO)

4-nitroquinoline N-oxide (ISO)

4-octylphenol (ISO)

4-phenylbutyric acid (ISO)

5-aza-2'-deoxycytidine (ISO)

5-fluorouracil (ISO)

acetaldehyde (ISO)

actinomycin D (ISO)

alachlor (ISO)

all-trans-retinoic acid (ISO)

allopurinol (ISO)

alpha-D-galactose (ISO)

aluminium atom (ISO)

aluminium(0) (ISO)

alvocidib (ISO)

amlexanox (ISO)

ammonium chloride (EXP)

apocynin (ISO)

aripiprazole (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

atrazine (ISO)

azathioprine (ISO)

benomyl (ISO)

bisphenol A (EXP,ISO)

cannabidiol (ISO)

carbaryl (ISO)

chaetoglobosin A (ISO)

chlordecone (ISO)

chloroquine (ISO)

chlorpromazine (ISO)

Cirsimarin (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

cortisol (ISO)

cudratricusxanthone A (ISO)

curcumin (ISO)

delta-tocotrienol (ISO)

deoxynivalenol (ISO)

dexamethasone (ISO)

diarsenic trioxide (ISO)

dicofol (ISO)

diethyl phthalate (ISO)

disodium selenite (ISO)

divanadium pentaoxide (ISO)

ethanol (EXP,ISO)

galactose (ISO)

gentamycin (EXP)

hexadecanoic acid (ISO)

hydrogen peroxide (ISO)

hydroxychloroquine (ISO)

ifosfamide (ISO)

linuron (ISO)

lipopolysaccharide (EXP,ISO)

luteolin (ISO)

malathion (ISO)

mangiferin (ISO)

mercury dichloride (ISO)

metam (ISO)

methotrexate (EXP)

methoxychlor (ISO)

microcystin-LR (ISO)

Mitotane (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodiethylamine (ISO)

N-nitrosodimethylamine (ISO)

nickel sulfate (ISO)

nicotine (ISO)

nimesulide (ISO)

nitric oxide (ISO)

Nivalenol (ISO)

nonanoic acid (ISO)

Nonylphenol (ISO)

Octachlorostyrene (ISO)

ozone (ISO)

paraquat (ISO)

pentachlorophenol (ISO)

pitavastatin (ISO)

pitavastatin(1-) (ISO)

poly(I:C) (EXP,ISO)

pravastatin (ISO)

pristane (EXP)

progesterone (ISO)

quercetin (ISO)

reactive oxygen species (ISO)

resiquimod (ISO)

resveratrol (ISO)

ruxolitinib (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

scoparone (ISO)

silver atom (ISO)

silver(0) (ISO)

simazine (ISO)

sodium arsenite (ISO)

tamoxifen (ISO)

temozolomide (ISO)

tetrachloromethane (ISO)

toluene 2,4-diisocyanate (ISO)

trametinib (ISO)

trichloroethene (EXP)

Triptolide (ISO)

wortmannin (ISO)

zinc protoporphyrin (ISO)

ziram (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adaptive immune response (IBA,ISO)

B cell activation involved in immune response (ISO)

B cell differentiation (IBA)

B cell proliferation (IBA,ISO)

cellular response to dexamethasone stimulus (ISO)

cellular response to dsRNA (ISO)

cellular response to interferon-beta (ISO)

cellular response to virus (ISO)

cytokine-mediated signaling pathway (IBA,ISO)

defense response to bacterium (ISO)

defense response to virus (ISO,ISS)

humoral immune response (IBA,ISO)

innate immune response (ISO)

macrophage activation involved in immune response (IDA)

natural killer cell activation involved in immune response (IBA)

negative regulation of Lewy body formation (ISO,ISS)

negative regulation of osteoclast differentiation (ISO)

negative regulation of T cell differentiation (ISO)

negative regulation of T-helper 2 cell cytokine production (ISO)

negative regulation of viral genome replication (ISO)

neuron cellular homeostasis (ISO,ISS)

positive regulation of apoptotic signaling pathway (ISO)

positive regulation of autophagy (ISO,ISS)

positive regulation of peptidyl-serine phosphorylation of STAT protein (IBA,ISO)

positive regulation of transcription by RNA polymerase II (ISO)

receptor signaling pathway via JAK-STAT (ISO)

response to exogenous dsRNA (IBA,ISO)

T cell activation involved in immune response (IBA)

type I interferon-mediated signaling pathway (ISO)

Cellular Component

extracellular space (IBA,ISO)

Molecular Function

chloramphenicol O-acetyltransferase activity (ISO)

cytokine activity (IBA,ISO)

cytokine receptor binding (ISO)

protein binding (ISO)

type I interferon receptor binding (IBA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Chagas disease pathway (IEA)

cytokine mediated signaling pathway (IEA)

hepatitis C pathway (IEA)

influenza A pathway (IEA)

Jak-Stat signaling pathway (IEA)

measles pathway (IEA)

Retinoic acid-inducible gene (RIG) I-like receptor signaling pathway (IEA)

Toll-like receptor signaling pathway (IEA)

tuberculosis pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Dichotomy between survival and lytic gene expression in RNase L- and PKR-deficient mice transduced with an adenoviral vector expressing murine IFN-beta following ocular HSV-1 infection.	Al-Khatib K, etal., Exp Eye Res. 2005 Feb;80(2):167-73. doi: 10.1016/j.exer.2004.08.026.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	A SARS-CoV-2 Infection Model in Mice Demonstrates Protection by Neutralizing Antibodies.	Hassan AO, etal., Cell. 2020 Jun 10. pii: S0092-8674(20)30742-X. doi: 10.1016/j.cell.2020.06.011.
5.	Ubiquicidin, a novel murine microbicidal protein present in the cytosolic fraction of macrophages.	Hiemstra PS, etal., J Leukoc Biol. 1999 Sep;66(3):423-8.
6.	Triple combination of interferon beta-1b, lopinavir-ritonavir, and ribavirin in the treatment of patients admitted to hospital with COVID-19: an open-label, randomised, phase 2 trial.	Hung IF, etal., Lancet. 2020 May 30;395(10238):1695-1704. doi: 10.1016/S0140-6736(20)31042-4. Epub 2020 May 10.
7.	Acute Respiratory Infection in Human Dipeptidyl Peptidase 4-Transgenic Mice Infected with Middle East Respiratory Syndrome Coronavirus.	Iwata-Yoshikawa N, etal., J Virol. 2019 Mar 5;93(6). pii: JVI.01818-18. doi: 10.1128/JVI.01818-18. Print 2019 Mar 15.
8.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
9.	An essential role for the antiviral endoribonuclease, RNase-L, in antibacterial immunity.	Li XL, etal., Proc Natl Acad Sci U S A. 2008 Dec 30;105(52):20816-21. doi: 10.1073/pnas.0807265105. Epub 2008 Dec 15.
10.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
11.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
13.	GOA pipeline	RGD automated data pipeline
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Isolation and expression of rat interferon beta gene and growth-inhibitory effect of its expression on rat glioma cells.	Yokoyama S, etal., Biochem Biophys Res Commun 1997 Mar 27;232(3):698-701.

Additional References at PubMed

PMID:10918594	PMID:11337497	PMID:12932356	PMID:14597717	PMID:15240719	PMID:16984225	PMID:17277142	PMID:17442941	PMID:18035482	PMID:18596219	PMID:19008854	PMID:19176627
PMID:19541371	PMID:20214528	PMID:20554961	PMID:21266579	PMID:21606371	PMID:23872679	PMID:24882218	PMID:26252165	PMID:27129230	PMID:33160814

Genomics

Comparative Map Data

Ifnb1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	103,020,969 - 103,021,523 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	103,020,969 - 103,021,523 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	105,375,610 - 105,376,164 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	107,166,057 - 107,166,611 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	107,226,739 - 107,227,293 (-)	NCBI	Rnor_WKY
Rnor_6.0	5	106,865,192 - 106,865,746 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	106,865,192 - 106,865,746 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	110,843,902 - 110,844,456 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	107,837,628 - 107,838,182 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	107,842,853 - 107,843,408 (-)	NCBI
Celera	5	100,095,218 - 100,095,772 (+)	NCBI		Celera
RH 3.4 Map	5	746.3	RGD
Cytogenetic Map	5	q32	NCBI

IFNB1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	21,077,104 - 21,077,942 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	9	21,077,104 - 21,077,942 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	21,077,103 - 21,077,941 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	21,067,104 - 21,067,943 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	21,067,103 - 21,067,943	NCBI
Celera	9	21,015,373 - 21,016,212 (-)	NCBI		Celera
Cytogenetic Map	9	p21.3	NCBI
HuRef	9	21,040,313 - 21,041,152 (-)	NCBI		HuRef
CHM1_1	9	21,076,893 - 21,077,732 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	21,090,986 - 21,091,824 (-)	NCBI		T2T-CHM13v2.0

Ifnb1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	88,440,253 - 88,441,083 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	88,440,262 - 88,441,011 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	88,522,025 - 88,522,794 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	88,522,025 - 88,522,774 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	88,167,929 - 88,168,698 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	87,993,256 - 87,994,025 (-)	NCBI		MGSCv36	mm8
Celera	4	87,037,706 - 87,038,475 (-)	NCBI		Celera
Cytogenetic Map	4	C4	NCBI
cM Map	4	41.91	NCBI

Ifnb1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955434	23,301,623 - 23,302,304 (-)	NCBI	ChiLan1.0	ChiLan1.0

IFNB1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	9	103,466,363 - 103,476,565 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	20,884,742 - 20,886,317 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	21,540,849 - 21,541,695 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

IFNB1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	40,668,295 - 40,668,855 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	40,668,295 - 40,668,855 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	39,330,806 - 39,331,366 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	41,610,249 - 41,610,809 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	41,610,249 - 41,610,809 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	40,302,366 - 40,302,926 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	40,090,657 - 40,091,217 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	40,726,193 - 40,726,753 (-)	NCBI		UU_Cfam_GSD_1.0

Ifnb1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	155,066,763 - 155,067,326 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936652	2,736,270 - 2,736,833 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IFNB1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	201,850,935 - 201,851,495 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	201,850,935 - 201,851,495 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	225,469,554 - 225,470,114 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3
Pig Cytomap	1	q23-q27	NCBI

Ifnb1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624736	25,099,061 - 25,099,746 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Ifnb1
1 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	17
Count of miRNA genes:	16
Interacting mature miRNAs:	17
Transcripts:	ENSRNOT00000008224
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	58829236	128034027	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
2316957	Pur21	Proteinuria QTL 21	6.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	5	59793528	113558156	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
2290005	Mcs24	Mammary carcinoma susceptibility QTL 24			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	64719390	109719390	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	66174080	124160948	Rat
2312671	Scl64	Serum cholesterol level QTL 64		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	68984307	104251008	Rat
61380	Edpm5	Estrogen-dependent pituitary mass QTL 5	4.5	0.92	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	5	68984307	104251008	Rat
1357396	Bw44	Body weight QTL 44	4.19		body mass (VT:0001259)	body weight (CMO:0000012)	5	68984307	104251008	Rat
1357402	Bw46	Body weight QTL 46	4.47		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	5	68984307	104251008	Rat
2302381	Bw84	Body weight QTL 84	4.47		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	5	68984307	104251008	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
1298070	Scl18	Serum cholesterol level QTL 18	3.7		blood LDL cholesterol amount (VT:0000181)	calculated plasma low density lipoprotein cholesterol level (CMO:0001245)	5	79584860	124584860	Rat
1598846	Bp293	Blood pressure QTL 293	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	79584860	124584860	Rat
1598859	Cm66	Cardiac mass QTL 66	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	79584860	124584860	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1298086	Bp156	Blood pressure QTL 156			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	84132602	129132602	Rat
7411601	Foco12	Food consumption QTL 12	19.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	87468046	132468046	Rat
7411564	Bw135	Body weight QTL 135		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	87468046	132468046	Rat
7411582	Foco3	Food consumption QTL 3	7.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	87468046	132468046	Rat
6903316	Bw113	Body weight QTL 113	2	0.0103	body mass (VT:0001259)	body weight (CMO:0000012)	5	87765973	132765973	Rat
1358889	Bp261	Blood pressure QTL 261	2.86		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	90067849	128034027	Rat
1358909	Kidm25	Kidney mass QTL 25	1.87		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	90067849	128034027	Rat
631527	Tls1	T-lymphoma susceptibility QTL 1	0	0.001	thymus integrity trait (VT:0010555)	post-insult time to onset of T-cell lymphoma (CMO:0001907)	5	90450144	135450144	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	94858972	143070159	Rat
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	97059760	147465714	Rat
2317753	Glom24	Glomerulus QTL 24	3.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	5	97570330	136479578	Rat
1582212	Livw2	Liver weight QTL 2	3.5	0.0004	liver mass (VT:0003402)	liver weight to body weight ratio (CMO:0000633)	5	99016066	119085810	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	99216724	148607142	Rat
1600362	Mcs19	Mammary carcinoma susceptibility QTL 19	2.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	99485997	103690167	Rat
7394708	Emca11	Estrogen-induced mammary cancer QTL 11			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	99753548	113061097	Rat

Markers in Region

RH94433

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	103,020,870 - 103,020,967 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	106,865,094 - 106,865,190	NCBI	Rnor6.0
Rnor_5.0	5	110,843,804 - 110,843,900	UniSTS	Rnor5.0
RGSC_v3.4	5	107,837,530 - 107,837,626	UniSTS	RGSC3.4
Celera	5	100,095,774 - 100,095,870	UniSTS
RH 3.4 Map	5	746.3	UniSTS
Cytogenetic Map	5	q31-q33	UniSTS

PMC26775P1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	103,021,015 - 103,021,601 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	106,865,239 - 106,865,824	NCBI	Rnor6.0
Rnor_5.0	5	110,843,949 - 110,844,534	UniSTS	Rnor5.0
RGSC_v3.4	5	107,837,675 - 107,838,260	UniSTS	RGSC3.4
Celera	5	100,095,140 - 100,095,725	UniSTS
Cytogenetic Map	5	q31-q33	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	circulatory system	endocrine system	hemolymphoid system	nervous system	respiratory system
High
Medium
Low	1
Below cutoff	1	3	4	7	3

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019127	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474094	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D87919	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	LR761027	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000008224 ⟹ ENSRNOP00000008225

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	103,020,969 - 103,021,523 (-)	Ensembl
Rnor_6.0 Ensembl	5	106,865,192 - 106,865,746 (-)	Ensembl

RefSeq Acc Id:

NM_019127 ⟹ NP_062000

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	103,020,969 - 103,021,523 (-)	NCBI
Rnor_6.0	5	106,865,192 - 106,865,746 (-)	NCBI
Rnor_5.0	5	110,843,902 - 110,844,456 (-)	NCBI
RGSC_v3.4	5	107,837,628 - 107,838,182 (-)	RGD
Celera	5	100,095,218 - 100,095,772 (+)	RGD

Sequence:

show sequence

ATGGCCAACAGGTGGACCCTCCACATTGCGTTCCTGCTGTGCTTCTCCACCACTGCCCTCTCCA
TCGACTACAAGCAGCTCCAGTTCCGACAAAGCACTAGCATTCGGACATGTCAGAAGCTCCTGAG
GCAGCTGAATGGAAGGCTCAACCTCAGCTACAGGACGGACTTCAAGATCCCTATGGAGGTGATG
CACCCGTCACAGATGGAGAAGAGTTACACTGCCTTTGCCATTCAAGTGATGCTCCAGAATGTCT
TTCTTGTCTTCAGAAGCAATTTCTCCAGCACTGGGTGGAATGAGACTATTGTTGAAAGTCTCTT
GGATGAACTACATCAGCAGACAGAGCTTCTGGAGATAATACTAAAGGAAAAGCAAGAGGAAAGA
TTGACTTGGGTGACATCCACGACTACTTTAGGCTTGAAGAGCTATTACTGGAGGGTACAAAGGT
ACCTTAAAGACAAGAAGTACAACAGCTATGCCTGGATGGTGGTCCGAGCAGAAGTCTTCAGGAA
CTTTTCCATTATTCTAAGACTTAATAGAAACTTCCAGAACTGA

hide sequence

Protein Sequences


Protein RefSeqs	NP_062000	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAA13502	(Get FASTA)	NCBI Sequence Viewer
	CAB0000194	(Get FASTA)	NCBI Sequence Viewer
	EDL75998	(Get FASTA)	NCBI Sequence Viewer
	P70499	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_062000 ⟸ NM_019127
- Peptide Label:	precursor
- UniProtKB:	P70499 (UniProtKB/Swiss-Prot), A0A7R8GV74 (UniProtKB/TrEMBL)
- Sequence:	show sequence MANRWTLHIAFLLCFSTTALSIDYKQLQFRQSTSIRTCQKLLRQLNGRLNLSYRTDFKIPMEVM HPSQMEKSYTAFAIQVMLQNVFLVFRSNFSSTGWNETIVESLLDELHQQTELLEIILKEKQEER LTWVTSTTTLGLKSYYWRVQRYLKDKKYNSYAWMVVRAEVFRNFSIILRLNRNFQN hide sequence

RefSeq Acc Id:

ENSRNOP00000008225 ⟸ ENSRNOT00000008224

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P70499-F1-model_v2	AlphaFold	P70499	1-184	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2865	AgrOrtholog
BioCyc Gene	G2FUF-40824	BioCyc
Ensembl Genes	ENSRNOG00000006268	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000008225	ENTREZGENE
	ENSRNOP00000008225.1	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000008224	ENTREZGENE
	ENSRNOT00000008224.3	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.1250.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	4_helix_cytokine-like_core	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Interferon_alpha/beta/delta	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:24481	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	24481	ENTREZGENE
PANTHER	INTERFERON BETA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11691	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Interferon	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Ifnb1	PhenoGen
PRINTS	INTERFERONAB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	INTERFERON_A_B_D	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	IFabd	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF47266	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A7R8GV74	ENTREZGENE, UniProtKB/TrEMBL
	IFNB_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-03-29	Ifnb1	interferon beta 1	Ifnb1	interferon beta 1, fibroblast	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Ifnb1	interferon beta 1, fibroblast		interferon, beta 1	Name updated	1299863	APPROVED
2002-11-06	Ifnb1	interferon, beta 1		Interferon, beta 1, fibroblast	Name updated	625702	APPROVED
2002-06-10	Ifnb1	Interferon, beta 1, fibroblast			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_homology	86.7 and 67.6% homologous to the mouse and human IFN beta	633076
gene_protein	encodes a polypeptide 184 amino acids long	633076

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)