Hspe1 (heat shock protein family E (Hsp10) member 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Hspe1 (heat shock protein family E (Hsp10) member 1) Rattus norvegicus

Analyze

Symbol:

Hspe1

Name:

heat shock protein family E (Hsp10) member 1

RGD ID:

2844

Description:

Predicted to enable chaperone binding activity; metal ion binding activity; and unfolded protein binding activity. Predicted to be involved in chaperone cofactor-dependent protein refolding. Located in mitochondrial matrix. Orthologous to human HSPE1 (heat shock protein family E (Hsp10) member 1); INTERACTS WITH 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 17alpha-ethynylestradiol; 2,2,2-tetramine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

10 kDa chaperonin; 10 kDa heat shock protein, mitochondrial; chaperonin 10; Cpn10; Heat shock 10 kD protein 1 (chaperonin 10); heat shock 10 kDa protein 1 ; heat shock 10 kDa protein 1 (chaperonin 10); heat shock protein 1 (chaperonin 10); heat shock protein family E member 1; hsp10

RGD Orthologs

Human

Mouse

Dog

Squirrel

Pig

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	HSPE1 (heat shock protein family E (Hsp10) member 1)	HGNC	HomoloGene, NCBI, Panther
Mus musculus (house mouse):	Hspe1 (heat shock protein 1 (chaperonin 10))	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	LOC609748 (10 kDa heat shock protein, mitochondrial)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	LOC101971313 (10 kDa heat shock protein, mitochondrial)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	HSPE1 (heat shock protein family E (Hsp10) member 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Hspe1 (heat shock protein 1 (chaperonin 10))	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	HSPE1 (heat shock protein family E (Hsp10) member 1)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Hspe1-rs1 (heat shock protein 1 (chaperonin 10), related sequence 1)	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	hspe1 (heat shock 10 protein 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG11267	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	HSP10	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	Y22D7AL.10	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG9920	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	9	56,589,912 - 56,593,000 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	56,589,789 - 56,593,089 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	65,098,866 - 65,101,955 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	9	70,214,763 - 70,217,852 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	9	68,514,481 - 68,517,569 (+)	NCBI	Rnor_WKY
Rnor_6.0	9	61,691,246 - 61,724,948 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	61,692,154 - 61,694,599 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	61,372,462 - 61,375,656 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	53,895,333 - 53,898,421 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	53,896,746 - 53,899,835 (+)	NCBI
Celera	9	54,071,386 - 54,074,474 (+)	NCBI		Celera
Cytogenetic Map	9	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

cardiomyopathy (ISO)

Neurodevelopmental Disorders (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

(S)-nicotine (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

1H-pyrazole (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,2,2-tetramine (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-methylcholine (ISO)

2-nitrofluorene (EXP)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP)

5-fluorouracil (ISO)

7,12-dimethyltetraphene (EXP)

acrylamide (ISO)

aflatoxin B1 (EXP,ISO)

albendazole (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

amphibole asbestos (ISO)

antimycin A (ISO)

atrazine (ISO)

benazepril (EXP)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

bisphenol F (EXP,ISO)

bleomycin A2 (EXP,ISO)

Brodifacoum (EXP)

cadmium atom (ISO)

cadmium dichloride (EXP)

caffeine (ISO)

calcitriol (ISO)

candesartan (EXP)

carbon nanotube (ISO)

carbonyl cyanide p-trifluoromethoxyphenylhydrazone (ISO)

cerium trichloride (ISO)

chloropicrin (ISO)

chloroprene (ISO)

chromium(6+) (ISO)

cis-caffeic acid (ISO)

cisplatin (ISO)

clobetasol (ISO)

clofibrate (EXP)

clofibric acid (EXP)

cobalt dichloride (ISO)

crocidolite asbestos (ISO)

CU-O LINKAGE (ISO)

cyclophosphamide (EXP)

cyclosporin A (ISO)

deguelin (ISO)

dexamethasone (ISO)

dibutyl phthalate (EXP)

diethylstilbestrol (EXP)

dihydroxyacetone (ISO)

dimethylarsinic acid (EXP)

doxorubicin (EXP,ISO)

enzyme inhibitor (ISO)

ethanol (ISO)

ethyl methanesulfonate (ISO)

etoposide (ISO)

fenofibrate (EXP)

fenpyroximate (ISO)

finasteride (EXP)

flutamide (EXP)

folic acid (ISO)

fructose (EXP)

gentamycin (EXP)

hexachlorobenzene (EXP)

hydrogen peroxide (ISO)

ICI D1694 (ISO)

indometacin (ISO)

ivermectin (ISO)

kojic acid (EXP,ISO)

L-ascorbic acid (ISO)

lead diacetate (EXP)

leflunomide (ISO)

methapyrilene (EXP)

methoxychlor (EXP)

methyl methanesulfonate (ISO)

monocrotaline (ISO)

morphine (EXP)

N-methyl-4-phenylpyridinium (ISO)

N-nitrosodiethylamine (EXP,ISO)

N-nitrosodimethylamine (EXP)

nefazodone (EXP)

nicotine (ISO)

nimesulide (EXP)

oxaliplatin (ISO)

oxidopamine (EXP)

p-menthan-3-ol (ISO)

paracetamol (ISO)

paraquat (EXP,ISO)

perfluorooctanoic acid (EXP,ISO)

phenethyl isothiocyanate (ISO)

phenobarbital (EXP,ISO)

phenytoin (ISO)

PhIP (EXP)

phlorizin (ISO)

picoxystrobin (ISO)

piperonyl butoxide (EXP)

pirinixic acid (EXP,ISO)

piroxicam (ISO)

potassium dichromate (EXP)

propiconazole (ISO)

pterostilbene (ISO)

pyrimidifen (ISO)

quercetin (ISO)

resveratrol (ISO)

rifampicin (ISO)

rotenone (ISO)

selenomethionine (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

streptozocin (EXP)

tamoxifen (EXP,ISO)

tebufenpyrad (ISO)

tetrachloromethane (EXP,ISO)

thapsigargin (ISO)

trans-caffeic acid (ISO)

trichloroacetic acid (EXP)

trichloroethene (ISO)

troglitazone (ISO)

tungsten (ISO)

tunicamycin (ISO)

urethane (ISO)

valproic acid (EXP)

zinc pyrithione (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

chaperone cofactor-dependent protein refolding (IBA)

protein folding (IEA)

Cellular Component

mitochondrial inner membrane (ISO)

mitochondrial matrix (IBA,IDA)

mitochondrion (ISO,ISS)

peroxisomal matrix (ISO)

Molecular Function

ATP binding (IEA)

metal ion binding (IBA)

protein binding (ISO)

protein folding chaperone (IEA)

protein-folding chaperone binding (IBA,ISO,ISS)

unfolded protein binding (IBA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
3.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
4.	GOA pipeline	RGD automated data pipeline
5.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
6.	Isolation of a cDNA clone specifying rat chaperonin 10, a stress-inducible mitochondrial matrix protein synthesised without a cleavable presequence.	Ryan MT, etal., FEBS Lett 1994 Jan 10;337(2):152-6.
7.	The genes encoding mammalian chaperonin 60 and chaperonin 10 are linked head-to-head and share a bidirectional promoter.	Ryan MT, etal., Gene 1997 Sep 1;196(1-2):9-17.
8.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
9.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:1348860	PMID:8101099	PMID:10205158	PMID:12967636	PMID:12970367	PMID:14651853	PMID:15489334	PMID:15544816	PMID:16210410	PMID:18329043	PMID:18614015	PMID:20458337
PMID:22658674	PMID:23376485

Genomics

Comparative Map Data

Hspe1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	9	56,589,912 - 56,593,000 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	9	56,589,789 - 56,593,089 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	9	65,098,866 - 65,101,955 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	9	70,214,763 - 70,217,852 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	9	68,514,481 - 68,517,569 (+)	NCBI	Rnor_WKY
Rnor_6.0	9	61,691,246 - 61,724,948 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	9	61,692,154 - 61,694,599 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	9	61,372,462 - 61,375,656 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	9	53,895,333 - 53,898,421 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	9	53,896,746 - 53,899,835 (+)	NCBI
Celera	9	54,071,386 - 54,074,474 (+)	NCBI		Celera
Cytogenetic Map	9	q31	NCBI

HSPE1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	197,500,379 - 197,503,449 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	2	197,500,140 - 197,503,449 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	198,365,103 - 198,368,173 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	198,073,365 - 198,076,416 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	198,190,625 - 198,193,677	NCBI
Celera	2	192,120,594 - 192,124,059 (+)	NCBI		Celera
Cytogenetic Map	2	q33.1	NCBI
HuRef	2	190,217,125 - 190,220,592 (+)	NCBI		HuRef
CHM1_1	2	198,370,561 - 198,374,027 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	2	197,983,980 - 197,987,052 (+)	NCBI		T2T-CHM13v2.0

Hspe1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	55,127,307 - 55,130,476 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	55,127,291 - 55,130,466 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	55,088,148 - 55,091,317 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	55,088,132 - 55,091,307 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	55,144,992 - 55,148,161 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	55,032,862 - 55,035,851 (+)	NCBI		MGSCv36	mm8
Celera	1	55,608,218 - 55,611,387 (+)	NCBI		Celera
Cytogenetic Map	1	C1.2	NCBI

LOC609748
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	35,778,017 - 35,778,497 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	37	6,918,338 - 7,024,353 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	35,532,211 - 35,532,689 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	36,011,298 - 36,011,776 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	37	6,808,860 - 6,914,722 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	35,623,409 - 35,623,887 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	35,700,809 - 35,701,287 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	36,062,324 - 36,062,816 (+)	NCBI		UU_Cfam_GSD_1.0

LOC101971313
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405303	155,160,262 - 155,195,634 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936506	1,643,018 - 1,666,219 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936506	1,642,860 - 1,677,820 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HSPE1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	15	101,373,976 - 101,376,144 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	15	101,374,019 - 101,376,146 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	15	112,548,122 - 112,550,249 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

Variants

Variants in Hspe1
2 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	24
Count of miRNA genes:	23
Interacting mature miRNAs:	24
Transcripts:	ENSRNOT00000020066
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10054125	Srcrt7	Stress Responsive Cort QTL 7	3.33	0.0011	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	9	1	87073594	Rat
1331757	Cdexp1	CD45RC expression in CD8 T cells QTL 1	4.3		CD8-positive T cell quantity (VT:0008077)	blood CD45RC(high) CD8 T cell count to CD45RC(low) CD8 T cell count ratio (CMO:0001990)	9	1024537	67509080	Rat
631680	Cm11	Cardiac mass QTL 11	3.1	0.00089	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	9	20430519	65430519	Rat
70186	Niddm26	Non-insulin dependent diabetes mellitus QTL 26	3.87		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	9	22071169	86369743	Rat
631643	Bp120	Blood pressure QTL 120	3	0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	22071200	67071200	Rat
7207805	Bmd88	Bone mineral density QTL 88	4		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	9	23754024	58157242	Rat
1300180	Bw14	Body weight QTL 14	3.776		body mass (VT:0001259)	body weight (CMO:0000012)	9	23754024	61381613	Rat
7207814	Bmd91	Bone mineral density QTL 91	3.5		femur size trait (VT:1000369)	femoral neck cross-sectional area (CMO:0001697)	9	23754144	83851531	Rat
70218	Cm28	Cardiac mass QTL 28	8.3	0.0001	heart mass (VT:0007028)	heart wet weight (CMO:0000069)	9	25268044	79271759	Rat
724544	Uae9	Urinary albumin excretion QTL 9	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	9	25268044	114175309	Rat
731164	Uae25	Urinary albumin excretion QTL 25	3.5	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	9	25661188	100929786	Rat
1641894	Alcrsp12	Alcohol response QTL 12			response to alcohol trait (VT:0010489)	brain neurotensin receptor 1 density (CMO:0002068)	9	27468639	72468639	Rat
7411656	Foco26	Food consumption QTL 26	9.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	9	32535505	77535505	Rat
7411571	Bw138	Body weight QTL 138	14.3	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	9	32535505	77535505	Rat
1598834	Memor11	Memory QTL 11	2.5		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	9	36962359	77814038	Rat
8662828	Vetf6	Vascular elastic tissue fragility QTL 6	3.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	9	36962359	92058970	Rat
2290450	Scl57	Serum cholesterol level QTL 57	4.15		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	9	36962359	95410867	Rat
6903941	Pur31	Proteinuria QTL 31		0.036	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	9	40194188	85194188	Rat
11353949	Bp393	Blood pressure QTL 393			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	40194188	85194188	Rat
61352	Bp34	Blood pressure QTL 34	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	42495343	79271511	Rat
10058949	Gmadr5	Adrenal mass QTL 5	2	0.014	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	9	42791513	87976209	Rat
11353951	Bp394	Blood pressure QTL 394			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	44649921	89649921	Rat
12879506	Pur33	Proteinuria QTL 33			urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	9	44649921	89649921	Rat
11353957	Bmd92	Bone mineral density QTL 92		0.01	tibia mineral mass (VT:1000283)	volumetric bone mineral density (CMO:0001553)	9	46114199	91114199	Rat
631656	Bp108	Blood pressure QTL 108	5.97	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	9	48598251	93598251	Rat
1598849	Memor17	Memory QTL 17	2.2		exploratory behavior trait (VT:0010471)	difference between time of physical contact/close proximity of test subject and social stimulus during sample phase and test phase (CMO:0002678)	9	49968546	71098346	Rat
2303170	Bp332	Blood pressure QTL 332	3.73	0.027	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	9	55847841	77026453	Rat

Markers in Region

RH127488

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	9	61,375,272 - 61,375,678	UniSTS	Rnor5.0
RGSC_v3.4	9	53,898,037 - 53,898,443	UniSTS	RGSC3.4
Celera	9	54,074,090 - 54,074,496	UniSTS
RH 3.4 Map	9	478.57	UniSTS
Cytogenetic Map	9	q31	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High		2	14	6		6			2		4
Medium	3	41	43	35	19	35	8	11	72	35	37	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012966	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC058492	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473965	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209877	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ220992	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ222153	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000214	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U68562	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X71429	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000082300 ⟹ ENSRNOP00000068700

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	56,590,653 - 56,593,089 (+)	Ensembl
Rnor_6.0 Ensembl	9	61,692,154 - 61,694,599 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000102977 ⟹ ENSRNOP00000079497

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	9	56,589,789 - 56,593,089 (+)	Ensembl

RefSeq Acc Id:

NM_012966 ⟹ NP_037098

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	9	56,589,912 - 56,593,000 (+)	NCBI
Rnor_6.0	9	61,691,246 - 61,724,948 (+)	NCBI
Rnor_5.0	9	61,372,462 - 61,375,656 (+)	NCBI
RGSC_v3.4	9	53,895,333 - 53,898,421 (+)	RGD
Celera	9	54,071,386 - 54,074,474 (+)	RGD

Sequence:

show sequence

GAGGGGCTTGTTCTTTCACCTCAGCGGCCGACCTGGAAAAGCCTAGAAAGTGCTCCCCTTTTCT
TCCGCCTCCGGCTACCCGCATCGGCCGCCTGCGCGGAGTCCTGGCCACCAATCGGCGCGCGCGC
TGGAGTGGCCGCCTTCTCTCACGCTAAGGGGCTGAGTGCGCCTGCGCGCTGCGCTGTCTTTTCA
CGTGTCCTGAGCCGGCCCACGGGAGTCTCCTTGCAGCAGGAGTCCGAGTGCAGAGTCCGGAGCT
GCGGCGGCGTAAGTCATGGCTGGACAAGCTTTTAGGAAGTTTCTTCCGCTATTTGACAGAGTAT
TGGTTGAAAGGAGTGCCGCTGAAACTGTGACCAAAGGTGGCATTATGCTTCCAGAAAAGTCTCA
AGGAAAAGTATTGCAAGCAACGGTCGTGGCTGTGGGATCAGGCGGGAAAGGAAAGGGTGGAGAG
ATTCAGCCTGTCAGTGTGAAAGTTGGAGATAAAGTTCTTCTCCCAGAACACGGAGGCACCAAAG
TAGTACTAGACGACAAGGATTACTTCTTATTTAGAGATGGCGACATTCTTGGAAAGTATGTCGA
CTGAAATCACTGTTGAAATGGTGTCACATGAAGCTGCCCATTCCACTGATATTCTGAACTATTT
CATCATGTAAATAATTTCCATGCCTCCCTTTTATAATAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_037098	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAC53361	(Get FASTA)	NCBI Sequence Viewer
	AAH58492	(Get FASTA)	NCBI Sequence Viewer
	CAA50560	(Get FASTA)	NCBI Sequence Viewer
	EDL99050	(Get FASTA)	NCBI Sequence Viewer
	P26772	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_037098 ⟸ NM_012966
- UniProtKB:	P97601 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAGQAFRKFLPLFDRVLVERSAAETVTKGGIMLPEKSQGKVLQATVVAVGSGGKGKGGEIQPVS VKVGDKVLLPEHGGTKVVLDDKDYFLFRDGDILGKYVD hide sequence

RefSeq Acc Id:

ENSRNOP00000068700 ⟸ ENSRNOT00000082300

RefSeq Acc Id:

ENSRNOP00000079497 ⟸ ENSRNOT00000102977

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P26772-F1-model_v2	AlphaFold	P26772	1-102	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2844	AgrOrtholog
BioCyc Gene	G2FUF-27533	BioCyc
Ensembl Genes	ENSRNOG00000051624	Ensembl, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000068700.2	UniProtKB/TrEMBL
	ENSRNOP00000079497.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000082300.2	UniProtKB/TrEMBL
	ENSRNOT00000102977.1	UniProtKB/TrEMBL
Gene3D-CATH	2.30.33.40	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:6887393	IMAGE-MGC_LOAD
InterPro	Chaperonin_GroES	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Chaperonin_GroES_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Chaprnonin_Cpn10_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GroES-like_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25462	UniProtKB/TrEMBL
MGC_CLONE	MGC:72916	IMAGE-MGC_LOAD
NCBI Gene	25462	ENTREZGENE
PANTHER	10 KDA HEAT SHOCK PROTEIN, MITOCHONDRIAL	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR10772	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Cpn10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Hspe1	PhenoGen
PRINTS	CHAPERONIN10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	CHAPERONINS_CPN10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	Cpn10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF50129	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC216558
	TC216995
UniProt	A0A0G2JTG1_RAT	UniProtKB/TrEMBL
	A0A8I5ZMY9_RAT	UniProtKB/TrEMBL
	CH10_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	P97601	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-04-10	Hspe1	heat shock protein family E (Hsp10) member 1	Hspe1	heat shock protein family E member 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-02-25	Hspe1	heat shock protein family E member 1	Hspe1	heat shock protein 1 (chaperonin 10)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-15	Hspe1	heat shock protein 1 (chaperonin 10)	Hspe1	heat shock 10 kDa protein 1 (chaperonin 10)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-03-30	Hspe1	heat shock 10 kDa protein 1 (chaperonin 10)		heat shock 10 kDa protein 1	Name updated	1299863	APPROVED
2002-11-06	Hspe1	heat shock 10 kDa protein 1		Heat shock 10 kD protein 1 (chaperonin 10)	Name updated	625702	APPROVED
2002-06-10	Hspe1	Heat shock 10 kD protein 1 (chaperonin 10)			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_other	shares a bidirectional promoter with chaperonin 60	633052
gene_regulation	acetylated prior to mitochondrial import	729181

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD