Advanced Search (OLGA)

Gene: Htr1d (5-hydroxytryptamine receptor 1D) Rattus norvegicus

Analyze

Symbol:

Htr1d

Name:

5-hydroxytryptamine receptor 1D

RGD ID:

2847

Description:

Predicted to enable neurotransmitter receptor activity; serotonin binding activity; and transmembrane signaling receptor activity. Involved in regulation of synaptic vesicle exocytosis. Is active in glutamatergic synapse and neuronal dense core vesicle. Orthologous to human HTR1D (5-hydroxytryptamine receptor 1D); INTERACTS WITH 6-propyl-2-thiouracil; amitriptyline; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

5 - Hydroxytryptamine (serotonin) receptor 1D; 5-HT-1D; 5-HT1D; 5-hydroxytryptamine (serotonin) receptor 1D; 5-hydroxytryptamine (serotonin) receptor 1D, G protein-coupled; 5HT1D; serotonin receptor 1D

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	153,939,735 - 153,960,012 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	153,939,516 - 153,960,012 (+)	Ensembl				GRCr8
mRatBN7.2	5	148,656,252 - 148,676,532 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	148,674,495 - 148,675,619 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	151,370,870 - 151,371,994 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	153,145,161 - 153,146,285 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	153,127,165 - 153,128,289 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	154,780,958 - 154,801,505 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	154,800,226 - 154,801,350 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	158,566,277 - 158,567,401 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	155,188,669 - 155,189,793 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	147,075,945 - 147,077,069 (+)	NCBI		Celera
RGSC_v3.1	5	155,198,707 - 155,199,832 (+)	NCBI
RH 3.4 Map	5	1008.8	RGD
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autistic disorder (ISO)

Hypotension (ISO)

obsessive-compulsive disorder (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

2-palmitoylglycerol (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-sulfonyldiphenol (ISO)

6-propyl-2-thiouracil (EXP)

amitriptyline (EXP)

ammonium chloride (EXP)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

Azoxymethane (ISO)

benzo[a]pyrene (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

butanal (ISO)

cannabidiol (ISO)

capsaicin (ISO)

carbon nanotube (ISO)

chlorpyrifos (EXP,ISO)

clozapine (EXP)

cocaine (EXP)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

diazinon (EXP)

dieldrin (EXP)

eletriptan (EXP)

ethanol (ISO)

ethylparaben (ISO)

folic acid (ISO)

fulvestrant (ISO)

gentamycin (EXP)

haloperidol (EXP)

lead diacetate (ISO)

manganese atom (ISO)

manganese(0) (ISO)

manganese(II) chloride (ISO)

naratriptan (ISO)

nickel atom (EXP)

nickel sulfate (ISO)

okadaic acid (ISO)

ozone (ISO)

paracetamol (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

resveratrol (ISO)

serotonin (ISO)

sodium arsenite (ISO)

sumatriptan (EXP)

tamoxifen (ISO)

tetrachloromethane (EXP,ISO)

Theaflavin 3,3'-digallate (ISO)

titanium dioxide (ISO)

trichloroethene (EXP)

triptonide (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway (ISO,ISS)

adenylate cyclase-inhibiting serotonin receptor signaling pathway (IBA,ISO)

chemical synaptic transmission (IBA,IEA)

G protein-coupled receptor signaling pathway (IEA)

G protein-coupled receptor signaling pathway, coupled to cyclic nucleotide second messenger (IBA)

intestine smooth muscle contraction (ISO)

regulation of behavior (IEA)

regulation of locomotion (IEA)

regulation of synaptic vesicle exocytosis (EXP,IDA)

response to toxic substance (ISO)

signal transduction (IEA)

smooth muscle contraction (IEA)

vasoconstriction (IEA)

Cellular Component

dendrite (IBA)

glutamatergic synapse (EXP,IDA)

membrane (IEA)

neuronal dense core vesicle (IDA)

plasma membrane (IBA,IEA,ISO,ISS)

Molecular Function

G protein-coupled receptor activity (IEA)

G protein-coupled serotonin receptor activity (IBA,IEA,ISO,ISS)

Gi/o-coupled serotonin receptor activity (ISO)

neurotransmitter receptor activity (IBA)

serotonin binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
3.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
4.	Serotonin 5-HT1D and 5-HT1A receptors respectively mediate inhibition of glutamate release and inhibition of cyclic GMP production in rat cerebellum in vitro.	Maura G and Raiteri M, J Neurochem. 1996 Jan;66(1):203-9. doi: 10.1046/j.1471-4159.1996.66010203.x.
5.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
6.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
7.	Peptidergic nociceptors of both trigeminal and dorsal root ganglia express serotonin 1D receptors: implications for the selective antimigraine action of triptans.	Potrebic S, etal., J Neurosci 2003 Nov 26;23(34):10988-97.
8.	GOA pipeline	RGD automated data pipeline
9.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
10.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
11.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:1557407	PMID:1652050	PMID:9186750	PMID:16469416	PMID:16899728	PMID:20510890	PMID:20833155	PMID:21600121	PMID:23155193	PMID:23583574	PMID:32574671	PMID:34061415

Genomics

Comparative Map Data

Htr1d
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	153,939,735 - 153,960,012 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	5	153,939,516 - 153,960,012 (+)	Ensembl				GRCr8
mRatBN7.2	5	148,656,252 - 148,676,532 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	148,674,495 - 148,675,619 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	5	151,370,870 - 151,371,994 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	153,145,161 - 153,146,285 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	153,127,165 - 153,128,289 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	154,780,958 - 154,801,505 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	154,800,226 - 154,801,350 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	5	158,566,277 - 158,567,401 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	5	155,188,669 - 155,189,793 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	5	147,075,945 - 147,077,069 (+)	NCBI		Celera
RGSC_v3.1	5	155,198,707 - 155,199,832 (+)	NCBI
RH 3.4 Map	5	1008.8	RGD
Cytogenetic Map	5	q36	NCBI

HTR1D
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	23,191,895 - 23,217,502 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	23,190,178 - 23,217,547 (-)	Ensembl			hg38	GRCh38
GRCh37	1	23,518,388 - 23,543,995 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	23,390,975 - 23,393,809 (-)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	1	23,263,694 - 23,266,528	NCBI
Celera	1	21,840,525 - 21,843,359 (-)	NCBI		Celera
Cytogenetic Map	1	p36.12	NCBI
HuRef	1	21,762,979 - 21,765,813 (-)	NCBI		HuRef
CHM1_1	1	23,631,124 - 23,633,958 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	23,017,572 - 23,043,163 (-)	NCBI		T2T-CHM13v2.0

Htr1d
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	136,150,835 - 136,171,716 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	136,150,835 - 136,171,709 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	4	136,423,522 - 136,444,405 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	136,423,524 - 136,444,398 (+)	Ensembl			mm10	GRCm38
MGSCv37	4	135,979,439 - 136,000,317 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	4	135,695,600 - 135,716,474 (+)	NCBI		MGSCv36	mm8
Celera	4	134,616,431 - 134,638,378 (+)	NCBI		Celera
Cytogenetic Map	4	D3	NCBI
cM Map	4	68.74	NCBI

Htr1d
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955452	3,207,950 - 3,228,867 (-)	Ensembl
ChiLan1.0	NW_004955452	3,207,950 - 3,228,867 (-)	NCBI	ChiLan1.0	ChiLan1.0

HTR1D
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	203,729,058 - 203,754,759 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	202,832,060 - 202,858,852 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	22,378,262 - 22,403,918 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	23,370,307 - 23,375,115 (-)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	23,371,492 - 23,372,625 (-)	Ensembl			panPan2	panpan1.1

HTR1D
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	76,198,343 - 76,200,005 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	72,703,249 - 72,704,911 (+)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	76,757,002 - 76,758,664 (+)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	76,740,524 - 76,761,502 (+)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	73,578,897 - 73,580,556 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	74,586,637 - 74,588,299 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	75,590,781 - 75,592,443 (+)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Htr1d
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	42,528,241 - 42,609,375 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	8,432,074 - 8,433,207 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936474	8,432,009 - 8,433,382 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HTR1D
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	6	81,089,655 - 81,113,277 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	75,044,406 - 75,045,539 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HTR1D
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	109,482,357 - 109,485,176 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	109,482,863 - 109,483,996 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666033	6,834,518 - 6,862,695 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Htr1d
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	7,855,472 - 7,856,602 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624764	7,854,576 - 7,874,874 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Htr1d
(Rattus rattus - black rat)

Black Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Black Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rrattus_CSIRO_v1	1	21,788,620 - 21,790,231 (-)	NCBI		Rrattus_CSIRO_v1

Variants

Variants in Htr1d
157 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	28
Count of miRNA genes:	28
Interacting mature miRNAs:	28
Transcripts:	ENSRNOT00000016046
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	130249266	172190305	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	116702075	161702075	Rat
1354583	Despr3	Despair related QTL3	4.98	0.0002	locomotor behavior trait (VT:0001392)	amount of time spent in voluntary immobility (CMO:0001043)	5	132930505	172190305	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	141212838	172190305	Rat
1300119	Bp180	Blood pressure QTL 180	3.82		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	149642129	171146538	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	99905133	172190305	Rat
70156	Niddm30	Non-insulin dependent diabetes mellitus QTL 30	3.98		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	5	134369218	156289444	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	133789363	172190305	Rat
1331803	Rf32	Renal function QTL 32	2.798		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	134369199	172190305	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	65089051	166764498	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	136631198	172190305	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	112142946	157142946	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	112142946	157142946	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	110770739	155770739	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	133081618	172190305	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	51657967	166600247	Rat
631263	Cm24	Cardiac mass QTL 24	3.5		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	149805999	162987697	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	138002522	170842766	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	112142946	157142946	Rat
1581505	Rf54	Renal function QTL 54			kidney physiology trait (VT:0002136)	kidney 20-HETE level (CMO:0001854)	5	133270647	172190305	Rat
2317753	Glom24	Glomerulus QTL 24	3.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	5	141764300	172190305	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	133789363	172190305	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	148093485	172129029	Rat
1581510	Cm54	Cardiac mass QTL 54	3.4	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	125969677	172190305	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55124766	172190305	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	111236572	156236572	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	131708216	172190305	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	114131300	159131300	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	125969677	156302135	Rat
2313096	Bmd78	Bone mineral density QTL 78	3.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	5	149661912	166600247	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	112142946	157142946	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	116702075	161702075	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	112142946	157142946	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	116702075	161702075	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	74335621	156302135	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	116702075	161702075	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	114131300	159131300	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	133081618	172190305	Rat

Markers in Region

UniSTS:143418

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	148,675,419 - 148,675,608 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	154,801,151 - 154,801,339	NCBI	Rnor6.0
Rnor_5.0	5	158,567,202 - 158,567,390	UniSTS	Rnor5.0
RGSC_v3.4	5	155,189,594 - 155,189,782	UniSTS	RGSC3.4
Celera	5	147,076,870 - 147,077,058	UniSTS
Cytogenetic Map	5	q36	UniSTS

RH132942

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	148,675,573 - 148,675,774 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	154,801,305 - 154,801,505	NCBI	Rnor6.0
Rnor_5.0	5	158,567,356 - 158,567,556	UniSTS	Rnor5.0
RGSC_v3.4	5	155,189,748 - 155,189,948	UniSTS	RGSC3.4
Celera	5	147,077,024 - 147,077,224	UniSTS
RH 3.4 Map	5	1004.2	UniSTS
Cytogenetic Map	5	q36	UniSTS

Htr1d

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	5	153,958,814 - 153,958,919 (+)	Marker Load Pipeline
mRatBN7.2	5	148,675,335 - 148,675,439 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	154,801,067 - 154,801,170	NCBI	Rnor6.0
Rnor_5.0	5	158,567,118 - 158,567,221	UniSTS	Rnor5.0
RGSC_v3.4	5	155,189,510 - 155,189,613	UniSTS	RGSC3.4
Celera	5	147,076,786 - 147,076,889	UniSTS
Cytogenetic Map	5	q36	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
6	1	16	109	25	23	9	9	9	6	97	45	9	92	37	65	14	11	11

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012852	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017593153	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017593154	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017593155	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017593156	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017593157	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017593158	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M89953	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000016046 ⟹ ENSRNOP00000016047

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	153,939,516 - 153,960,012 (+)	Ensembl
mRatBN7.2 Ensembl	5	148,674,495 - 148,675,619 (+)	Ensembl
Rnor_6.0 Ensembl	5	154,800,226 - 154,801,350 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000171476 ⟹ ENSRNOP00000104073

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	5	153,939,735 - 153,960,012 (+)	Ensembl

RefSeq Acc Id:

NM_012852 ⟹ NP_036984

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	5	153,939,735 - 153,960,012 (+)	NCBI
mRatBN7.2	5	148,656,252 - 148,676,532 (+)	NCBI
Rnor_6.0	5	154,800,226 - 154,801,350 (+)	NCBI
Rnor_5.0	5	158,566,277 - 158,567,401 (+)	NCBI
RGSC_v3.4	5	155,188,669 - 155,189,793 (+)	RGD
Celera	5	147,075,945 - 147,077,069 (+)	RGD

Sequence:

show sequence

ATGTCGCTGCCAAACCAGTCCCTAGAAGGCCTTCCTCAGGAGGCCTCCAACAGATCCCTGAATG
CTACAGGGGCTTGGGACCCAGAGGTCCTGCAGGCACTCAGAATCTCCCTCGTGGTGGTCCTATC
CATCATTACACTGGCCACTGTCCTCTCCAATGCCTTCGTACTTACCACCATCCTGCTCACCAAG
AAGCTCCATACCCCAGCCAACTATCTCATTGGCTCCTTGGCCACCACCGACCTCCTGGTTTCTA
TCTTGGTCATGCCCATCAGCATAGCCTATACCACCACCCGTACCTGGAACTTTGGCCAGATCCT
GTGTGACATCTGGGTGTCTTCTGACATCACATGCTGTACGGCCTCCATCCTGCATCTCTGTGTC
ATCGCTCTGGACAGATACTGGGCCATCACCGATGCCCTGGAGTACAGCAAGCGCCGGACCGCAG
GTCACGCGGCGGCCATGATTGCGGCCGTCTGGGCCATCTCCATCTGTATCTCCATCCCACCGCT
CTTCTGGCGGCAGGCCACGGCTCACGAGGAGATGTCTGACTGCCTGGTGAACACATCTCAGATT
TCTTACACCATCTACTCGACCTGTGGGGCCTTCTACATCCCATCCATCTTGCTCATTATCCTGT
ATGGCCGCATATACGTGGCCGCCCGGAGTCGAATCCTGAACCCACCCTCCCTCTACGGGAAGCG
CTTCACCACAGCACAGCTTATCACGGGCTCTGCGGGCTCTTCACTCTGCTCGCTCAACCCCAGC
CTCCACGAGAGCCACACGCACACAGTCGGTTCCCCTCTTTTTTTCAACCAGGTGAAAATCAAGC
TTGCTGATAGCATCTTAGAACGCAAGAGGATCTCTGCAGCCCGAGAAAGGAAAGCCACTAAGAC
ATTGGGCATCATTCTGGGGGCCTTTATCATCTGCTGGCTGCCTTTCTTTGTGGTATCCTTGGTC
CTCCCCATCTGCAGGGACTCCTGTTGGATCCACCCGGCCCTCTTTGACTTCTTCACGTGGCTAG
GTTATTTAAACTCTCTCATTAACCCCGTCATCTACACTGTGTTCAACGAAGACTTTCGACAAGC
GTTTCAGAGAGTCGTCCATTTCCGAAAGGCCTCTTAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_036984	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA40614	(Get FASTA)	NCBI Sequence Viewer
	EDL80813	(Get FASTA)	NCBI Sequence Viewer
	EDL80814	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000016047.1
	ENSRNOP00000104073
GenBank Protein	P28565	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_036984 ⟸ NM_012852

- UniProtKB:

P28565 (UniProtKB/Swiss-Prot), A6ITB2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MSLPNQSLEGLPQEASNRSLNATGAWDPEVLQALRISLVVVLSIITLATVLSNAFVLTTILLTK
KLHTPANYLIGSLATTDLLVSILVMPISIAYTTTRTWNFGQILCDIWVSSDITCCTASILHLCV
IALDRYWAITDALEYSKRRTAGHAAAMIAAVWAISICISIPPLFWRQATAHEEMSDCLVNTSQI
SYTIYSTCGAFYIPSILLIILYGRIYVAARSRILNPPSLYGKRFTTAQLITGSAGSSLCSLNPS
LHESHTHTVGSPLFFNQVKIKLADSILERKRISAARERKATKTLGIILGAFIICWLPFFVVSLV
LPICRDSCWIHPALFDFFTWLGYLNSLINPVIYTVFNEDFRQAFQRVVHFRKAS

hide sequence

Ensembl Acc Id:

ENSRNOP00000016047 ⟸ ENSRNOT00000016046

Ensembl Acc Id:

ENSRNOP00000104073 ⟸ ENSRNOT00000171476

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P28565-F1-model_v2	AlphaFold	P28565	1-374	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2847	AgrOrtholog
BioCyc Gene	G2FUF-39502	BioCyc
Ensembl Genes	ENSRNOG00000012038	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000016046.3	UniProtKB/Swiss-Prot
	ENSRNOT00000171476	ENTREZGENE
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	5HT1D_rcpt	UniProtKB/Swiss-Prot
	5HT_rcpt	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn	UniProtKB/Swiss-Prot
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
KEGG Report	rno:25323	UniProtKB/Swiss-Prot
NCBI Gene	25323	ENTREZGENE
PANTHER	5-HYDROXYTRYPTAMINE RECEPTOR 1D	UniProtKB/Swiss-Prot
	ADRENERGIC RECEPTOR-RELATED G-PROTEIN COUPLED RECEPTOR	UniProtKB/Swiss-Prot
Pfam	7tm_1	UniProtKB/Swiss-Prot
PharmGKB	HTR1D	RGD
PhenoGen	Htr1d	PhenoGen
PRINTS	5HT1DRECEPTR	UniProtKB/Swiss-Prot
	5HTRECEPTOR	UniProtKB/Swiss-Prot
	GPCRRHODOPSN	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000012038	RatGTEx
SMART	7TM_GPCR_Srsx	UniProtKB/Swiss-Prot
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
TIGR	TC234441
UniProt	5HT1D_RAT	UniProtKB/Swiss-Prot
	A6ITB2	ENTREZGENE, UniProtKB/TrEMBL
	P28565	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-02-11	Htr1d	5-hydroxytryptamine receptor 1D	Htr1d	5-hydroxytryptamine (serotonin) receptor 1D, G protein-coupled	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2012-07-17	Htr1d	5-hydroxytryptamine (serotonin) receptor 1D, G protein-coupled	Htr1d	5-hydroxytryptamine (serotonin) receptor 1D	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Htr1d	5 - Hydroxytryptamine (serotonin) receptor 1D			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localized exclusively within dense core vesicles of synaptic terminals	734519

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD