Advanced Search (OLGA)

Gene: Hmox1 (heme oxygenase 1) Rattus norvegicus

Analyze

Symbol:

Hmox1

Name:

heme oxygenase 1

RGD ID:

2806

Description:

Enables several functions, including heme binding activity; oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen; and phospholipase D activity. Involved in several processes, including intracellular signal transduction; negative regulation of apoptotic process; and regulation of gene expression. Located in caveola; endoplasmic reticulum; and nucleus. Used to study several diseases, including artery disease (multiple); cerebrovascular disease (multiple); hepatic vascular disease (multiple); limb ischemia; and sciatic neuropathy. Biomarker of several diseases, including Sjogren's syndrome; artery disease (multiple); brain disease (multiple); liver disease (multiple); and lung disease (multiple). Human ortholog(s) of this gene implicated in several diseases, including artery disease (multiple); cerebrovascular disease (multiple); factor VIII deficiency; lung disease (multiple); and type 2 diabetes mellitus. Orthologous to human HMOX1 (heme oxygenase 1); PARTICIPATES IN heme degradation pathway; hypertension pathway; oxidative stress response pathway; INTERACTS WITH (+)-pilocarpine; (+)-taxifolin; (R)-carnitine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

heme oxygenas; heme oxygenase; heme oxygenase (decycling) 1; heme oxygenase (decyclizing) 1; Heox; HEOXG; Hmox; Ho-1; Ho1; hsp32

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	HMOX1 (heme oxygenase 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Hmox1 (heme oxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Hmox1 (heme oxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	HMOX1 (heme oxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	HMOX1 (heme oxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Hmox1 (heme oxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	HMOX1 (heme oxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	HMOX1 (heme oxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Hmox1 (heme oxygenase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Hmox1 (heme oxygenase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	HMOX1 (heme oxygenase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	hmox1a (heme oxygenase 1a)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)
Saccharomyces cerevisiae (baker's yeast):	HMX1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder)
Saccharomyces cerevisiae (baker's yeast):	HMX1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Ho	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	hmox1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	hmox1	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Is Marker For:

Strains: SS/Jr

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	13,452,365 - 13,479,823 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	13,472,884 - 13,479,818 (+)	Ensembl				GRCr8
mRatBN7.2	19	13,466,287 - 13,474,082 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	13,467,244 - 13,474,079 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	13,440,832 - 13,447,675 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	14,206,098 - 14,212,941 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	13,487,026 - 13,493,858 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	14,508,634 - 14,515,455 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	14,508,616 - 14,515,456 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	25,622,556 - 25,629,377 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	13,963,139 - 13,969,960 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	13,334,259 - 13,341,080 (+)	NCBI		Celera
RGSC_v3.1	19	13,967,964 - 13,974,784 (+)	NCBI
Cytogenetic Map	19	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

abdominal aortic aneurysm (ISO)

acute chest syndrome (ISO)

acute kidney failure (IMP,ISO)

Acute Lung Injury (IEP,IMP)

acute myeloid leukemia (IEP)

adenocarcinoma (ISO)

adenylosuccinase lyase deficiency (ISO)

adrenoleukodystrophy (ISO)

adult respiratory distress syndrome (ISO)

allergic rhinitis (ISO)

Altitude Sickness (IEP)

Alzheimer's disease (ISO)

anterior compartment syndrome (ISO)

arteriosclerosis (ISO)

asthma (ISO)

Behcet's disease (ISO)

berylliosis (ISO)

Blast Crisis (ISO)

blood coagulation disease (ISO)

Brain Death (IEP,IMP)

brain edema (IEP)

Brain Hypoxia-Ischemia (IEP)

Brain Injuries (IEP)

brain ischemia (IEP,IMP)

Breast Neoplasms (ISO)

bronchiolitis obliterans (ISO)

Carbon Monoxide Poisoning (IDA,IEP)

Carbon Tetrachloride Poisoning (IEP)

Cardiomegaly (ISO)

carotid artery disease (ISO)

carotid artery thrombosis (ISO)

Cerebral Hemorrhage (ISO)

cerebral infarction (ISO)

Chemical and Drug Induced Liver Injury (IEP,ISO)

chronic myeloid leukemia (ISO)

chronic obstructive pulmonary disease (IEP,ISO)

Chronic Tubulointerstitial Nephropathy (ISO)

colitis (IEP,ISO)

congestive heart failure (IMP,ISO)

contact dermatitis (ISO)

coronary artery disease (ISO)

Coronary Disease (ISO)

coronary restenosis (ISO)

cystic fibrosis (ISO)

diabetic angiopathy (ISO)

Diabetic Cardiomyopathies (IEP)

Diabetic Nephropathies (IEP)

Dilatation, Pathologic (IDA)

end stage renal disease (ISO)

Endotoxemia (IEP)

esophageal cancer (IEP)

Experimental Diabetes Mellitus (IEP,ISO)

Experimental Liver Cirrhosis (IDA,ISO)

Experimental Mammary Neoplasms (IDA,ISO)

Experimental Radiation Injuries (IMP)

factor VIII deficiency (ISO)

Fever (IEP)

Fibrosis (ISO)

gastroparesis (ISO)

Graft Occlusion, Vascular (ISO)

Growth Disorders (ISO)

Helicobacter Infections (ISO)

Heme Oxygenase 1 Deficiency (ISO)

hemochromatosis (ISS)

Hemolysis (ISO)

hemolytic anemia (ISO)

Hemorrhagic Shock (IEP,IMP)

hepatic encephalopathy (IEP)

hepatic veno-occlusive disease (IDA)

hepatitis (ISO)

hepatopulmonary syndrome (IEP)

hepatorenal syndrome (ISO)

hyperinsulinism (ISO)

Hyperoxic Lung Injury (IEP)

Hyperplasia (ISO)

hypertension (IDA,ISO)

hyperthyroidism (IEP)

hypertrophic cardiomyopathy (IEP)

IgA vasculitis (ISO)

ileus (IEP)

Inflammation (ISO)

Insulin Resistance (ISO)

interstitial lung disease (ISO)

Intestinal Reperfusion Injury (IEP)

intracranial vasospasm (IMP,ISO)

iron metabolism disease (ISO)

ischemia (ISO)

Kawasaki disease (ISO)

Kidney Reperfusion Injury (IMP)

learning disability (ISO)

limb ischemia (IDA)

liver disease (ISO)

Liver Neoplasms (ISO)

Liver Reperfusion Injury (IEP)

lung disease (IDA,IEP,ISO)

Lung Injury (ISO)

Lung Neoplasms (ISO)

Lung Reperfusion Injury (IEP)

malaria (ISS)

Metabolic Syndrome (IEP)

middle cerebral artery infarction (IDA,IEP,ISO)

myocardial infarction (IDA,IEP)

Myocardial Ischemia (IEP,ISO)

Myocardial Reperfusion Injury (IDA,IEP,ISO)

Neointima (IMP)

Neonatal Hyperbilirubinemia (IMP)

Neoplasm Invasiveness (ISO)

neurodegenerative disease (ISO)

newborn respiratory distress syndrome (ISO)

obesity (ISO)

obstructive sleep apnea (ISO)

pancreas disease (ISO)

Paraparesis (IEP)

Parkinson's disease (ISO)

Parkinsonism (IEP)

Pathologic Constriction (IDA)

peptic ulcer disease (IMP)

Perennial Allergic Rhinitis (ISO)

Pneumococcal Pneumonia (ISO)

pneumonia (ISO)

pneumothorax (ISO)

portal hypertension (IDA)

pre-eclampsia (ISO)

Pregnancy-Induced Hypertension (IEP)

primary biliary cholangitis (IEP)

Prostatic Neoplasms (ISO)

Pulmonary Edema of Mountaineers (IEP)

pulmonary emphysema (ISO)

pulmonary fibrosis (ISO)

pulmonary hypertension (IDA,IEP,ISO)

pulmonary sarcoidosis (ISO)

pulmonary venoocclusive disease (IEP,ISO)

renal hypertension (IDA)

Reperfusion Injury (IDA,IEP,IMP,ISO)

Retina Reperfusion Injury (IEP)

retinal disease (ISO)

retinal ischemia (IEP)

Rhabdomyolysis (IEP)

Right Ventricular Hypertrophy (ISO)

sciatic neuropathy (IDA)

sickle cell anemia (IMP,ISO)

silicosis (ISO)

Sjogren's syndrome (IEP)

Spinal Cord Injuries (IEP)

spinocerebellar ataxia type 17 (ISO)

status epilepticus (IEP,ISO)

Stomach Neoplasms (ISO)

Stroke (ISO)

Subarachnoid Hemorrhage (IEP,IMP,ISO)

systemic mastocytosis (ISO)

Testis Reperfusion Injury (IMP)

thrombosis (ISO)

toxic shock syndrome (IDA)

type 2 diabetes mellitus (IEP,ISO)

varicocele (ISO)

Vascular System Injuries (ISO)

Ventricular Fibrillation (ISO)

viral pneumonia (ISO)

visceral leishmaniasis (ISO)

Wounds and Injuries (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-albicanol (ISO)

(+)-alpha-viniferin (ISO)

(+)-catechin (ISO)

(+)-epicatechin-3-O-gallate (ISO)

(+)-pilocarpine (EXP,ISO)

(+)-schisandrin B (ISO)

(+)-taxifolin (EXP,ISO)

(+)-trans-(S)-allethrin (ISO)

(+-)-suloctidil (ISO)

(-)-citrinin (ISO)

(-)-epigallocatechin 3-gallate (ISO)

(-)-selegiline (ISO)

(1->4)-beta-D-glucan (ISO)

(1S)-bornane-2,3-dione (ISO)

(2,4,5-trichlorophenoxy)acetic acid (ISO)

(20S)-ginsenoside Rg3 (ISO)

(25R)-cholest-5-ene-3beta,26-diol (ISO)

(E)-cinnamyl alcohol (ISO)

(R)-carnitine (EXP)

(R)-lipoic acid (EXP,ISO)

(R)-noradrenaline (ISO)

(R)-pantothenic acid (ISO)

(R,R,R)-alpha-tocopherol (EXP,ISO)

(S)-AMPA (EXP)

(S)-colchicine (EXP,ISO)

(S)-duloxetine hydrochloride (ISO)

(S)-naringenin (EXP,ISO)

(S)-nicotine (EXP,ISO)

(S)-ropivacaine (ISO)

(Z)-ligustilide (ISO)

1,1'-azobis(N,N-dimethylformamide) (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP)

1,1,1-trichloroethane (ISO)

1,1-bis(2-aminoethyl)-2-hydroxy-3-oxotriazane (ISO)

1,1-dichloroethene (EXP)

1,10-phenanthroline (ISO)

1,2,4-trichlorobenzene (EXP)

1,2-dichloroethane (ISO)

1,2-dimethylhydrazine (EXP,ISO)

1,2-naphthoquinone (ISO)

1,3-benzothiazole-2-thiol (ISO)

1,3-dichloropropan-2-ol (EXP,ISO)

1,3-dinitrobenzene (EXP)

1,4-benzoquinone (ISO)

1,4-dichlorobenzene (ISO)

1,4-dithiothreitol (ISO)

1,4-phenylenediamine (ISO)

1-(5-isoquinolinesulfonyl)-2-methylpiperazine (ISO)

1-[(2,3,4-trimethoxyphenyl)methyl]piperazine (ISO)

1-aminobenzotriazole (ISO)

1-bromopropane (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

1-fluoro-2,4-dinitrobenzene (ISO)

1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine (ISO)

1-naphthyl isothiocyanate (EXP,ISO)

1-nitropyrene (ISO)

1-phenyl-1,2-propanedione (ISO)

15-deoxy-Delta(12,14)-prostaglandin J2 (EXP,ISO)

15-oxo-ETE (ISO)

17-hydroxyjolkinolide B (ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

1H-[1,2,4]oxadiazolo[4,3-a]quinoxalin-1-one (ISO)

1H-pyrazole (ISO)

2''-galloylhyperin (ISO)

2',4'-dihydroxy-6'-methoxy-3',5'-dimethylchalcone (ISO)

2'-hydroxychalcone (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,2'-bipyridine (ISO)

2,2,2-tetramine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (ISO)

2,3-dimethoxynaphthalene-1,4-dione (ISO)

2,4,6-tribromophenol (ISO)

2,4,6-trinitrobenzenesulfonic acid (EXP)

2,4-D (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2,4-dinitrotoluene (EXP)

2,6-di-tert-butyl-4-methylphenol (EXP,ISO)

2,6-dichloroindophenol (ISO)

2-(3,4-dimethoxyphenyl)-5-\{[2-(3,4-dimethoxyphenyl)ethyl](methyl)amino\}-2-(propan-2-yl)pentanenitrile (EXP,ISO)

2-acetamidofluorene (EXP)

2-amino-2-deoxy-D-galactopyranose (EXP,ISO)

2-amino-2-deoxy-D-glucopyranose (ISO)

2-aminophenol (ISO)

2-bromo-2-(bromomethyl)pentanedinitrile (ISO)

2-butoxyethanol (ISO)

2-chloroethanol (EXP)

2-deoxy-D-glucose (ISO)

2-hexenal (ISO)

2-Hydroxy-6-(8,11,14-pentadecatrienyl)benzoic acid (EXP)

2-hydroxyethyl methacrylate (ISO)

2-hydroxypropanoic acid (ISO)

2-methyl-2-[4-(1,2,3,4-tetrahydronaphthalen-1-yl)phenoxy]propanoic acid (ISO)

2-nitrofluorene (EXP)

2-palmitoylglycerol (ISO)

2-tert-butylhydroquinone (EXP,ISO)

20-hydroxyecdysone (EXP)

22-Hydroxycholesterol (ISO)

26-hydroxycholesterol (ISO)

3'-amino-3'-deoxy-N(6),N(6)-dimethyladenosine (EXP)

3,3',4,4',5-pentachlorobiphenyl (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,3',5-triiodo-L-thyronine (EXP)

3,3'-diindolylmethane (ISO)

3,4-dihydroxybenzoate (ISO)

3,4-dihydroxybenzoic acid (EXP)

3-\{1-[3-(dimethylamino)propyl]-1H-indol-3-yl\}-4-(1H-indol-3-yl)-1H-pyrrole-2,5-dione (ISO)

3-chloropropane-1,2-diol (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

3-methoxycatechol (ISO)

3-methyladenine (ISO)

3-methylcholanthrene (EXP,ISO)

3-Nitrofluoranthene (ISO)

3-nitropropanoic acid (EXP)

3-O-Caffeoyl-1-O-methylquinic acid (ISO)

3-phenylprop-2-enal (ISO)

3H-1,2-dithiole-3-thione (ISO)

4,4'-diaminodiphenylmethane (EXP,ISO)

4,4'-sulfonyldiphenol (ISO)

4,6-dioxoheptanoic acid (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO)

4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP,ISO)

4-amino-2,6-dinitrotoluene (EXP)

4-aminobenzohydrazide (ISO)

4-aminophenol (ISO)

4-hydroxy-TEMPO (EXP,ISO)

4-Hydroxybenzyl isothiocyanate (EXP)

4-hydroxynon-2-enal (EXP,ISO)

4-hydroxyphenyl retinamide (ISO)

4-methoxyacetophenone (ISO)

4-nitrobenzyl bromide (ISO)

4-nitrophenol (ISO)

4-nitroquinoline N-oxide (ISO)

4-phenylbutylamine (EXP)

4-phenylbutyric acid (ISO)

5,5-diethylbarbituric acid (ISO)

5,6-dichloro-1-beta-D-ribofuranosyl-1H-benzimidazole (ISO)

5-(2-methylpiperazine-1-sulfonyl)isoquinoline (ISO)

5-aminolevulinic acid (EXP,ISO)

5-aza-2'-deoxycytidine (ISO)

5-bromo-2'-deoxyuridine (ISO)

5-chloro-7-iodoquinolin-8-ol (ISO)

5-fluorouracil (EXP,ISO)

5-methoxy-2-\{[(4-methoxy-3,5-dimethylpyridin-2-yl)methyl]sulfinyl\}-1H-benzimidazole (ISO)

6-aminonicotinamide (ISO)

6-chloro-2,3,4,9-tetrahydro-1H-carbazole-1-carboxamide (ISO)

6-Methoxyflavone (ISO)

6-propyl-2-thiouracil (EXP)

6alpha-methylprednisolone (EXP)

7,12-dimethyltetraphene (EXP)

7,8-dihydroxycoumarin (ISO)

7beta-aminocephalosporanic acid (ISO)

7H-xanthine (EXP)

8-Br-cAMP (EXP)

8-bromo-3',5'-cyclic GMP (ISO)

9,10-phenanthroquinone (ISO)

9-cis-retinoic acid (ISO)

9H-xanthine (EXP)

[2,8-bis(trifluoromethyl)quinolin-4-yl]-(2-piperidyl)methanol (ISO)

[6]-Shogaol (ISO)

abamectin (EXP)

Abemaciclib (ISO)

abexinostat (ISO)

acetamide (EXP)

acetic acid (EXP)

acetylcholine (EXP)

acetylsalicylic acid (EXP,ISO)

acrolein (EXP,ISO)

acrylamide (EXP,ISO)

acrylonitrile (ISO)

actinomycin D (EXP,ISO)

adefovir pivoxil (ISO)

Aescin (ISO)

aflatoxin B1 (EXP,ISO)

Aflatoxin G1 (ISO)

afzelechin (EXP)

AL 8810 (ISO)

alachlor (EXP)

aldehydo-D-glucosamine (ISO)

aldehydo-D-glucose (EXP,ISO)

aldosterone (EXP)

aldrin (ISO)

alexidine (ISO)

all-trans-retinal (ISO)

all-trans-retinoic acid (ISO)

allethrin (EXP)

allicin (ISO)

allopurinol (ISO)

alloxan (EXP)

alloxanthine (ISO)

allyl isothiocyanate (EXP,ISO)

allyl methyl disulfide (ISO)

alpha,alpha-trehalose (EXP)

alpha-D-galactose (EXP,ISO)

alpha-hexylcinnamaldehyde (ISO)

alpha-linolenic acid (EXP,ISO)

alpha-Solamarine (ISO)

AM-251 (ISO)

aminoguanidine (ISO)

amiodarone (EXP,ISO)

amitrole (EXP)

amlexanox (ISO)

ammonia (ISO)

ammonium acetate (EXP)

ammonium chloride (EXP,ISO)

ammonium hexachloroplatinate (ISO)

ammonium hydroxide (ISO)

ammonium sulfate (EXP)

Ammothamnine (EXP,ISO)

amphetamine (EXP)

amphibole asbestos (ISO)

amphotericin B (ISO)

ampicillin (ISO)

andrographolide (EXP,ISO)

anethole (EXP)

angiotensin II (EXP)

anthra[1,9-cd]pyrazol-6(2H)-one (EXP,ISO)

antimonite (ISO)

antimony(0) (ISO)

antimycin A (ISO)

apigenin (EXP,ISO)

apocynin (EXP,ISO)

arachidonic acid (EXP,ISO)

arecoline (ISO)

aristolochic acid A (EXP,ISO)

aristolochic acids (EXP)

Aroclor 1254 (ISO)

arotinoid acid (ISO)

arsane (EXP,ISO)

arsenic acid (EXP)

arsenic atom (EXP,ISO)

arsenic trichloride (ISO)

arsenite(3-) (EXP,ISO)

arsenous acid (EXP,ISO)

asbestos (ISO)

asperuloside (ISO)

astaxanthin (EXP,ISO)

astemizole (ISO)

astragaloside IV (ISO)

atazanavir sulfate (ISO)

Atipamezole (EXP)

atorvastatin calcium (EXP,ISO)

ATP (ISO)

atrazine (EXP,ISO)

aucubin (ISO)

auranofin (ISO)

aureusidin (EXP,ISO)

Aurin (ISO)

Azoxymethane (ISO)

azoxystrobin (ISO)

bacitracin (EXP)

bafilomycin A1 (ISO)

baicalein (ISO)

baicalin (EXP,ISO)

Bandrowski's base (ISO)

BAPTA (ISO)

Bardoxolone methyl (ISO)

bathocuproine disulfonic acid (ISO)

bellidifolin (EXP)

benfotiamine (ISO)

benzalkonium chloride (ISO)

benzene (ISO)

benzene-1,2,4-triol (ISO)

Benzo[a]fluorene (ISO)

benzo[a]pyrene (EXP,ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[a]pyrene-7,8-dione (ISO)

benzo[b]fluoranthene (ISO)

Benzo[b]fluorene (ISO)

Benzo[c]fluorene (ISO)

benzo[e]pyrene (ISO)

Benzo[ghi]perylene (ISO)

Benzo[k]fluoranthene (ISO)

benzoic acid (ISO)

benzoquinones (ISO)

benzyl bromide (ISO)

benzyl isothiocyanate (EXP,ISO)

benzylideneacetone (ISO)

beraprost (EXP)

berberine (EXP,ISO)

bergaptol (ISO)

Bergenin (EXP,ISO)

beta-D-glucosamine (ISO)

beta-hexachlorocyclohexane (ISO)

beta-lapachone (ISO)

beta-naphthoflavone (EXP,ISO)

beta-tocopherol (EXP)

betulin (EXP)

bifenthrin (ISO)

bilirubin IXalpha (EXP,ISO)

biliverdin (ISO)

biphenyl-2-ol (ISO)

bis(2-chloroethyl) sulfide (EXP)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisdemethoxycurcumin (ISO)

bisphenol A (EXP,ISO)

Bisphenol A diglycidyl ether (EXP)

Bisphenol A glycidylmethacrylate (ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

bleomycin A2 (EXP,ISO)

boric acid (ISO)

boron nitride (ISO)

bortezomib (EXP,ISO)

bosentan (ISO)

bromoacetate (ISO)

bromobenzene (EXP,ISO)

Bromochloroacetonitrile (ISO)

bromocriptine (ISO)

Brusatol (EXP,ISO)

Bucillamine (ISO)

buspirone (EXP)

buta-1,3-diene (ISO)

butan-1-ol (ISO)

butane-2,3-dione (EXP)

butein (ISO)

butylated hydroxyanisole (ISO)

Butylbenzyl phthalate (ISO)

cadmium acetate (EXP,ISO)

cadmium atom (EXP,ISO)

cadmium dichloride (EXP,ISO)

cadmium selenide (ISO)

cadmium sulfate (ISO)

Calcimycin (ISO)

calciol (ISO)

calcitriol (ISO)

calcium atom (ISO)

calcium dichloride (ISO)

calcium oxalate (ISO)

calcium(0) (ISO)

Calphostin C (ISO)

cannabidiol (ISO)

capsaicin (EXP,ISO)

captan (ISO)

carbamazepine (EXP,ISO)

carbaryl (ISO)

carbendazim (EXP)

carbon disulfide (EXP)

carbon monoxide (EXP,ISO)

carbon nanotube (EXP,ISO)

carbonyl cyanide p-trifluoromethoxyphenylhydrazone (ISO)

carboplatin (EXP,ISO)

carmustine (ISO)

carnosic acid (ISO)

Carnosol (ISO)

carrageenan (EXP)

carvedilol (ISO)

catalpol (ISO)

cefaloridine (EXP)

celastrol (EXP,ISO)

celecoxib (EXP,ISO)

ceric oxide (ISO)

cerium trichloride (ISO)

ceruletide (ISO)

cetylpyridinium (ISO)

CGP 52608 (ISO)

chenodeoxycholic acid (ISO)

CHIR 99021 (ISO)

chitosan (EXP,ISO)

chloral hydrate (EXP)

chloramine T (ISO)

chloroacetaldehyde (ISO)

chloroacetic acid (EXP)

Chloroacetonitrile (ISO)

chlorobenzene (EXP,ISO)

chloroethene (ISO)

chloroform (ISO)

chlorogenic acid (ISO)

chloromethylisothiazolinone (ISO)

chloropicrin (ISO)

chloroprene (ISO)

chlorotoluron (ISO)

chlorpromazine (EXP,ISO)

chlorpyrifos (EXP,ISO)

cholesterol (EXP)

choline (ISO)

chromium atom (EXP,ISO)

chromium trinitrate (ISO)

chromium trioxide (ISO)

chromium(6+) (EXP,ISO)

chrysin (EXP,ISO)

ciclopirox (ISO)

cidofovir anhydrous (ISO)

ciglitazone (ISO)

cilostazol (EXP,ISO)

cimetidine (EXP)

cinnamyl alcohol (ISO)

cisplatin (EXP,ISO)

citraconic acid (EXP,ISO)

citral (ISO)

clodronic acid (ISO)

clofibrate (ISO)

Clofop (ISO)

clozapine (ISO)

cobalt atom (EXP,ISO)

cobalt dichloride (EXP,ISO)

cobalt(2+) sulfate (ISO)

coenzyme Q10 (EXP)

colforsin daropate hydrochloride (EXP,ISO)

colistin (ISO)

coniferyl aldehyde (ISO)

copper atom (EXP,ISO)

copper(0) (EXP,ISO)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

cordycepin (EXP)

corilagin (ISO)

corosolic acid (ISO)

cortisol (ISO)

corynoline (ISO)

coumermycin A1 (ISO)

crocidolite asbestos (EXP,ISO)

crocin-1 (EXP)

crotonaldehyde (ISO)

CU-O LINKAGE (ISO)

cucurbitacin I (EXP)

cumene hydroperoxide (ISO)

Cuprizon (EXP)

curcumin (EXP,ISO)

cyanidin cation (ISO)

cyanocob(III)alamin (ISO)

cyanuric chloride (ISO)

cycloheximide (EXP,ISO)

cyclophosphamide (EXP,ISO)

cyclosporin A (EXP,ISO)

cyhalothrin (EXP)

cypermethrin (EXP,ISO)

cyproconazole (ISO)

cysteamine (EXP)

D-glucose (EXP,ISO)

D-mannitol (ISO)

D-penicillamine (ISO)

daidzein 7-O-beta-D-glucoside (ISO)

dantrolene (ISO)

dapagliflozin (EXP)

DDT (ISO)

decabromodiphenyl ether (ISO)

deguelin (ISO)

dehydrocostus lactone (ISO)

delphinidin (EXP)

delta-tocopherol (EXP)

demethoxycurcumin (ISO)

Dendrobine (ISO)

deoxycholic acid (ISO)

Deoxycorticosterone acetate (EXP)

deoxynivalenol (ISO)

desferrioxamine B (EXP,ISO)

dexamethasone (EXP,ISO)

dexmedetomidine (EXP,ISO)

dextran sulfate (ISO)

Di-n-octyl phthalate (ISO)

diallyl disulfide (EXP,ISO)

Diallyl sulfide (EXP,ISO)

diallyl trisulfide (EXP,ISO)

Diallyltetrasulfane (ISO)

diarsenic trioxide (EXP,ISO)

diazepam (ISO)

diazinon (EXP,ISO)

diazoxide (ISO)

dibenziodolium (ISO)

Dibromoacetonitrile (ISO)

dibutyl phthalate (EXP,ISO)

dichlorine (ISO)

Dichloroacetonitrile (ISO)

dichloroacetyl chloride (ISO)

dichloromethane (ISO)

dichlorvos (ISO)

diclofenac (EXP,ISO)

dicyclanil (ISO)

Didecyldimethylammonium (ISO)

dieldrin (EXP,ISO)

diethyl malate (ISO)

diethyl maleate (ISO)

diethyl phthalate (ISO)

diethyl sulfate (ISO)

diethyldithiocarbamic acid (EXP)

diethylene glycol (EXP)

diethylstilbestrol (EXP)

Diglycolic acid (EXP,ISO)

dihydroactinidiolide (ISO)

dihydroartemisinin (ISO)

dihydroxyacetone (ISO)

Diisodecyl phthalate (ISO)

diisononyl phthalate (ISO)

dimercaprol (ISO)

dimethyl fumarate (EXP,ISO)

dimethyl sulfate (ISO)

dimethyl sulfoxide (EXP,ISO)

dimethylarsinic acid (ISO)

dimethylarsinous acid (ISO)

dimethyldithiocarbamate (ISO)

dinoseb (ISO)

dioscin (EXP)

diosmetin (EXP)

dioxygen (EXP,ISO)

diphenyl diselenide (EXP)

diphenylcyclopropenone (ISO)

dipotassium bis[mu-tartrato(4-)]diantimonate(2-) trihydrate (ISO)

diprotium oxide (EXP,ISO)

dipyridamole (EXP)

diquat (ISO)

disodium selenite (EXP,ISO)

disulfiram (ISO)

dithianon (ISO)

dithionite(2-) (ISO)

dobutamine (EXP)

dopamine (EXP,ISO)

dorsomorphin (ISO)

doxorubicin (EXP,ISO)

doxycycline (ISO)

duroquinone (ISO)

ebselen (EXP)

echinacoside (ISO)

edaravone (EXP,ISO)

elemental selenium (EXP,ISO)

elesclomol (ISO)

ellagic acid (ISO)

emodin (EXP,ISO)

enalapril (EXP)

endosulfan (EXP)

enflurane (ISO)

entacapone (ISO)

entinostat (ISO)

epalrestat (ISO)

epichlorohydrin (ISO)

epoxiconazole (ISO)

erastin (ISO)

erdosteine (EXP,ISO)

ergosta-4,6,8(14),22-tetraen-3-one (ISO)

eriodictyol (EXP,ISO)

erythromycin A (ISO)

esmolol (EXP)

etacrynic acid (ISO)

ethanol (EXP,ISO)

ethionamide (ISO)

ethoxyquin (ISO)

Ethyl maltol (ISO)

ethyl methanesulfonate (ISO)

ethylbenzene (EXP,ISO)

ethylene glycol bis(2-aminoethyl)tetraacetic acid (ISO)

ethylene glycol dimethacrylate (ISO)

etomoxir (ISO)

eugenol (ISO)

farnesol (EXP,ISO)

farrerol (ISO)

fasudil (ISO)

felbamate (EXP)

fenamidone (ISO)

fenofibrate (EXP,ISO)

fenpyroximate (ISO)

fenvalerate (EXP)

ferric ammonium citrate (EXP,ISO)

ferric oxide (EXP,ISO)

ferricyanide (EXP)

ferroheme b (EXP,ISO)

ferrosoferric oxide (ISO)

ferrostatin-1 (EXP,ISO)

ferulic acid (ISO)

fisetin (EXP,ISO)

flavonol (ISO)

flumequine (ISO)

fluoranthene (ISO)

fluorescein 5-isothiocyanate (ISO)

fluoxetine (EXP,ISO)

fluprostenol (ISO)

flutamide (EXP,ISO)

fluvastatin (EXP)

fluxapyroxad (ISO)

folic acid (ISO)

formaldehyde (EXP,ISO)

formononetin (EXP,ISO)

Forsythiaside (ISO)

fructose (EXP,ISO)

fucoxanthin (EXP,ISO)

fulvestrant (EXP,ISO)

fumonisin B1 (ISO)

furan (ISO)

furazolidone (ISO)

furfural (ISO)

furosemide (EXP,ISO)

gabapentin (EXP)

galactose (EXP,ISO)

galangin (EXP)

gallic acid (EXP,ISO)

gallium nitrate (ISO)

gallocatechin (ISO)

gamma-linolenic acid (ISO)

gamma-tocopherol (EXP,ISO)

Ganoderiol F (ISO)

Garcinol (ISO)

Gastrodin (EXP,ISO)

gedunin (ISO)

gefitinib (EXP,ISO)

geldanamycin (ISO)

gemcitabine (ISO)

Genipin (ISO)

genistein (ISO)

gentamycin (EXP,ISO)

geranial (ISO)

Geraniin (ISO)

geraniol (EXP,ISO)

Gingerenone A (ISO)

ginkgolide B (ISO)

Ginkgolide C (EXP)

ginsenoside Rb1 (ISO)

ginsenoside Rg1 (ISO)

Ginsenoside Rh4 (EXP,ISO)

gliclazide (EXP,ISO)

glucose (EXP,ISO)

glutathione (EXP,ISO)

Glutathione ethyl ester (ISO)

glyburide (EXP)

glycerol (EXP,ISO)

glycerol 2-phosphate (EXP)

glycine betaine (EXP,ISO)

glycochenodeoxycholic acid (ISO)

glycocholic acid (ISO)

glycodeoxycholic acid (ISO)

glycyrrhetinate (EXP)

glycyrrhetinic acid (EXP)

glycyrrhizinic acid (ISO)

glyoxal (ISO)

glyoxylic acid (ISO)

glyphosate (ISO)

Goe 6976 (ISO)

gold atom (ISO)

gold(0) (ISO)

gossypin (EXP)

gossypol (EXP)

griseofulvin (ISO)

GSK-J4 (ISO)

GW 6471 (ISO)

halothane (ISO)

harman (ISO)

heme b (EXP,ISO)

hemin (EXP,ISO)

heparin (EXP)

herbimycin (ISO)

hesperetin (ISO)

hesperidin (EXP)

Hexachloro-1,3-butadiene (EXP)

hexachlorobenzene (EXP)

hexadecanoic acid (EXP,ISO)

hexaflumuron (EXP)

hexamethylene diisocyanate (ISO)

hexanal (ISO)

hexane (ISO)

hydralazine (ISO)

hydrogen chloride (EXP)

hydrogen peroxide (EXP,ISO)

hydroquinone (ISO)

hydroquinone O-beta-D-glucopyranoside (EXP)

hydroxycitronellal (ISO)

hydroxysafflor yellow A (ISO)

hypochlorous acid (ISO)

hypoxanthine (ISO)

iberin (EXP)

idarubicin (ISO)

Ile(5)-angiotensin II (EXP)

imidacloprid (EXP)

imidazoles (ISO)

Indeno[1,2,3-cd]pyrene (ISO)

indirubin-3'-monoxime (ISO)

indole-3-methanol (EXP,ISO)

indolin-2-one (ISO)

indoline (ISO)

indometacin (EXP,ISO)

indoxyl sulfate (ISO)

iodixanol (EXP)

iohexol (EXP,ISO)

irinotecan (ISO)

iron atom (EXP,ISO)

iron dextran (EXP,ISO)

iron dichloride (ISO)

iron trichloride (EXP,ISO)

iron(0) (EXP,ISO)

iron(2+) sulfate (anhydrous) (EXP,ISO)

iron(III) citrate (ISO)

iron(III) nitrilotriacetate (EXP,ISO)

isobutyl nitrite (ISO)

isoeugenol (ISO)

isoflurane (EXP,ISO)

isoimperatorin (ISO)

isoliquiritigenin (ISO)

isoniazide (EXP,ISO)

isoprenaline (EXP,ISO)

isorhamnetin (EXP,ISO)

ivermectin (ISO)

kaempferol (EXP,ISO)

kahweol (ISO)

kainic acid (EXP)

ketamine (EXP)

ketoconazole (EXP,ISO)

KN-93 (ISO)

KT 5720 (EXP,ISO)

L-1,4-dithiothreitol (ISO)

L-arginine (ISO)

L-ascorbic acid (EXP,ISO)

L-ascorbic acid 2-phosphate (ISO)

L-cysteine (ISO)

L-dehydroascorbic acid (ISO)

L-glutamic acid (ISO)

L-methionine (ISO)

lactacystin (EXP,ISO)

lactulose (EXP)

lansoprazole (EXP,ISO)

lanthanum trichloride (ISO)

lapatinib (ISO)

lead diacetate (EXP,ISO)

lead nitrate (EXP,ISO)

lead(0) (EXP,ISO)

lead(II) chloride (EXP,ISO)

Leonurine (EXP)

letrozole (EXP)

leukotriene B4 (ISO)

leukotriene C4 (ISO)

levetiracetam (EXP)

Licochalcone B (ISO)

lidocaine (EXP)

Liensinine (ISO)

lignan (ISO)

limonene (ISO)

limonin (ISO)

linagliptin (EXP)

linalool (ISO)

linderalactone (ISO)

linoleic acid (ISO)

linsidomine (ISO)

lipoic acid (EXP,ISO)

lipopolysaccharide (EXP,ISO)

lipoteichoic acid (EXP,ISO)

lipoxin A4 (EXP)

liquiritigenin (EXP)

liquiritin (EXP,ISO)

liraglutide (EXP)

lithium atom (ISO)

lithium chloride (EXP,ISO)

lithium hydride (ISO)

lithocholic acid (ISO)

loganin (ISO)

loliolide (ISO)

lopinavir (ISO)

losartan (EXP,ISO)

lovastatin (ISO)

lucidenic acid N (ISO)

Lucidenic acid P (ISO)

Lucidone (ISO)

lutein (ISO)

luteolin (EXP,ISO)

Luteolin 7-methyl ether (EXP)

LY294002 (EXP,ISO)

lycopene (EXP,ISO)

lysophosphatidylcholine (ISO)

Macrosphelide B (ISO)

magnesium dichloride (EXP)

Magnolol (ISO)

malaoxon (EXP)

malathion (EXP)

maleic acid (EXP)

malonaldehyde (ISO)

malvidin (ISO)

maneb (EXP,ISO)

manganese atom (EXP,ISO)

manganese(0) (EXP,ISO)

manganese(II) chloride (EXP,ISO)

mangiferin (EXP)

manidipine (ISO)

masoprocol (EXP,ISO)

mechlorethamine (EXP,ISO)

mefloquine (ISO)

meglumine amidotrizoate (EXP)

MeIQx (ISO)

melatonin (EXP,ISO)

menadione (EXP,ISO)

mercaptoethanol (ISO)

mercury atom (EXP,ISO)

mercury dibromide (ISO)

mercury dichloride (EXP,ISO)

mercury(0) (EXP,ISO)

mesalamine (EXP,ISO)

mesoporphyrin IX (ISO)

metformin (EXP,ISO)

methamphetamine (EXP,ISO)

Methanandamide (ISO)

methapyrilene (EXP)

methimazole (EXP)

methomyl (EXP)

methotrexate (EXP,ISO)

methyl 3,4,5-trihydroxybenzoate (ISO)

methyl beta-cyclodextrin (ISO)

methyl methacrylate (ISO)

methyl methanesulfonate (EXP,ISO)

methyl non-2-ynoate (ISO)

methyl salicylate (ISO)

methylarsonic acid (EXP,ISO)

methylene blue (EXP,ISO)

methylglyoxal (ISO)

methylisothiazolinone (ISO)

methyllycaconitine (EXP)

methylmercury chloride (EXP,ISO)

methylparaben (ISO)

methylphenidate (ISO)

Methysticin (ISO)

metoprolol (EXP)

metronidazole (ISO)

metyrapone (EXP)

mevastatin (ISO)

mevinphos (EXP)

microcystin-LR (ISO)

midostaurin (ISO)

mifepristone (EXP)

miquelianin (EXP,ISO)

Mitoquinone (ISO)

monascin (ISO)

mono(2-ethylhexyl) phthalate (ISO)

monocrotaline (EXP,ISO)

monosodium L-glutamate (ISO)

monothioglycerol (ISO)

montelukast (EXP)

morin (EXP)

morphine (ISO)

Morroniside (ISO)

motexafin gadolinium (ISO)

myricetin (ISO)

N(4)-hydroxycytidine (ISO)

N,N-diethyl-m-toluamide (EXP)

N,N-dimethylformamide (ISO)

N-(6-acetamidohexyl)acetamide (ISO)

N-[2-(4-bromocinnamylamino)ethyl]isoquinoline-5-sulfonamide (EXP,ISO)

N-[3,5-bis(trifluoromethyl)phenyl]-5-chloro-2-hydroxybenzamide (ISO)

N-[3-(aminomethyl)benzyl]acetamidine (EXP)

N-acetyl-L-cysteine (EXP,ISO)

N-acetylsphingosine (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (EXP,ISO)

N-ethyl-N-nitrosourea (ISO)

N-isopropyl-N'-phenyl-p-phenylenediamine (EXP)

N-methyl-4-phenylpyridinium (EXP,ISO)

N-methyl-N-nitrosourea (EXP)

N-methylformamide (ISO)

N-methylnicotinate (ISO)

N-nitrosodiethylamine (EXP,ISO)

N-nitrosodimethylamine (EXP)

N-Nitrosopyrrolidine (ISO)

n-propyl gallate (ISO)

N-tosyl-L-phenylalanyl chloromethyl ketone (EXP,ISO)

N1'-[2-[[5-[(dimethylamino)methyl]-2-furanyl]methylthio]ethyl]-N1-methyl-2-nitroethene-1,1-diamine (EXP)

nafenopin (ISO)

naphthalene (EXP,ISO)

naphthalene-1,2-diol (ISO)

naringin (EXP,ISO)

nectandrin B (ISO)

nefazodone (EXP)

Neferine (ISO)

nelfinavir (ISO)

neomycin (ISO)

nickel atom (ISO)

nickel dichloride (EXP,ISO)

nickel subsulfide (EXP)

nickel sulfate (ISO)

nicorandil (EXP)

nicotinamide (EXP)

nicotine (EXP,ISO)

nicotinic acid (EXP)

nifedipine (ISO)

nilotinib (EXP)

nimesulide (EXP)

nitisinone (ISO)

nitric oxide (EXP,ISO)

nitrites (ISO)

nitrofen (EXP)

nitrofurantoin (EXP)

nitrogen dioxide (ISO)

nitroglycerin (EXP,ISO)

nitroprusside (EXP,ISO)

Nivalenol (ISO)

nobiletin (EXP)

Nodosin (EXP)

Nonidet P-40 (ISO)

Nonylphenol (EXP)

norswertianolin (EXP)

notoginsenoside R1 (EXP,ISO)

NS-398 (EXP,ISO)

NSC 23766 (ISO)

O-acetyl-L-carnitine (EXP)

o-xylene (ISO)

ochratoxin A (EXP,ISO)

Octachlorostyrene (ISO)

octadecanoic acid (ISO)

octreotide (EXP)

okadaic acid (ISO)

olanzapine (ISO)

oleanolic acid (EXP,ISO)

oleic acid (ISO)

Olmesartan medoxomil (EXP)

Olprinone hydrochloride (EXP)

omeprazole (ISO)

Ophiopogonin D (ISO)

organoselenium compound (ISO)

oridonin (EXP)

oxaliplatin (EXP)

oxidopamine (EXP,ISO)

ozone (EXP,ISO)

p-chloromercuribenzoic acid (ISO)

p-cresol (ISO)

Pachymic acid (ISO)

paclitaxel (EXP)

paeoniflorin (ISO)

Paeonol (EXP)

Palbinone (EXP)

palmatine (ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

paraquat (EXP,ISO)

parathion (EXP)

pelargonidin (ISO)

pentachlorophenol (ISO)

pentaerythritol tetranitrate (EXP,ISO)

pentetrazol (ISO)

Pentoxifylline (ISO)

perfluorobutanesulfonic acid (ISO)

perfluorodecanoic acid (ISO)

perfluorododecanoic acid (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (EXP,ISO)

perfluorooctanoic acid (EXP,ISO)

perfluoroundecanoic acid (ISO)

permethrin (EXP)

peroxides (ISO)

peroxynitrous acid (EXP)

Pf-06840003 (ISO)

phalloidin (ISO)

phenacetin (EXP)

phencyclidine (EXP)

phenethyl caffeate (EXP,ISO)

phenethyl isothiocyanate (EXP,ISO)

phenobarbital (EXP,ISO)

phenol (ISO)

phenylarsine oxide (EXP,ISO)

phenylarsonic acid (EXP)

phenylhydrazine (EXP)

phenylmercury acetate (ISO)

phenytoin (EXP,ISO)

PhIP (EXP,ISO)

phlorizin (ISO)

phlorizin chalcone (ISO)

phorbol 13-acetate 12-myristate (ISO)

phorone (EXP,ISO)

phosgene (ISO)

phosphane (EXP)

physostigmine (EXP)

phytoestrogen (EXP)

Picein (ISO)

picoxystrobin (ISO)

pinostrobin (ISO)

pioglitazone (EXP,ISO)

piperine (EXP,ISO)

piperonyl butoxide (EXP)

pipoxolan (ISO)

pirfenidone (ISO)

pirinixic acid (EXP,ISO)

platycodin D (ISO)

plumbagin (EXP,ISO)

pluronic P-123 (ISO)

Poloxamer (ISO)

Polpunonic acid (ISO)

poly(ethylene) (ISO)

poly(I:C) (EXP)

poly(vinyl chloride) (ISO)

poly(vinylpyrrolidone) (EXP)

polymyxin B2 (ISO)

polysorbate 40 (ISO)

Potassium 2,6-dihydroxytriazinecarboxylate (ISO)

potassium bromate (ISO)

potassium chloride (EXP)

potassium dichromate (EXP,ISO)

potassium iodide (EXP)

pravastatin (EXP,ISO)

prazosin (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

probucol (EXP,ISO)

procyanidin (ISO)

procyanidin B1 (ISO)

procyanidin B2 (EXP)

procyanidin B3 (ISO)

prodigiosin (EXP)

progesterone (EXP,ISO)

propacetamol (ISO)

propan-2-ol (ISO)

propiconazole (EXP)

propofol (EXP)

propranolol (ISO)

prostaglandin A1 (ISO)

prostaglandin E2 (ISO)

protein kinase inhibitor (ISO)

protoporphyrin (EXP)

pterostilbene (ISO)

puerarin (EXP,ISO)

punicalagin (EXP)

puromycin (ISO)

pyrazinecarboxamide (EXP)

pyrazoles (EXP)

pyrethrins (EXP)

pyridine (EXP)

Pyridostigmine bromide (EXP)

pyrimidifen (ISO)

pyrithione (ISO)

pyrrolidine dithiocarbamate (EXP,ISO)

pyrrolidines (EXP)

pyrroloquinoline quinone (EXP)

quartz (EXP,ISO)

quercetin (EXP,ISO)

quercetin 3-O-beta-D-glucofuranoside (EXP)

quercetin 3-O-beta-D-glucopyranoside (EXP)

quercetin 4'-O-beta-D-glucopyranoside (ISO)

quinolin-8-ol (EXP,ISO)

rac-lactic acid (ISO)

raloxifene (EXP,ISO)

ranitidine (EXP)

raspberry ketone (ISO)

razoxane (ISO)

reactive oxygen species (EXP,ISO)

resolvin D1 (ISO)

resorcinol (ISO)

resveratrol (EXP,ISO)

Rhynchophylline (EXP,ISO)

rifampicin (EXP,ISO)

rimonabant (EXP)

ritonavir (ISO)

Ro 31-8220 (ISO)

roflumilast (EXP,ISO)

rosmarinic acid (ISO)

rotenone (EXP,ISO)

rottlerin (EXP,ISO)

Ruscogenin (ISO)

Rutecarpine (ISO)

rutin (ISO)

ryanodine (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

S-(1,2-Dichlorovinyl)glutathione (ISO)

S-allylcysteine (ISO)

S-butyl-DL-homocysteine (S,R)-sulfoximine (EXP,ISO)

S-nitroso-N-acetyl-D-penicillamine (EXP)

S-nitrosoglutathione (ISO)

Salinomycin (ISO)

salubrinal (ISO)

salvianolic acid B (EXP,ISO)

saxagliptin (EXP)

SB 203580 (EXP,ISO)

SB 431542 (ISO)

SCH 23390 (EXP)

SCH772984 (ISO)

scopolamine (ISO)

scutellarin (ISO)

Se-methyl-L-selenocysteine (ISO)

Se-methylselenocysteine (ISO)

selenium atom (EXP,ISO)

selenomethionine (ISO)

serpentine asbestos (ISO)

sesquiterpene (ISO)

sevoflurane (EXP,ISO)

sildenafil citrate (EXP)

silibinin (EXP)

silicon atom (ISO)

silicon dioxide (EXP,ISO)

silver atom (EXP,ISO)

silver(0) (EXP,ISO)

silver(1+) nitrate (ISO)

simvastatin (EXP,ISO)

sinapic acid (EXP)

sirolimus (EXP,ISO)

sodium arsenate (EXP,ISO)

sodium arsenite (EXP,ISO)

sodium benzoate (EXP)

sodium chloride (ISO)

sodium cholate (EXP)

sodium dichromate (EXP,ISO)

sodium dodecyl sulfate (EXP,ISO)

sodium fluoride (EXP,ISO)

sodium hypochlorite (ISO)

Sodium oleate (ISO)

solanesol (ISO)

Soman (EXP)

spironolactone (EXP)

staurosporine (ISO)

sterigmatocystin (EXP)

streptozocin (EXP,ISO)

styrene (ISO)

styrene oxide (ISO)

succimer (ISO)

sucrose (EXP)

sulfadimethoxine (EXP)

sulfaphenazole (EXP)

sulfasalazine (EXP)

sulforaphane (EXP,ISO)

sulfur dioxide (EXP)

sulindac (ISO)

sunitinib (EXP,ISO)

superoxide (EXP,ISO)

surfactin (ISO)

surfactin C (ISO)

T-2 toxin (ISO)

tacrine (EXP)

tacrolimus hydrate (EXP,ISO)

tadalafil (EXP)

tamoxifen (EXP,ISO)

tangeretin (EXP,ISO)

Tanshinone I (EXP,ISO)

taurine (EXP,ISO)

taurodeoxycholic acid (ISO)

tebufenpyrad (ISO)

tectorigenin (ISO)

temozolomide (ISO)

TEMPO (ISO)

tenofovir disoproxil fumarate (EXP)

tert-butyl hydroperoxide (EXP,ISO)

Tesaglitazar (EXP)

testosterone (EXP,ISO)

tetrachloro-1,4-benzoquinone (ISO)

tetrachloromethane (EXP,ISO)

tetracycline (EXP)

tetrahydropalmatine (ISO)

tetramethylpyrazine (ISO)

tetrathiomolybdate(2-) (EXP,ISO)

thallium sulfate (EXP)

thapsigargin (ISO)

Theaflavin 3,3'-digallate (EXP,ISO)

thiabendazole (ISO)

thiazoles (ISO)

thifluzamide (ISO)

thimerosal (ISO)

thioacetamide (EXP,ISO)

thiostrepton (ISO)

thiram (ISO)

thymidine (ISO)

thymine (ISO)

thymoquinone (ISO)

ticlopidine (ISO)

tideglusib (ISO)

tienilic acid (ISO)

Timosaponin b ii (ISO)

tin(II) chloride (anhydrous) (EXP)

Tiopronin (ISO)

Tiron (ISO)

titanium dioxide (ISO)

tobramycin (ISO)

toluene (ISO)

topotecan (EXP)

Torularhodin (EXP,ISO)

trans-anethole (EXP)

trans-isoeugenol (ISO)

trans-rhaponticin (EXP)

tranylcypromine (EXP)

Tremulacin (ISO)

triacetin (ISO)

triacsin C (ISO)

tributylstannane (EXP,ISO)

Tributyltin oxide (EXP,ISO)

tricalcium bis(phosphate) (ISO)

tricetin (ISO)

Tricetinidin (EXP)

trichloroacetaldehyde (ISO)

trichloroacetic acid (ISO)

Trichloroacetonitrile (ISO)

trichloroethene (EXP,ISO)

trichostatin A (EXP,ISO)

triclocarban (ISO)

triclosan (ISO)

trilobatin (EXP,ISO)

trimethylarsine oxide (ISO)

trimethyltin (ISO)

triphenyl phosphate (EXP,ISO)

triphenylene (ISO)

Triptolide (EXP,ISO)

Tris(1-aziridinyl)phosphine oxide (ISO)

tris(2-butoxyethyl) phosphate (ISO)

troglitazone (EXP,ISO)

tropisetron (EXP)

trovafloxacin (ISO)

Tungsten carbide (ISO)

tunicamycin (EXP,ISO)

tyrphostin AG 1478 (ISO)

undecan-2-one (EXP,ISO)

urea (ISO)

urethane (ISO)

ursolic acid (EXP)

valproic acid (EXP,ISO)

valsartan (EXP)

vancomycin (EXP,ISO)

vanillin (ISO)

verapamil (EXP,ISO)

verteporfin (ISO)

vincaleukoblastine (EXP)

vincamine (ISO)

vinclozolin (EXP)

vincristine (EXP,ISO)

Vinpocetine (EXP)

vitamin E (EXP,ISO)

vitexin (ISO)

vorinostat (EXP)

warfarin (EXP)

water (EXP,ISO)

wedelolactone (ISO)

withaferin A (ISO)

wortmannin (EXP,ISO)

Xamoterol (EXP)

Xanthatin (ISO)

xanthohumol (ISO)

XAV939 (ISO)

yttrium chloride (EXP)

zearalenone (ISO)

zidovudine (EXP)

zinc acetate (EXP,ISO)

zinc atom (EXP,ISO)

zinc dichloride (EXP,ISO)

zinc molecular entity (ISO)

zinc oxide (EXP,ISO)

zinc protoporphyrin (EXP,ISO)

zinc pyrithione (ISO)

zinc sulfate (EXP,ISO)

zinc(0) (EXP,ISO)

ziprasidone (EXP)

ziram (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

angiogenesis (IDA)

apoptotic process (IEA)

cellular response to arsenic-containing substance (IEA,ISO)

cellular response to cadmium ion (IEA,ISO)

cellular response to cisplatin (IEA,ISO)

cellular response to heat (IEA,ISO)

cellular response to nutrient (IEP)

epithelial cell apoptotic process (IEA,ISO)

erythrocyte differentiation (ISO)

erythrocyte homeostasis (IEA,ISO)

heme catabolic process (IBA,IDA,IEA,ISO)

heme metabolic process (IEA,ISO)

heme oxidation (IBA,IEA,ISO)

host-mediated suppression of viral transcription (ISO)

intracellular iron ion homeostasis (IEA,ISO)

intracellular signal transduction (IDA)

intrinsic apoptotic signaling pathway in response to DNA damage (IDA)

liver regeneration (IMP)

macroautophagy (IEA,ISO)

multicellular organismal-level iron ion homeostasis (IEA,ISO)

negative regulation of cell population proliferation (IDA)

negative regulation of cytokine production involved in inflammatory response (IEA,ISO)

negative regulation of DNA binding (IDA)

negative regulation of DNA-binding transcription factor activity (IDA)

negative regulation of epithelial cell apoptotic process (IMP)

negative regulation of extrinsic apoptotic signaling pathway via death domain receptors (IEA,ISO)

negative regulation of ferroptosis (IEA,ISO,ISS)

negative regulation of macroautophagy (IEA,ISO)

negative regulation of mast cell cytokine production (IDA)

negative regulation of mast cell degranulation (IDA)

negative regulation of muscle cell apoptotic process (IDA)

negative regulation of neuron apoptotic process (IMP)

negative regulation of smooth muscle cell proliferation (IEA,IMP,ISO)

negative regulation of vascular associated smooth muscle cell proliferation (IMP)

negative regulation of viral life cycle (ISO)

phospholipid metabolic process (TAS)

positive regulation of angiogenesis (IEA,IMP,ISO)

positive regulation of blood vessel endothelial cell proliferation involved in sprouting angiogenesis (IEA,ISO)

positive regulation of canonical NF-kappaB signal transduction (ISO)

positive regulation of cell migration involved in sprouting angiogenesis (IEA,ISO)

positive regulation of epithelial cell apoptotic process (IEA,ISO)

positive regulation of macroautophagy (IEA,ISO)

positive regulation of smooth muscle cell proliferation (IEA,ISO)

regulation of blood pressure (IDA)

regulation of transcription by RNA polymerase II (IDA)

response to 3-methylcholanthrene (IEP)

response to arachidonate (IMP)

response to estrogen (IDA)

response to hydrogen peroxide (IDA)

response to hypoxia (IEP,IMP)

response to nicotine (IEA,ISO)

response to oxidative stress (IBA,IDA,IEA,ISO)

response to xenobiotic stimulus (IEP)

small GTPase-mediated signal transduction (IDA)

wound healing involved in inflammatory response (IEA,ISO)

Cellular Component

caveola (IDA)

cytosol (IEA,ISO)

endoplasmic reticulum (IDA,IEA,ISO)

endoplasmic reticulum membrane (IEA,ISO,ISS)

membrane (IEA)

nucleus (IDA,IEA,ISO)

perinuclear region of cytoplasm (IEA,ISO)

Molecular Function

arachidonate omega-hydroxylase activity (IMP)

enzyme binding (IPI)

heme binding (IBA,IDA,IEA,ISO)

heme oxygenase (decyclizing) activity (IBA,IDA,IEA,ISO)

identical protein binding (IEA,ISO)

metal ion binding (IEA)

oxidoreductase activity (IEA)

phospholipase D activity (IDA)

protein binding (IPI,ISO)

protein homodimerization activity (IEA,ISO)

structural molecule activity (IEA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

acute intermittent porphyria pathway (ISO)

erythropoietic porphyria pathway (ISO)

heme degradation pathway (IDA)

hereditary coproporphyria pathway (ISO)

hypertension pathway (IMP)

hypoxia inducible factor pathway (ISO)

oxidative stress response pathway (IDA)

porphyrin and chlorophyll metabolic pathway (IEA)

porphyrin metabolic pathway (ISO)

variegate porphyria pathway (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

decreased systemic arterial blood pressure (IDA)

increased vasodilation (IDA)

References

References - curated

#	Reference Title	Reference Citation
1.	3-methylcholanthrene and benzo(a)pyrene modulate cardiac cytochrome P450 gene expression and arachidonic acid metabolism in male Sprague Dawley rats.	Aboutabl ME, etal., Br J Pharmacol. 2009 Dec;158(7):1808-19. doi: 10.1111/j.1476-5381.2009.00461.x.
2.	Heme activates the heme oxygenase-1 gene in renal epithelial cells by stabilizing Nrf2.	Alam J, etal., Am J Physiol Renal Physiol 2003 Apr;284(4):F743-52.
3.	Heme oxygenase-1 is expressed in carotid atherosclerotic plaques infected by Helicobacter pylori and is more prevalent in asymptomatic subjects.	Ameriso SF, etal., Stroke. 2005 Sep;36(9):1896-900. Epub 2005 Aug 11.
4.	Role of heme oxygenase-1 in protection of the kidney after hemorrhagic shock.	Arimori Y, etal., Int J Mol Med. 2010 Jul;26(1):27-32.
5.	Microsatellite polymorphism in the heme oxygenase-1 gene promoter is associated with iron status in persons with type 2 diabetes mellitus.	Arredondo M, etal., Am J Clin Nutr. 2007 Nov;86(5):1347-53.
6.	Heme oxygenase-1-related carbon monoxide production and ventricular fibrillation in isolated ischemic/reperfused mouse myocardium.	Bak I, etal., FASEB J. 2003 Nov;17(14):2133-5. Epub 2003 Sep 4.
7.	The role of AT1-receptor blockade on reactive oxygen species and cardiac autonomic drive in experimental hyperthyroidism.	Baraldi D, etal., Auton Neurosci. 2013 Oct;177(2):163-9. doi: 10.1016/j.autneu.2013.04.003. Epub 2013 Apr 26.
8.	Heme oxygenase-1 gene promoter polymorphism is associated with reduced incidence of acute chest syndrome among children with sickle cell disease.	Bean CJ, etal., Blood. 2012 Nov 1;120(18):3822-8. doi: 10.1182/blood-2011-06-361642. Epub 2012 Sep 10.
9.	Induction of Hsp27 and Hsp32 stress proteins and vimentin in glial cells of the rat hippocampus following hyperthermia.	Bechtold DA and Brown IR, Neurochem Res 2003 Aug;28(8):1163-73.
10.	Heme oxygenase-1 gene delivery by Sleeping Beauty inhibits vascular stasis in a murine model of sickle cell disease.	Belcher JD, etal., J Mol Med (Berl). 2010 Jul;88(7):665-75. doi: 10.1007/s00109-010-0613-6. Epub 2010 Mar 23.
11.	Pharmacological activation of heme oxygenase (HO)-1/carbon monoxide pathway prevents the development of peripheral neuropathic pain in Wistar rats.	Bijjem KR, etal., Naunyn Schmiedebergs Arch Pharmacol. 2013 Jan;386(1):79-90. doi: 10.1007/s00210-012-0816-1. Epub 2012 Dec 9.
12.	Normalization and subtraction: two approaches to facilitate gene discovery.	Bonaldo MF, etal., Genome Res 1996 Sep;6(9):791-806.
13.	Hemin induction of HO-1 protects against LPS-induced septic ileus.	Bortscher S, etal., J Surg Res. 2012 Dec;178(2):866-73. doi: 10.1016/j.jss.2012.07.064. Epub 2012 Aug 15.
14.	Increase in heme oxygenase-1 levels ameliorates renovascular hypertension.	Botros FT, etal., Kidney Int. 2005 Dec;68(6):2745-55.
15.	Intramuscular heat shock protein 72 and heme oxygenase-1 mRNA are reduced in patients with type 2 diabetes: evidence that insulin resistance is associated with a disturbed antioxidant defense mechanism.	Bruce CR, etal., Diabetes. 2003 Sep;52(9):2338-45.
16.	Lentiviral-human heme oxygenase targeting endothelium improved vascular function in angiotensin II animal model of hypertension.	Cao J, etal., Hum Gene Ther. 2011 Mar;22(3):271-82. doi: 10.1089/hum.2010.059. Epub 2011 Jan 27.
17.	High-fat diet exacerbates renal dysfunction in SHR: reversal by induction of HO-1-adiponectin axis.	Cao J, etal., Obesity (Silver Spring). 2012 May;20(5):945-53. doi: 10.1038/oby.2011.365. Epub 2011 Dec 22.
18.	Regulation of heme oxygenase-1 by nitric oxide during hepatopulmonary syndrome.	Carter EP, etal., Am J Physiol Lung Cell Mol Physiol 2002 Aug;283(2):L346-53.
19.	Heme oxygenase-1 inhibition prevents intimal hyperplasia enhancing nitric oxide-dependent apoptosis of vascular smooth muscle cells.	Cerrito MG, etal., Biol Pharm Bull. 2011;34(8):1204-14.
20.	Baicalein protects against retinal ischemia by antioxidation, antiapoptosis, downregulation of HIF-1alpha, VEGF, and MMP-9 and upregulation of HO-1.	Chao HM, etal., J Ocul Pharmacol Ther. 2013 Jul-Aug;29(6):539-49. doi: 10.1089/jop.2012.0179. Epub 2013 Mar 28.
21.	Regulation of heme oxygenase 1 expression by miR-27b with stem cell therapy for liver regeneration in rats.	Chen KD, etal., Transplant Proc. 2014 May;46(4):1198-200. doi: 10.1016/j.transproceed.2013.12.013.
22.	Naringenin inhibits TNF-alpha induced VSMC proliferation and migration via induction of HO-1.	Chen S, etal., Food Chem Toxicol. 2012 Sep;50(9):3025-31. doi: 10.1016/j.fct.2012.06.006. Epub 2012 Jun 16.
23.	Study on changes of heme oxygenase-1 expression in patients with coronary heart disease.	Chen SM, etal., Clin Cardiol. 2005 Apr;28(4):197-201.
24.	Elevated serum heme oxygenase-1 and insulin-like growth factor-1 levels in patients with Henoch-Schonlein purpura.	Chen T, etal., Rheumatol Int. 2011 Mar;31(3):321-6. doi: 10.1007/s00296-009-1254-3. Epub 2009 Dec 16.
25.	Increased vascular heme oxygenase-1 expression contributes to arterial vasodilation in experimental cirrhosis in rats.	Chen YC, etal., Hepatology. 2004 Apr;39(4):1075-87.
26.	Microsatellite polymorphism in promoter of heme oxygenase-1 gene is associated with susceptibility to coronary artery disease in type 2 diabetic patients.	Chen YH, etal., Hum Genet. 2002 Jul;111(1):1-8. Epub 2002 Jun 19.
27.	Oxidant stress responses in influenza virus pneumonia: gene expression and transcription factor activation.	Choi AM, etal., Am J Physiol. 1996 Sep;271(3 Pt 1):L383-91.
28.	Beneficial effect of prolonged heme oxygenase 1 activation in a rat model of chronic heart failure.	Collino M, etal., Dis Model Mech. 2013 Jul;6(4):1012-20. doi: 10.1242/dmm.011528. Epub 2013 Apr 16.
29.	Heme oxygenase-1 plays a pro-life role in experimental brain stem death via nitric oxide synthase I/protein kinase G signaling at rostral ventrolateral medulla.	Dai KY, etal., J Biomed Sci. 2010 Sep 7;17:72. doi: 10.1186/1423-0127-17-72.
30.	Effectiveness of miltefosine treatment in targeting anti-leishmanial HO-1/Nrf-2-mediated oxidative responses in visceral leishmaniasis patients.	Das S, etal., J Antimicrob Chemother. 2013 Sep;68(9):2059-65. doi: 10.1093/jac/dkt162. Epub 2013 May 31.
31.	The protection by heme oxygenase-1 induction against thioacetamide-induced liver toxicity is associated with changes in arginine and asymmetric dimethylarginine.	Develi-Is S, etal., Cell Biochem Funct. 2013 Mar;31(2):122-8. doi: 10.1002/cbf.2866. Epub 2012 Aug 13.
32.	Hyperglycemia in streptozotocin-induced diabetic rat increases infarct size associated with low levels of myocardial HO-1 during ischemia/reperfusion.	Di Filippo C, etal., Diabetes. 2005 Mar;54(3):803-10.
33.	Therapeutic effect of placenta-derived mesenchymal stem cells on hypoxic-ischemic brain damage in rats.	Ding HF, etal., World J Pediatr. 2015 Feb;11(1):74-82. doi: 10.1007/s12519-014-0531-8. Epub 2014 Dec 1.
34.	Transient elevation of serum bilirubin (a heme oxygenase-1 metabolite) level in hemorrhagic stroke: bilirubin is a marker of oxidant stress.	Dohi K, etal., Acta Neurochir Suppl. 2003;86:247-9.
35.	Heme oxygenase (HO)-1 is upregulated in the nasal mucosa with allergic rhinitis.	Elhini A, etal., Laryngoscope. 2006 Mar;116(3):446-50.
36.	A microsatellite polymorphism in the heme oxygenase-1 gene promoter is associated with increased bilirubin and HDL levels but not with coronary artery disease.	Endler G, etal., Thromb Haemost. 2004 Jan;91(1):155-61.
37.	The protective effect of salvianolic acid B on blood-spinal cord barrier after compression spinal cord injury in rats.	Fan ZK, etal., J Mol Neurosci. 2013 Nov;51(3):986-93. doi: 10.1007/s12031-013-0083-8. Epub 2013 Aug 14.
38.	Increased heme oxygenase-1 expression in premature infants with respiratory distress syndrome.	Farkas I, etal., Eur J Pediatr. 2008 Dec;167(12):1379-83. Epub 2008 Feb 27.
39.	Absence of heme oxygenase-1 expression in the lung parenchyma exacerbates endotoxin-induced acute lung injury and decreases surfactant protein-B levels.	Fredenburgh LE, etal., Cell Mol Biol (Noisy-le-grand). 2005 Oct 3;51(5):513-20.
40.	Expression of heme oxygenase-1 protein and messenger RNA in permanent cerebral ischemia in rats.	Fu R, etal., Neurol Res. 2006 Jan;28(1):38-45.
41.	Heme oxygenase-1 polymorphism associated with severity of chronic obstructive pulmonary disease.	Fu WP, etal., Chin Med J (Engl). 2007 Jan 5;120(1):12-6.
42.	Relationship between COPD and polymorphisms of HOX-1 and mEPH in a Chinese population.	Fu WP, etal., Oncol Rep. 2007 Feb;17(2):483-8.
43.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
44.	Systemic perfluorohexane attenuates lung injury induced by lipopolysaccharide in rats: the role of heme oxygenase-1.	Ge ZJ, etal., Pharmacol Rep. 2010 Jan-Feb;62(1):170-7.
45.	Induction of heme oxygenase 1 attenuates placental ischemia-induced hypertension.	George EM, etal., Hypertension. 2011 May;57(5):941-8. doi: 10.1161/HYPERTENSIONAHA.111.169755. Epub 2011 Mar 7.
46.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
47.	Antioxidant role of heme oxygenase-1 in prehepatic portal hypertensive rats.	Gonzales S, etal., World J Gastroenterol. 2006 Jul 14;12(26):4149-55.
48.	The systemic administration of oleoylethanolamide exerts neuroprotection of the nigrostriatal system in experimental Parkinsonism.	Gonzalez-Aparicio R, etal., Int J Neuropsychopharmacol. 2014 Mar;17(3):455-68. doi: 10.1017/S1461145713001259. Epub 2013 Oct 29.
49.	Neuroprotective role of heme-oxygenase 1 against iodoacetate-induced toxicity in rat cerebellar granule neurons: Role of bilirubin.	Gonzalez-Reyes S, etal., Free Radic Res. 2009 Mar;43(3):214-23. Epub 2009 Jan 28.
50.	Heme oxygenase-1 reduces murine monocrotaline-induced pulmonary inflammatory responses and resultant right ventricular overload.	Goto J, etal., Antioxid Redox Signal. 2002 Aug;4(4):563-8.
51.	Induction of heme oxygenase-1, biliverdin reductase and H-ferritin in lung macrophage in smokers with primary spontaneous pneumothorax: role of HIF-1alpha.	Goven D, etal., PLoS One. 2010 May 28;5(5):e10886.
52.	Dynamic Changes of Heme Oxygenase-1 in the Hippocampus of Rats After Acute Carbon Monoxide Poisoning.	Guan L, etal., Arch Environ Contam Toxicol. 2010 Apr 27.
53.	Induction of heme oxygenase-1 with hemin attenuates hippocampal injury in rats after acute carbon monoxide poisoning.	Guan L, etal., Toxicology. 2009 Aug 3;262(2):146-52. Epub 2009 Jun 9.
54.	Clinical restenosis after coronary stent implantation is associated with the heme oxygenase-1 gene promoter polymorphism and the heme oxygenase-1 +99G/C variant.	Gulesserian T, etal., Clin Chem. 2005 Sep;51(9):1661-5. Epub 2005 Jul 14.
55.	Effects of heme oxygenase-1 on pulmonary function and structure in rats with liver cirrhosis.	Guo SB, etal., Chin Med J (Engl). 2011 Mar;124(6):918-22.
56.	Transduction of PEP-1-heme oxygenase-1 fusion protein reduces myocardial ischemia/reperfusion injury in rats.	He XH, etal., J Cardiovasc Pharmacol. 2013 Nov;62(5):436-42. doi: 10.1097/FJC.0b013e3182a0b638.
57.	Involvement of NADPH in the interaction between heme oxygenase-1 and cytochrome P450 reductase.	Higashimoto Y, etal., J Biol Chem. 2005 Jan 7;280(1):729-37. Epub 2004 Oct 31.
58.	Heme oxygenase-1 inhibits rat and human breast cancer cell proliferation: mutual cross inhibition with indoleamine 2,3-dioxygenase.	Hill M, etal., FASEB J. 2005 Dec;19(14):1957-68.
59.	Microarray studies of genomic oxidative stress and cell cycle responses in obstructive sleep apnea.	Hoffmann MS, etal., Antioxid Redox Signal. 2007 Jun;9(6):661-9.
60.	Simvastatin ameliorates established pulmonary hypertension through a heme oxygenase-1 dependent pathway in rats.	Hsu HH, etal., Respir Res. 2009 May 2;10:32.
61.	2-methoxycinnamaldehyde from Cinnamomum cassia reduces rat myocardial ischemia and reperfusion injury in vivo due to HO-1 induction.	Hwa JS, etal., J Ethnopharmacol. 2012 Jan 31;139(2):605-15. doi: 10.1016/j.jep.2011.12.001. Epub 2011 Dec 9.
62.	Combinational therapy of ischemic brain stroke by delivery of heme oxygenase-1 gene and dexamethasone.	Hyun H, etal., Biomaterials. 2011 Jan;32(1):306-15. doi: 10.1016/j.biomaterials.2010.08.116.
63.	Hemin prevents in-stent stenosis in rat and rabbit models by inducing heme-oxygenase-1.	Hyvelin JM, etal., J Vasc Surg. 2010 Feb;51(2):417-28.
64.	Dietary alpha-linolenic acid-rich formula reduces adhesion molecules in rats with experimental colitis.	Ibrahim A, etal., Nutrition. 2012 Jul;28(7-8):799-802. doi: 10.1016/j.nut.2011.10.008. Epub 2012 Jan 20.
65.	Heme oxygenase-1 against vascular insufficiency: roles of atherosclerotic disorders.	Ishikawa K Curr Pharm Des. 2003;9(30):2489-97.
66.	Expression of rat heme oxygenase in Escherichia coli as a catalytically active, full-length form that binds to bacterial membranes.	Ishikawa K, etal., Eur J Biochem. 1991 Nov 15;202(1):161-5. doi: 10.1111/j.1432-1033.1991.tb16357.x.
67.	Upregulation of cytoprotective defense mechanisms and hypoxia-responsive proteins imparts tolerance to acute hypobaric hypoxia.	Jain K, etal., High Alt Med Biol. 2013 Mar;14(1):65-77. doi: 10.1089/ham.2012.1064.
68.	Activation of hypoxia-inducible factor-1alpha via nuclear factor-kappa B in rats with chronic obstructive pulmonary disease.	Jiang H, etal., Acta Biochim Biophys Sin (Shanghai). 2010 Jul;42(7):483-8. doi: 10.1093/abbs/gmq041. Epub 2010 Jun 10.
69.	Heme oxygenase inhibitor restores arteriolar nitric oxide function in dahl rats.	Johnson FK, etal., Hypertension 2003 Jan;41(1):149-55.
70.	Postischemic cardiac recovery in heme oxygenase-1 transgenic ischemic/reperfused mouse myocardium.	Juhasz B, etal., J Cell Mol Med. 2010 Aug 16.
71.	Epigallocatechin-3-gallate protects kidneys from ischemia reperfusion injury by HO-1 upregulation and inhibition of macrophage infiltration.	Kakuta Y, etal., Transpl Int. 2011 May;24(5):514-22. doi: 10.1111/j.1432-2277.2011.01224.x. Epub 2011 Feb 3.
72.	Polymorphisms of heme oxygenase-1 and bilirubin UDP-glucuronosyltransferase genes are not associated with Kawasaki disease susceptibility.	Kanai M, etal., Tohoku J Exp Med. 2003 Jul;200(3):155-9.
73.	Heme: a novel inducer of MCP-1 through HO-dependent and HO-independent mechanisms.	Kanakiriya SK, etal., Am J Physiol Renal Physiol 2003 Mar;284(3):F546-54.
74.	Heme oxygenase-1 gene promoter polymorphism is associated with coronary artery disease in Japanese patients with coronary risk factors.	Kaneda H, etal., Arterioscler Thromb Vasc Biol. 2002 Oct 1;22(10):1680-5.
75.	Heme oxygenase 1 modulates thrombomodulin and endothelial protein C receptor levels to attenuate septic kidney injury.	Kang K, etal., Shock. 2013 Aug;40(2):136-43. doi: 10.1097/SHK.0b013e31829d23f5.
76.	Vascular insult accompanied by overexpressed heme oxygenase-1 as a pathophysiological mechanism in experimental neurolathyrism with hind-leg paraparesis.	Kawaguchi K, etal., Biochem Biophys Res Commun. 2012 Nov 9;428(1):160-6. doi: 10.1016/j.bbrc.2012.10.032. Epub 2012 Oct 12.
77.	Hydrogen gas reduces hyperoxic lung injury via the Nrf2 pathway in vivo.	Kawamura T, etal., Am J Physiol Lung Cell Mol Physiol. 2013 May 15;304(10):L646-56. doi: 10.1152/ajplung.00164.2012. Epub 2013 Mar 8.
78.	Cytoprotective and antiapoptotic effects of IL-13 in hepatic cold ischemia/reperfusion injury are heme oxygenase-1 dependent.	Ke B, etal., Am J Transplant. 2003 Sep;3(9):1076-82.
79.	Heme oxygenase 1 mediates the immunomodulatory and antiapoptotic effects of interleukin 13 gene therapy in vivo and in vitro.	Ke B, etal., Hum Gene Ther 2002 Oct 10;13(15):1845-57.
80.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
81.	Association of susceptibility to the development of lung adenocarcinoma with the heme oxygenase-1 gene promoter polymorphism.	Kikuchi A, etal., Hum Genet. 2005 Apr;116(5):354-60. Epub 2005 Feb 2.
82.	Phenolic antioxidants tert-butyl-bisphenol and vitamin E decrease oxidative stress and enhance vascular function in an animal model of rhabdomyolysis yet do not improve acute renal dysfunction.	Kim HB, etal., Free Radic Res. 2011 Sep;45(9):1000-12. doi: 10.3109/10715762.2011.590137. Epub 2011 Jul 5.
83.	Caveolae compartmentalization of heme oxygenase-1 in endothelial cells.	Kim HP, etal., FASEB J 2004 Jul;18(10):1080-9.
84.	Association of reduced heme oxygenase-1 with excessive Toll-like receptor 4 expression in peripheral blood mononuclear cells in Behcet's disease.	Kirino Y, etal., Arthritis Res Ther. 2008;10(1):R16. doi: 10.1186/ar2367. Epub 2008 Jan 31.
85.	cDNA microarray analysis of gene expression in rat alveolar macrophages in response to organic extract of diesel exhaust particles.	Koike E, etal., Toxicol Sci 2002 Jun;67(2):241-6.
86.	High extracellular induced sputum haem oxygenase-1 in sarcoidosis and chronic beryllium disease.	Kokturk N, etal., Eur J Clin Invest. 2009 Jul;39(7):584-90. Epub 2009 Apr 27.
87.	Sunitinib Inhibits Breast Cancer Cell Proliferation by Inducing Apoptosis, Cell-cycle Arrest and DNA Repair While Inhibiting NF-κB Signaling Pathways.	Korashy HM, etal., Anticancer Res. 2017 Sep;37(9):4899-4909. doi: 10.21873/anticanres.11899.
88.	Evaluation of the heme oxygenase-1 expression in esophagitis and esophageal cancer induced by different reflux experimental models and diethylnitrosamine.	Kruel CR, etal., Acta Cir Bras. 2010 Jun;25(3):304-10.
89.	Transient limb ischemia induces remote preconditioning in liver among rats: the protective role of heme oxygenase-1.	Lai IR, etal., Transplantation. 2006 May 15;81(9):1311-7.
90.	Expression and regulation of hemeoxygenase 1 in healthy human lung and interstitial lung disorders.	Lakari E, etal., Hum Pathol. 2001 Nov;32(11):1257-63.
91.	Expression of heme oxygenase-1 in response to myocardial infarction in rats.	Lakkisto P, etal., J Mol Cell Cardiol. 2002 Oct;34(10):1357-65.
92.	Heme oxygenase-1 mediated memorial and revivable protective effect of ischemic preconditioning on brain injury.	Le LL, etal., CNS Neurosci Ther. 2013 Dec;19(12):963-8. doi: 10.1111/cns.12152. Epub 2013 Jul 22.
93.	Aprotinin Inhibits Vascular Smooth Muscle Cell Inflammation and Proliferation via Induction of HO-1.	Lee DH, etal., Korean J Physiol Pharmacol. 2009 Apr;13(2):123-9. Epub 2009 Apr 30.
94.	Anti-asthmatic effect of Sanguisorba officinalis L. and potential role of heme oxygenase-1 in an ovalbumin-induced murine asthma model.	Lee NH, etal., Int J Mol Med. 2010 Aug;26(2):201-8.
95.	Baicalein, an active component of Scutellaria baicalensis Georgi, improves cardiac contractile function in endotoxaemic rats via induction of heme oxygenase-1 and suppression of inflammatory responses.	Lee YM, etal., J Ethnopharmacol. 2011 Apr 26;135(1):179-85. doi: 10.1016/j.jep.2011.03.009. Epub 2011 Mar 17.
96.	Hypoxia inducible factor-1 alpha correlates the expression of heme oxygenase 1 gene in pulmonary arteries of rat with hypoxia-induced pulmonary hypertension.	Li QF and Dai AG, Acta Biochim Biophys Sin (Shanghai). 2004 Feb;36(2):133-40.
97.	Immunocytochemical localization and expression of heme oxygenase-1 in primary astroglial cell cultures during differentiation: effect of glutamate.	Li Volti G, etal., Biochem Biophys Res Commun 2004 Mar 5;315(2):517-24.
98.	Tin chloride enhances parvalbumin-positive interneuron survival by modulating heme metabolism in a model of cerebral ischemia.	Li Volti G, etal., Neurosci Lett. 2011 Mar 29;492(1):33-8. doi: 10.1016/j.neulet.2011.01.048. Epub 2011 Jan 27.
99.	Mesenchymal Stromal Cells Expressing Heme Oxygenase-1 Reverse Pulmonary Hypertension.	Liang OD, etal., Stem Cells. 2010 Oct 18.
100.	Heme oxygenase-1 protein localizes to the nucleus and activates transcription factors important in oxidative stress.	Lin Q, etal., J Biol Chem. 2007 Jul 13;282(28):20621-33. Epub 2007 Apr 12.
101.	Lesional accumulation of heme oxygenase-1+ microglia/macrophages in rat traumatic brain injury.	Liu Y, etal., Neuroreport. 2013 Apr 17;24(6):281-6. doi: 10.1097/WNR.0b013e32835f2810.
102.	Induction of heat shock proteins in the adult rat cerebral cortex following pilocarpine-induced status epilepticus.	Lively S and Brown IR, Brain Res. 2010 Oct 21.
103.	Effect of hypertonic saline resuscitation on heme oxygenase-1 mRNA expression and apoptosis of the intestinal mucosa in a rat model of hemorrhagic shock.	Lu YQ, etal., Chin Med J (Engl). 2010 Jun;123(11):1453-8.
104.	The heme oxygenase system and cellular defense mechanisms. Do HO-1 and HO-2 have different functions?	Maines MD and Panahian N, Adv Exp Med Biol 2001;502:249-72.
105.	Ischemic preconditioning of small bowel mitigates the late phase of reperfusion injury: heme oxygenase mediates cytoprotection.	Mallick IH, etal., Am J Surg. 2010 Feb;199(2):223-31. doi: 10.1016/j.amjsurg.2009.01.011. Epub 2009 Apr 11.
106.	Comparison of Human and Experimental Pulmonary Veno-Occlusive Disease.	Manaud G, etal., Am J Respir Cell Mol Biol. 2020 Jul;63(1):118-131. doi: 10.1165/rcmb.2019-0015OC.
107.	Heme oxygenase-1 and the ischemia-reperfusion injury in the rat heart.	Masini E, etal., Exp Biol Med (Maywood). 2003 May;228(5):546-9.
108.	[Impact of stress response genes induced by L-glutamine on warm ischemia and reperfusion injury in the rat small intestine]	Masuko Y Hokkaido Igaku Zasshi 2002 Mar;77(2):169-83.
109.	Human heme oxygenase-2: characterization and expression of a full-length cDNA and evidence suggesting that the two HO-2 transcripts may differ by choice of polyadenylation signal.	McCoubrey WK, etal., Arch Biochem Biophys. 1992 May 15;295(1):13-20. doi: 10.1016/0003-9861(92)90481-b.
110.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
111.	Expression of heme oxygenase-1 in the peripheral blood mononuclear cells from asthmatic patients.	Mo B, etal., J Huazhong Univ Sci Technolog Med Sci. 2005;25(4):385-8.
112.	A phosphodiesterase III inhibitor protects rat liver from sinusoidal obstruction syndrome through heme oxygenase-1 induction.	Narita M, etal., Ann Surg. 2009 May;249(5):806-13.
113.	Oxidative stress and induction of heme oxygenase-1 in the kidney in sickle cell disease.	Nath KA, etal., Am J Pathol. 2001 Mar;158(3):893-903.
114.	Heme protein-induced chronic renal inflammation: suppressive effect of induced heme oxygenase-1.	Nath KA, etal., Kidney Int. 2001 Jan;59(1):106-17.
115.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
116.	Hemin therapy suppresses inflammation and retroperitoneal adipocyte hypertrophy to improve glucose metabolism in obese rats co-morbid with insulin-resistant type-2 diabetes.	Ndisang JF and Jadhav A, Diabetes Obes Metab. 2013 Nov;15(11):1029-39. doi: 10.1111/dom.12130. Epub 2013 Jun 30.
117.	Selective regulation of blood pressure by heme oxygenase-1 in hypertension.	Ndisang JF, etal., Hypertension. 2002 Sep;40(3):315-21.
118.	Bilirubin is highly effective in preventing in vivo delta-aminolevulinic acid-induced oxidative cell damage.	Noriega GO, etal., Biochim Biophys Acta 2003 Jul 14;1638(2):173-8.
119.	Effects of 1alpha,25 dihydroxyvitamin D3 on the expression of HO-1 and GFAP in glial cells of the photothrombotically lesioned cerebral cortex.	Oermann E, etal., J Chem Neuroanat. 2004 Dec;28(4):225-38.
120.	Protein therapy using heme-oxygenase-1 fused to a polyarginine transduction domain attenuates cerebral vasospasm after experimental subarachnoid hemorrhage.	Ogawa T, etal., J Cereb Blood Flow Metab. 2011 Nov;31(11):2231-42. doi: 10.1038/jcbfm.2011.87. Epub 2011 Jun 8.
121.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
122.	A promoter variant of the heme oxygenase-1 gene may reduce the incidence of ischemic heart disease in Japanese.	Ono K, etal., Atherosclerosis. 2004 Apr;173(2):315-9.
123.	Association of a promoter variant of the haeme oxygenase-1 gene with hypertension in women.	Ono K, etal., J Hypertens. 2003 Aug;21(8):1497-503.
124.	Leydig cell-derived heme oxygenase-1 regulates apoptosis of premeiotic germ cells in response to stress.	Ozawa N, etal., J Clin Invest 2002 Feb;109(4):457-67.
125.	Protective effect of heme oxygenase-1 on lung injury induced by erythrocyte instillation in rats.	Pang QF, etal., Chin Med J (Engl). 2008 Sep 5;121(17):1688-92.
126.	Evaluation of oxidative status and depression-like responses in Brown Norway rats with acute myeloid leukemia.	Papiez MA, etal., Prog Neuropsychopharmacol Biol Psychiatry. 2009 Jun 15;33(4):596-604. doi: 10.1016/j.pnpbp.2009.02.015. Epub 2009 Mar 3.
127.	The microglial alpha7-acetylcholine nicotinic receptor is a key element in promoting neuroprotection by inducing heme oxygenase-1 via nuclear factor erythroid-2-related factor 2.	Parada E, etal., Antioxid Redox Signal. 2013 Oct 10;19(11):1135-48. doi: 10.1089/ars.2012.4671. Epub 2013 Feb 25.
128.	Ischemia/reperfusion Lung Injury Increases Serum Ferritin and Heme Oxygenase-1 in Rats.	Park YY Korean J Physiol Pharmacol. 2009 Jun;13(3):181-7. Epub 2009 Jun 30.
129.	Induction of heme oxygenase-1 expression inhibits platelet-dependent thrombosis.	Peng L, etal., Antioxid Redox Signal. 2004 Aug;6(4):729-35.
130.	Heme Oxygenase-1 Mediates the Protective Effects of Ischemic Preconditioning on Mitigating Lung Injury Induced by Lower Limb Ischemia-Reperfusion in Rats.	Peng TC, etal., J Surg Res. 2010 Jun 30.
131.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
132.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
133.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
134.	Resistance to nitric oxide-induced necrosis in heme oxygenase-1 overexpressing pulmonary epithelial cells associated with decreased lipid peroxidation.	Reiter TA, etal., J Biol Chem. 2006 Dec 1;281(48):36603-12. Epub 2006 Oct 4.
135.	Development of inhibitory antibodies to therapeutic factor VIII in severe hemophilia A is associated with microsatellite polymorphisms in the HMOX1 promoter.	Repesse Y, etal., Haematologica. 2013 Oct;98(10):1650-5. doi: 10.3324/haematol.2013.084665. Epub 2013 May 28.
136.	GOA pipeline	RGD automated data pipeline
137.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
138.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
139.	Chronic tempol treatment attenuates the renal hemodynamic effects induced by a heme oxygenase inhibitor in streptozotocin diabetic rats.	Rodriguez F, etal., Am J Physiol Regul Integr Comp Physiol. 2011 Nov;301(5):R1540-8. doi: 10.1152/ajpregu.00847.2010. Epub 2011 Aug 17.
140.	Protein kinase Akt/PKB phosphorylates heme oxygenase-1 in vitro and in vivo.	Salinas M, etal., FEBS Lett. 2004 Dec 3;578(1-2):90-4.
141.	Heme oxygenase-1, a potential biomarker of chronic silicosis, attenuates silica-induced lung injury.	Sato T, etal., Am J Respir Crit Care Med. 2006 Oct 15;174(8):906-14. Epub 2006 Jul 20.
142.	Heme oxygenase-1 gene promoter polymorphism is associated with abdominal aortic aneurysm.	Schillinger M, etal., Thromb Res. 2002 Apr 15;106(2):131-6.
143.	Expression of heme oxygenase-1 in the senescent and Alzheimer-diseased brain.	Schipper HM, etal., Ann Neurol 1995 Jun;37(6):758-68.
144.	Time course of Keap1-Nrf2 pathway expression after experimental intracerebral haemorrhage: correlation with brain oedema and neurological deficit.	Shang H, etal., Free Radic Res. 2013 May;47(5):368-75. doi: 10.3109/10715762.2013.778403. Epub 2013 Mar 21.
145.	Heme oxygenase-1 microsatellite polymorphism and haplotypes are associated with the development of acute respiratory distress syndrome.	Sheu CC, etal., Intensive Care Med. 2009 Aug;35(8):1343-51. Epub 2009 Jun 13.
146.	Cloning and expression of cDNA for rat heme oxygenase.	Shibahara S, etal., Proc Natl Acad Sci U S A. 1985 Dec;82(23):7865-9.
147.	Synergistic induction of heme oxygenase-1 by nicaraven after subarachnoid hemorrhage to prevent delayed cerebral vasospasm.	Shimada Y, etal., Eur J Pharmacol. 2009 Oct 12;620(1-3):16-20. Epub 2009 Aug 15.
148.	Increased expression of Leydig cell haem oxygenase-1 preserves spermatogenesis in varicocele.	Shiraishi K and Naito K, Hum Reprod. 2005 Sep;20(9):2608-13. Epub 2005 May 5.
149.	Hypoxic preconditioning with cobalt ameliorates hypobaric hypoxia induced pulmonary edema in rat.	Shukla D, etal., Eur J Pharmacol. 2011 Apr 10;656(1-3):101-9. doi: 10.1016/j.ejphar.2011.01.038. Epub 2011 Feb 4.
150.	VEGF-induced heme oxygenase-1 confers cytoprotection from lethal hyperoxia in vivo.	Siner JM, etal., FASEB J. 2007 May;21(7):1422-32. Epub 2007 Jan 30.
151.	Inhibition of the NADPH oxidase regulates heme oxygenase 1 expression in chronic myeloid leukemia.	Singh MM, etal., Cancer. 2012 Jul 1;118(13):3433-45. doi: 10.1002/cncr.26621. Epub 2011 Dec 2.
152.	Induction of pro- and anti-inflammatory molecules in a mouse model of pneumococcal pneumonia after influenza.	Smith MW, etal., Comp Med. 2007 Feb;57(1):82-9.
153.	Crystal structure of rat apo-heme oxygenase-1 (HO-1): mechanism of heme binding in HO-1 inferred from structural comparison of the apo and heme complex forms.	Sugishima M, etal., Biochemistry 2002 Jun 11;41(23):7293-300.
154.	Zinc protoporphyrin aggravates cerebral ischemic injury following experimental subarachnoid hemorrhage.	Sun BL, etal., Clin Hemorheol Microcirc. 2006;34(1-2):241-6.
155.	Retinal protection from acute glaucoma-induced ischemia-reperfusion injury through pharmacologic induction of heme oxygenase-1.	Sun MH, etal., Invest Ophthalmol Vis Sci. 2010 Sep;51(9):4798-808. Epub 2010 Mar 31.
156.	Intracranial heme metabolism and cerebral vasospasm after aneurysmal subarachnoid hemorrhage.	Suzuki H, etal., Stroke. 2003 Dec;34(12):2796-800. Epub 2003 Dec 1.
157.	Facilitated angiogenesis induced by heme oxygenase-1 gene transfer in a rat model of hindlimb ischemia.	Suzuki M, etal., Biochem Biophys Res Commun. 2003 Feb 28;302(1):138-43.
158.	Mechanism of salutary effects of estradiol on organ function after trauma-hemorrhage: upregulation of heme oxygenase.	Szalay L, etal., Am J Physiol Heart Circ Physiol. 2005 Jul;289(1):H92-8. Epub 2005 Feb 25.
159.	Right ventricle of patients undergoing congenital cardiac surgery differentially expresses haem oxygenase-1 and heat shock protein 70 genes.	Takeuchi M, etal., J Int Med Res. 2003 Sep-Oct;31(5):413-7.
160.	Intestinal preconditioning prevents systemic inflammatory response in hemorrhagic shock. Role of HO-1.	Tamion F, etal., Am J Physiol Gastrointest Liver Physiol 2002 Aug;283(2):G408-14.
161.	Induction of hepatic Bach1 mRNA expression by carbon tetrachloride-induced acute liver injury in rats.	Tanioka N, etal., Biomed Rep. 2014 May;2(3):359-363. Epub 2014 Feb 7.
162.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
163.	Antioxidant effects of diallyl trisulfide on high glucose-induced apoptosis are mediated by the PI3K/Akt-dependent activation of Nrf2 in cardiomyocytes.	Tsai CY, etal., Int J Cardiol. 2013 Sep 30;168(2):1286-97. doi: 10.1016/j.ijcard.2012.12.004. Epub 2013 Feb 27.
164.	Postconditioning with far-infrared irradiation increases heme oxygenase-1 expression and protects against ischemia/reperfusion injury in rat testis.	Tu YP, etal., Life Sci. 2013 Jan 17;92(1):35-41. doi: 10.1016/j.lfs.2012.10.019. Epub 2012 Nov 7.
165.	Role of melatonin and luzindole in rat mammary cancer.	Umit UM, etal., J Invest Surg. 2012 Dec;25(6):345-53. doi: 10.3109/08941939.2012.665570.
166.	Brain death induces renal expression of heme oxygenase-1 and heat shock protein 70.	van Dullemen LF, etal., J Transl Med. 2013 Jan 29;11:22. doi: 10.1186/1479-5876-11-22.
167.	Graft protective effects of heme oxygenase 1 in mouse tracheal transplant-related obliterative bronchiolitis.	Visner GA, etal., Transplantation. 2003 Aug 27;76(4):650-6.
168.	Influence of heme oxygenase-1 expression on immune liver fibrosis induced by cobalt protoporphyrin in rats.	Wang F, etal., World J Gastroenterol. 2009 Jun 28;15(24):3009-14.
169.	[Astragalus polysaccharides improved the cardiac function in Sjogren's syndrome model rats based on keap 1-Nrf2/ARE signaling pathway: a mechanism exploration].	Wang F, etal., Zhongguo Zhong Xi Yi Jie He Za Zhi. 2014 May;34(5):566-74.
170.	Paradoxical protection from atherosclerosis and thrombosis in a mouse model of sickle cell disease.	Wang H, etal., Br J Haematol. 2013 Jul;162(1):120-9. doi: 10.1111/bjh.12342. Epub 2013 Apr 17.
171.	Role of the heme oxygenase/carbon monoxide pathway in the pathogenesis and prevention of hepatic encephalopathy.	Wang QM, etal., Mol Med Rep. 2013 Jul;8(1):67-74. doi: 10.3892/mmr.2013.1472. Epub 2013 May 13.
172.	Targeted suppression of heme oxygenase-1 by small interference RNAs inhibits the production of bilirubin in neonatal rat with hyperbilirubinemia.	Wu J, etal., BMC Mol Biol. 2009 Aug 1;10:77.
173.	[The role of heme oxygenase 1 in hydrogen peroxide induced apoptosis and mitochondrial trans membrane potential change in rat primary type II alveolar epithelium cells].	Wu Y, etal., Zhongguo Wei Zhong Bing Ji Jiu Yi Xue. 2011 Nov;23(11):658-60.
174.	Ischemic postconditioning attenuates lung reperfusion injury and reduces systemic proinflammatory cytokine release via heme oxygenase 1.	Xu B, etal., J Surg Res. 2011 Apr;166(2):e157-64. doi: 10.1016/j.jss.2010.11.902. Epub 2010 Dec 21.
175.	Antioxidant N-acetylcysteine attenuates the reduction of Brg1 protein expression in the myocardium of type 1 diabetic rats.	Xu J, etal., J Diabetes Res. 2013;2013:716219. doi: 10.1155/2013/716219. Epub 2013 Jun 18.
176.	Microsatellite polymorphism in the heme oxygenase-1 gene promoter is associated with susceptibility to emphysema.	Yamada N, etal., Am J Hum Genet. 2000 Jan;66(1):187-95.
177.	Association of susceptibility to the development of pneumonia in the older Japanese population with haem oxygenase-1 gene promoter polymorphism.	Yasuda H, etal., J Med Genet. 2006 Apr;43(4):e17.
178.	Heme oxygenase-1 inhibits cytokine production by activated mast cells.	Yasui Y, etal., Biochem Biophys Res Commun. 2007 Mar 9;354(2):485-90. Epub 2007 Jan 10.
179.	Absence of heme oxygenase-1 exacerbates atherosclerotic lesion formation and vascular remodeling.	Yet SF, etal., FASEB J. 2003 Sep;17(12):1759-61. Epub 2003 Jul 3.
180.	Heme oxygenase-1 upregulation improves lipopolysaccharide-induced acute lung injury involving suppression of macrophage migration inhibitory factor.	Yin H, etal., Mol Immunol. 2010 Sep;47(15):2443-9. Epub 2010 Jul 16.
181.	Prevention by lansoprazole, a proton pump inhibitor, of indomethacin -induced small intestinal ulceration in rats through induction of heme oxygenase-1.	Yoda Y, etal., J Physiol Pharmacol. 2010 Jun;61(3):287-94.
182.	Protective effects of hemin pretreatment combined with ulinastatin on septic shock in rats.	Yu JB and Yao SL, Chin Med J (Engl). 2008 Jan 5;121(1):49-55.
183.	BTZO-15, an ARE-activator, ameliorates DSS- and TNBS-induced colitis in rats.	Yukitake H, etal., PLoS One. 2011;6(8):e23256. doi: 10.1371/journal.pone.0023256. Epub 2011 Aug 10.
184.	Protective role of heme oxygenase-1 against liver damage caused by hepatic ischemia and reperfusion in rats.	Yun N, etal., Antioxid Redox Signal. 2010 Nov 15;13(10):1503-12. doi: 10.1089/ars.2009.2873.
185.	Over-expression of HO-1 on mesenchymal stem cells promotes angiogenesis and improves myocardial function in infarcted myocardium.	Zeng B, etal., J Biomed Sci. 2010 Oct 7;17:80.
186.	Bicyclol upregulates transcription factor Nrf2, HO-1 expression and protects rat brains against focal ischemia.	Zhang J, etal., Brain Res Bull. 2014 Jan;100:38-43. doi: 10.1016/j.brainresbull.2013.11.001. Epub 2013 Nov 16.
187.	Amelioration of radiation-induced skin injury by adenovirus-mediated heme oxygenase-1 (HO-1) overexpression in rats.	Zhang S, etal., Radiat Oncol. 2012 Jan 17;7:4. doi: 10.1186/1748-717X-7-4.
188.	Mitogen-activated protein kinases regulate HO-1 gene transcription after ischemia-reperfusion lung injury.	Zhang X, etal., Am J Physiol Lung Cell Mol Physiol 2002 Oct;283(4):L815-29.
189.	[A study of the role of heme oxygenase-1 expression in ventilator induced lung injury and its mechanism in rats.]	Zhao WJ and Hu WW, Zhongguo Wei Zhong Bing Ji Jiu Yi Xue. 2010 Jul;22(7):410-3.
190.	Protective effect of dioscin against thioacetamide-induced acute liver injury via FXR/AMPK signaling pathway in vivo.	Zheng L, etal., Biomed Pharmacother. 2018 Jan;97:481-488. doi: 10.1016/j.biopha.2017.10.153. Epub 2017 Nov 6.
191.	Heme oxygenase-1 expression in human lungs with cystic fibrosis and cytoprotective effects against Pseudomonas aeruginosa in vitro.	Zhou H, etal., Am J Respir Crit Care Med. 2004 Sep 15;170(6):633-40. Epub 2004 Jun 7.

Additional References at PubMed

PMID:2783112	PMID:3032976	PMID:9884342	PMID:10589693	PMID:10760513	PMID:11786534	PMID:11814429	PMID:11976938	PMID:12036874	PMID:12065678	PMID:12084844	PMID:12099359
PMID:12118938	PMID:12194971	PMID:12208350	PMID:12220541	PMID:12232504	PMID:12235152	PMID:12372789	PMID:12372951	PMID:12420312	PMID:12477932	PMID:12511571	PMID:12637567
PMID:12649161	PMID:12709579	PMID:12709582	PMID:12732603	PMID:12736392	PMID:12751798	PMID:12761501	PMID:12777398	PMID:12794075	PMID:12812915	PMID:12846555	PMID:12874251
PMID:12890663	PMID:12898011	PMID:12918117	PMID:12950464	PMID:14514669	PMID:14572772	PMID:14598260	PMID:14654370	PMID:14693679	PMID:14766238	PMID:14965033	PMID:15050899
PMID:15093717	PMID:15105584	PMID:15118350	PMID:15123630	PMID:15158123	PMID:15162474	PMID:15173392	PMID:15188507	PMID:15217799	PMID:15281086	PMID:15337692	PMID:15345139
PMID:15358225	PMID:15546873	PMID:15591777	PMID:15652698	PMID:15681695	PMID:15686660	PMID:15739117	PMID:15808653	PMID:15814490	PMID:15834314	PMID:15838352	PMID:15870071
PMID:15879300	PMID:15949644	PMID:16140332	PMID:16181105	PMID:16181106	PMID:16181109	PMID:16183037	PMID:16200866	PMID:16213353	PMID:16309569	PMID:16309587	PMID:16309590
PMID:16375990	PMID:16458992	PMID:16464374	PMID:16467537	PMID:16503246	PMID:16510205	PMID:16524721	PMID:16531007	PMID:16556724	PMID:16595661	PMID:16597687	PMID:16601358
PMID:16712795	PMID:16778382	PMID:16901472	PMID:16928691	PMID:16930622	PMID:16940561	PMID:16945925	PMID:16962933	PMID:16968890	PMID:17027882	PMID:17103089	PMID:17124609
PMID:17194725	PMID:17221286	PMID:17320768	PMID:17322421	PMID:17351069	PMID:17373739	PMID:17389265	PMID:17404038	PMID:17406657	PMID:17560935	PMID:17600318	PMID:17603281
PMID:17614955	PMID:17631927	PMID:17667987	PMID:17681938	PMID:17684157	PMID:17721935	PMID:17822843	PMID:17823216	PMID:17849050	PMID:17854277	PMID:17873285	PMID:17879412
PMID:17890422	PMID:17906103	PMID:17914959	PMID:17915953	PMID:17919066	PMID:17976119	PMID:17999922	PMID:18028947	PMID:18057067	PMID:18073186	PMID:18165777	PMID:18171528
PMID:18202225	PMID:18205746	PMID:18206660	PMID:18286277	PMID:18313104	PMID:18331200	PMID:18334666	PMID:18337668	PMID:18355802	PMID:18379124	PMID:18430061	PMID:18434445
PMID:18437084	PMID:18453614	PMID:18456280	PMID:18497709	PMID:18547752	PMID:18576916	PMID:18596041	PMID:18617559	PMID:18632790	PMID:18633193	PMID:18688715	PMID:18776993
PMID:18784349	PMID:18787101	PMID:18795901	PMID:18854316	PMID:18937073	PMID:18992713	PMID:19138674	PMID:19171794	PMID:19214725	PMID:19224170	PMID:19228889	PMID:19244165
PMID:19244544	PMID:19323368	PMID:19333137	PMID:19356108	PMID:19372106	PMID:19372624	PMID:19420134	PMID:19446282	PMID:19486559	PMID:19515387	PMID:19556236	PMID:19570893
PMID:19648213	PMID:19657327	PMID:19682508	PMID:19698832	PMID:19781175	PMID:19875720	PMID:19886854	PMID:19943874	PMID:19969074	PMID:20020468	PMID:20080166	PMID:20092734
PMID:20095327	PMID:20134037	PMID:20154257	PMID:20155807	PMID:20163460	PMID:20203419	PMID:20221786	PMID:20227864	PMID:20303947	PMID:20686796	PMID:20705711	PMID:20942796
PMID:20943075	PMID:20965838	PMID:21030713	PMID:21055838	PMID:21073519	PMID:21115498	PMID:21129280	PMID:21141557	PMID:21158055	PMID:21158117	PMID:21163135	PMID:21174820
PMID:21179206	PMID:21186580	PMID:21186595	PMID:21189565	PMID:21207851	PMID:21239629	PMID:21253390	PMID:21263376	PMID:21295052	PMID:21315007	PMID:21349250	PMID:21384399
PMID:21463155	PMID:21597468	PMID:21670561	PMID:21693311	PMID:21693314	PMID:21721581	PMID:21752327	PMID:21781119	PMID:21788589	PMID:21865547	PMID:21908612	PMID:21911116
PMID:21963524	PMID:22036622	PMID:22088822	PMID:22100509	PMID:22144097	PMID:22159698	PMID:22160840	PMID:22288937	PMID:22381746	PMID:22447044	PMID:22466153	PMID:22503972
PMID:22529699	PMID:22544840	PMID:22585610	PMID:22686283	PMID:22737922	PMID:22781641	PMID:22802257	PMID:22821808	PMID:22879979	PMID:22888011	PMID:22954673	PMID:22989377
PMID:23000891	PMID:23036869	PMID:23043644	PMID:23044235	PMID:23059458	PMID:23073806	PMID:23096566	PMID:23209658	PMID:23307413	PMID:23395172	PMID:23454680	PMID:23486573
PMID:23498787	PMID:23525258	PMID:23533686	PMID:23534481	PMID:23562340	PMID:23564109	PMID:23594402	PMID:23643992	PMID:23661026	PMID:23704825	PMID:23770986	PMID:23788171
PMID:23824679	PMID:23826208	PMID:23918881	PMID:23969109	PMID:23981556	PMID:24013271	PMID:24014672	PMID:24040332	PMID:24144058	PMID:24163720	PMID:24178833	PMID:24260182
PMID:24365205	PMID:24399730	PMID:24415199	PMID:24465817	PMID:24494190	PMID:24553299	PMID:24553817	PMID:24564601	PMID:24651515	PMID:24673378	PMID:24700193	PMID:24746951
PMID:24755082	PMID:24771067	PMID:24810525	PMID:24844779	PMID:24997248	PMID:24998947	PMID:25027760	PMID:25035109	PMID:25036135	PMID:25086213	PMID:25091807	PMID:25148934
PMID:25175370	PMID:25224036	PMID:25234134	PMID:25236576	PMID:25264201	PMID:25268984	PMID:25343247	PMID:25448262	PMID:25452227	PMID:25460740	PMID:25471815	PMID:25496210
PMID:25498996	PMID:25529839	PMID:25571843	PMID:25639505	PMID:25683492	PMID:25714596	PMID:25766533	PMID:25780042	PMID:25780291	PMID:25823828	PMID:25824035	PMID:25904107
PMID:25959017	PMID:26064429	PMID:26212551	PMID:26252059	PMID:26253294	PMID:26286380	PMID:26339453	PMID:26381691	PMID:26391895	PMID:26392811	PMID:26440581	PMID:26492285
PMID:26709780	PMID:26780163	PMID:26798657	PMID:26838179	PMID:26866373	PMID:26925775	PMID:26992040	PMID:27006750	PMID:27021411	PMID:27021659	PMID:27034737	PMID:27138700
PMID:27187458	PMID:27220977	PMID:27280718	PMID:27391839	PMID:27432233	PMID:27442135	PMID:27499091	PMID:27545118	PMID:27590577	PMID:27658547	PMID:27662796	PMID:27666960
PMID:27672274	PMID:27778153	PMID:27830717	PMID:27852058	PMID:27864650	PMID:28025064	PMID:28069109	PMID:28088559	PMID:28195947	PMID:28209258	PMID:28229631	PMID:28290603
PMID:28427999	PMID:28464602	PMID:28497199	PMID:28596681	PMID:28617444	PMID:28635609	PMID:28744340	PMID:28770019	PMID:28776762	PMID:28854440	PMID:28887196	PMID:28901391
PMID:28928429	PMID:29054681	PMID:29074371	PMID:29147465	PMID:29305861	PMID:29362850	PMID:29385400	PMID:29412163	PMID:29635898	PMID:29662895	PMID:29743446	PMID:29749549
PMID:29956785	PMID:29996121	PMID:30013453	PMID:30213210	PMID:30412737	PMID:30578379	PMID:30867050	PMID:30977589	PMID:31046408	PMID:31279900	PMID:31400088	PMID:31416050
PMID:31539545	PMID:31600004	PMID:31729530	PMID:31767276	PMID:32016469	PMID:32036037	PMID:32105681	PMID:32184919	PMID:32420373	PMID:32478470	PMID:32587254	PMID:32605461
PMID:32657424	PMID:32697403	PMID:32795555	PMID:32802873	PMID:32838965	PMID:32844330	PMID:32993187	PMID:33040818	PMID:33290309	PMID:33300078	PMID:33343809	PMID:33382068
PMID:33713981	PMID:33811899	PMID:33962830	PMID:34071287	PMID:34194603	PMID:34287609	PMID:34310894	PMID:34669875	PMID:34914307	PMID:34984919	PMID:35163308	PMID:35720183
PMID:36227671	PMID:36764591	PMID:37030526	PMID:37169128	PMID:37169561	PMID:37257587	PMID:37678424	PMID:37818693	PMID:37919062	PMID:38087008	PMID:38360463	PMID:38532724
PMID:38573338	PMID:38583746	PMID:39075530	PMID:39293832	PMID:39444099

Genomics

Comparative Map Data

Hmox1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	19	13,452,365 - 13,479,823 (+)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	19	13,472,884 - 13,479,818 (+)	Ensembl				GRCr8
mRatBN7.2	19	13,466,287 - 13,474,082 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	13,467,244 - 13,474,079 (+)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	19	13,440,832 - 13,447,675 (+)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	19	14,206,098 - 14,212,941 (+)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	19	13,487,026 - 13,493,858 (+)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	19	14,508,634 - 14,515,455 (+)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	14,508,616 - 14,515,456 (+)	Ensembl			rn6	Rnor6.0
Rnor_5.0	19	25,622,556 - 25,629,377 (+)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	19	13,963,139 - 13,969,960 (+)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	19	13,334,259 - 13,341,080 (+)	NCBI		Celera
RGSC_v3.1	19	13,967,964 - 13,974,784 (+)	NCBI
Cytogenetic Map	19	p11	NCBI

HMOX1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	35,381,096 - 35,394,207 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	35,380,361 - 35,394,214 (+)	Ensembl			hg38	GRCh38
GRCh37	22	35,777,089 - 35,790,200 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	34,107,087 - 34,120,194 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Build 34	22	34,101,640 - 34,114,748	NCBI
Celera	22	19,579,740 - 19,592,881 (+)	NCBI		Celera
Cytogenetic Map	22	q12.3	NCBI
HuRef	22	18,737,577 - 18,750,716 (+)	NCBI		HuRef
CHM1_1	22	35,735,791 - 35,748,937 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	22	35,839,114 - 35,852,226 (+)	NCBI		T2T-CHM13v2.0

Hmox1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	75,820,246 - 75,827,221 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	75,820,249 - 75,827,217 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	8	75,093,618 - 75,100,593 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	75,093,621 - 75,100,589 (+)	Ensembl			mm10	GRCm38
MGSCv37	8	77,617,517 - 77,624,492 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	8	77,989,694 - 77,996,657 (+)	NCBI		MGSCv36	mm8
Celera	8	79,400,848 - 79,407,824 (+)	NCBI		Celera
Cytogenetic Map	8	C1	NCBI
cM Map	8	35.59	NCBI

Hmox1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955405	43,124,510 - 43,130,979 (+)	Ensembl
ChiLan1.0	NW_004955405	43,124,447 - 43,128,873 (+)	NCBI	ChiLan1.0	ChiLan1.0

HMOX1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	23	45,322,157 - 45,335,267 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	22	48,018,985 - 48,034,597 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	16,388,368 - 16,401,289 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	34,230,825 - 34,244,063 (+)	NCBI	PanPan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	22	34,230,825 - 34,244,063 (+)	Ensembl			panPan2	panpan1.1

HMOX1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	10	28,744,404 - 28,751,544 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	10	28,743,795 - 28,751,773 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	10	28,683,213 - 28,689,972 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	10	29,531,402 - 29,538,230 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	10	29,530,793 - 29,539,227 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	10	29,255,139 - 29,261,959 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	10	29,565,774 - 29,572,612 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	10	29,745,379 - 29,752,300 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Hmox1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404945	12,031,937 - 12,038,780 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936492	5,042,330 - 5,049,311 (-)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936492	5,042,353 - 5,049,216 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HMOX1
(Sus scrofa - pig)

No map positions available.

HMOX1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	18,144,466 - 18,157,944 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	19	18,144,545 - 18,157,971 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666045	107,791,541 - 107,805,610 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hmox1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624750	342,146 - 345,887 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624750	341,699 - 346,005 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Hmox1
316 total Variants

miRNA Target Status (No longer updated)

Confirmed Target Of

miRNA Gene	Mature miRNA	Method Name	Result Type	Data Type	Support Type	PMID
Mirlet7d	rno-let-7d-5p	Mirtarbase	external_info	Microarray	Functional MTI (Weak)	18258830

Predicted Target Of

	Summary Value
Count of predictions:	543
Count of miRNA genes:	263
Interacting mature miRNAs:	323
Transcripts:	ENSRNOT00000019192
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1549847	Bss8	Bone structure and strength QTL 8	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	19	1	31969901	Rat
8552935	Pigfal10	Plasma insulin-like growth factor 1 level QTL 10	5.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	19	7997750	52997750	Rat
9590298	Uminl5	Urine mineral level QTL 5	3.59	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	19	7997750	52997750	Rat
631840	Niddm38	Non-insulin dependent diabetes mellitus QTL 38	3.86		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	19	10329076	74246245	Rat
1358200	Insglur2	Insulin/glucose ratio QTL 2	4.1		blood glucose amount (VT:0000188)	serum glucose level (CMO:0000543)	19	5748064	50748064	Rat
10054132	Srcrt9	Stress Responsive Cort QTL 9	2.87	0.0017	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	27361636	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	36289	74246245	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10833618	74246245	Rat
7411590	Foco7	Food consumption QTL 7	6.8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	19	1	24694445	Rat
9590090	Insglur8	Insulin/glucose ratio QTL 8	10.81	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	19	7997750	52997750	Rat
9590250	Scort11	Serum corticosterone level QTL 11	23.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	7997750	52997750	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2194317	74246245	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2194317	74246245	Rat

Markers in Region

D19Arb1

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	13,467,860 - 13,468,069 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	14,509,237 - 14,509,445	NCBI	Rnor6.0
Rnor_5.0	19	25,623,159 - 25,623,367	UniSTS	Rnor5.0
RGSC_v3.4	19	13,963,741 - 13,963,950	RGD	RGSC3.4
RGSC_v3.4	19	13,963,742 - 13,963,950	UniSTS	RGSC3.4
Celera	19	13,334,862 - 13,335,070	UniSTS
RGSC_v3.1	19	13,968,567 - 13,968,776	RGD
RH 3.4 Map	19	158.7	UniSTS
RH 3.4 Map	19	158.7	RGD
FHH x ACI Map	19	14.6199	UniSTS
FHH x ACI Map	19	14.6199	RGD
Cytogenetic Map	19	p11	UniSTS

D19Mit15

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	19	13,473,661 - 13,473,823 (+)	Marker Load Pipeline
mRatBN7.2	19	13,467,917 - 13,468,079 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	14,509,294 - 14,509,455	NCBI	Rnor6.0
Rnor_5.0	19	25,623,216 - 25,623,377	UniSTS	Rnor5.0
RGSC_v3.4	19	13,963,798 - 13,963,960	RGD	RGSC3.4
RGSC_v3.4	19	13,963,799 - 13,963,960	UniSTS	RGSC3.4
Celera	19	13,334,919 - 13,335,080	UniSTS
RGSC_v3.1	19	13,968,624 - 13,968,786	RGD
RH 3.4 Map	19	132.88	UniSTS
RH 3.4 Map	19	132.88	RGD
RH 2.0 Map	19	142.4	RGD
Cytogenetic Map	19	p11	UniSTS

RH128180

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	13,473,638 - 13,473,849 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	14,515,015 - 14,515,225	NCBI	Rnor6.0
Rnor_5.0	19	25,628,937 - 25,629,147	UniSTS	Rnor5.0
RGSC_v3.4	19	13,969,520 - 13,969,730	UniSTS	RGSC3.4
Celera	19	13,340,640 - 13,340,850	UniSTS
Cytogenetic Map	19	p11	UniSTS

UniSTS:472912

Rat Assembly	Chr	Position (strand)	Source	JBrowse
GRCr8	19	13,475,137 - 13,476,033 (+)	Marker Load Pipeline
mRatBN7.2	19	13,469,393 - 13,470,289 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	14,510,770 - 14,511,665	NCBI	Rnor6.0
Rnor_5.0	19	25,624,692 - 25,625,587	UniSTS	Rnor5.0
RGSC_v3.4	19	13,965,275 - 13,966,170	UniSTS	RGSC3.4
Celera	19	13,336,395 - 13,337,290	UniSTS
Cytogenetic Map	19	p11	UniSTS

Related Rat Strains

The following Strains have been annotated to Hmox1

SS/Jr

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	163	91	90	59	92	59	6	356	192	11	142	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012580	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097470	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277775	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277776	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277777	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277778	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277779	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277780	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277781	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063277782	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC091164	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ228696	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J02722	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000019	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000019192 ⟹ ENSRNOP00000019192

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	19	13,472,884 - 13,479,818 (+)	Ensembl
mRatBN7.2 Ensembl	19	13,467,244 - 13,474,079 (+)	Ensembl
Rnor_6.0 Ensembl	19	14,508,616 - 14,515,456 (+)	Ensembl

RefSeq Acc Id:

NM_012580 ⟹ NP_036712

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	13,473,002 - 13,479,823 (+)	NCBI
mRatBN7.2	19	13,467,258 - 13,474,079 (+)	NCBI
Rnor_6.0	19	14,508,634 - 14,515,455 (+)	NCBI
Rnor_5.0	19	25,622,556 - 25,629,377 (+)	NCBI
RGSC_v3.4	19	13,963,139 - 13,969,960 (+)	RGD
Celera	19	13,334,259 - 13,341,080 (+)	RGD

Sequence:

show sequence

CGCCTCCAGAGTTTCCGCCTCCAACCAGCGAGTGGAGCCTGCCGGAGCAGAGCCATCTCGAGCG
GAGCCCGGAGCCTGAAGCGAGCGGAGCCAGCCTGAACTAGCCCAGTCCCGCGATGGAGCGCCCA
CAGCTCGACAGCATGTCCCAGGATTTGTCCGAGGCCTTGAAGGAGGCCACCAAGGAGGTGCACA
TCCGTGCAGAGAATTCTGAGTTCATGAGGAACTTTCAGAAGGGTCAGGTGTCCAGGGAAGGCTT
TAAGCTGGTGATGGCCTCCTTGTACCATATCTATACGGCCCTGGAAGAGGAGATAGAGCGAAAC
AAGCAGAACCCAGTCTATGCCCCACTCTACTTCCCTGAGGAGCTGCACCGAAGGGCTGCCCTAG
AGCAGGACATGGCCTTCTGGTATGGGCCCCACTGGCAGGAGGCCATCCCTTACACACCAGCCAC
ACAGCACTACGTAAAGCGTCTCCACGAGGTGGGAGGTACTCATCCTGAGCTGCTGGTGGCCCAC
GCATATACCCGCTACCTGGGTGACCTCTCAGGGGGTCAGGTCCTGAAGAAGATTGCGCAGAAGG
CCATGGCCTTGCCAAGCTCTGGGGAAGGCCTGGCTTTTTTCACCTTCCCGAGCATCGACAACCC
CACCAAGTTCAAACAGCTCTATCGTGCTCGCATGAACACTCTGGAGATGACCCCCGAGGTCAAG
CACAGGGTGACAGAAGAGGCTAAGACCGCCTTCCTGCTCAACATTGAGCTGTTTGAGGAGCTGC
AGGCACTGCTGACAGAGGAACACAAAGACCAGAGTCCCTCACAGACAGAGTTTCTTCGCCAGAG
GCCTGCTAGCCTGGTTCAAGATACTACCTCTGCAGAGACGCCCCGAGGAAAATCCCAGATCAGC
ACTAGTTCATCCCAGACACCGCTCCTGCGATGGGTCCTCACACTCAGTTTCCTGTTGGCGACCG
TGGCAGTGGGAATTTATGCCATGTAAATGCAGTGTTGGCCCCCAGAGGCTGTGAACTCTGTCTC
ATGTAGCCTTCTCTCTGCAGGGGAGAATCTTGCCTGGCTCTCTTTTCTTGGGCCTCTAAGAAAG
CTTTTGGGGTTCCTCGCCCCCTTCCTGTGTCTTCCTTTGTCTCTCTGGAATGGAAGGAGATGCC
TGGCACATTTCCCTCACCAAAAGCACAGCCAGGGGCCTGAACTTGGAAACCAGCAGCCCCAAAT
CCTGCAACAGAGCCCCAGAACTGTGGTCGGTAGAGGCGGCTGTTCTGAGCCCAGTGCCCTTGGT
AGTCGGCGTCCATGTTGACTGACCATGACTGCTTTCCCCCAGCGTCATGGCCACTTTGATATCA
GTGTGCAGAGATTTTCTGTCTTGTGTTTCTGTCTTGTTTTTGTTATTTCCCCAGTTCTACCAGT
GTAATGGTATTTTTTGTTGTATCGATTGTTTTTTTATTCTAACCAAGTAGGGCTGTCTTTTGAG
GGGTGGGTGGTATTTAATAATTGTAACCTTGGTCTCTAACTTCTGTGTGAAATAATAAATGGCA
TTATCTAATAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

XM_039097470 ⟹ XP_038953398

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	13,462,343 - 13,479,823 (+)	NCBI
mRatBN7.2	19	13,466,310 - 13,474,082 (+)	NCBI

RefSeq Acc Id:

XM_063277775 ⟹ XP_063133845

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	13,462,343 - 13,479,823 (+)	NCBI

RefSeq Acc Id:

XM_063277776 ⟹ XP_063133846

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	13,462,343 - 13,479,823 (+)	NCBI

RefSeq Acc Id:

XM_063277777 ⟹ XP_063133847

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	13,462,343 - 13,479,823 (+)	NCBI

RefSeq Acc Id:

XM_063277778 ⟹ XP_063133848

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	13,457,721 - 13,479,823 (+)	NCBI

RefSeq Acc Id:

XM_063277779 ⟹ XP_063133849

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	13,457,713 - 13,479,823 (+)	NCBI

RefSeq Acc Id:

XM_063277780 ⟹ XP_063133850

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	13,461,843 - 13,479,823 (+)	NCBI

RefSeq Acc Id:

XM_063277781 ⟹ XP_063133851

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	13,457,711 - 13,479,823 (+)	NCBI

RefSeq Acc Id:

XM_063277782 ⟹ XP_063133852

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	19	13,452,365 - 13,479,823 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_036712	(Get FASTA)	NCBI Sequence Viewer
	XP_038953398	(Get FASTA)	NCBI Sequence Viewer
	XP_063133845	(Get FASTA)	NCBI Sequence Viewer
	XP_063133846	(Get FASTA)	NCBI Sequence Viewer
	XP_063133847	(Get FASTA)	NCBI Sequence Viewer
	XP_063133848	(Get FASTA)	NCBI Sequence Viewer
	XP_063133849	(Get FASTA)	NCBI Sequence Viewer
	XP_063133850	(Get FASTA)	NCBI Sequence Viewer
	XP_063133851	(Get FASTA)	NCBI Sequence Viewer
	XP_063133852	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41346	(Get FASTA)	NCBI Sequence Viewer
	AAH91164	(Get FASTA)	NCBI Sequence Viewer
	EDL87376	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000019192
GenBank Protein	P06762	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_036712 ⟸ NM_012580

- UniProtKB:

Q5BK87 (UniProtKB/Swiss-Prot), P06762 (UniProtKB/Swiss-Prot), A6JY98 (UniProtKB/TrEMBL), A0A8L2UJE9 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MERPQLDSMSQDLSEALKEATKEVHIRAENSEFMRNFQKGQVSREGFKLVMASLYHIYTALEEE
IERNKQNPVYAPLYFPEELHRRAALEQDMAFWYGPHWQEAIPYTPATQHYVKRLHEVGGTHPEL
LVAHAYTRYLGDLSGGQVLKKIAQKAMALPSSGEGLAFFTFPSIDNPTKFKQLYRARMNTLEMT
PEVKHRVTEEAKTAFLLNIELFEELQALLTEEHKDQSPSQTEFLRQRPASLVQDTTSAETPRGK
SQISTSSSQTPLLRWVLTLSFLLATVAVGIYAM

hide sequence

Ensembl Acc Id:

ENSRNOP00000019192 ⟸ ENSRNOT00000019192

RefSeq Acc Id:	XP_038953398 ⟸ XM_039097470
- Peptide Label:	isoform X1
- UniProtKB:	P06762 (UniProtKB/Swiss-Prot), Q5BK87 (UniProtKB/Swiss-Prot), A6JY98 (UniProtKB/TrEMBL), A0A8L2UJE9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063133852 ⟸ XM_063277782
- Peptide Label:	isoform X1
- UniProtKB:	Q5BK87 (UniProtKB/Swiss-Prot), P06762 (UniProtKB/Swiss-Prot), A6JY98 (UniProtKB/TrEMBL), A0A8L2UJE9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063133851 ⟸ XM_063277781
- Peptide Label:	isoform X1
- UniProtKB:	Q5BK87 (UniProtKB/Swiss-Prot), P06762 (UniProtKB/Swiss-Prot), A6JY98 (UniProtKB/TrEMBL), A0A8L2UJE9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063133849 ⟸ XM_063277779
- Peptide Label:	isoform X1
- UniProtKB:	Q5BK87 (UniProtKB/Swiss-Prot), P06762 (UniProtKB/Swiss-Prot), A6JY98 (UniProtKB/TrEMBL), A0A8L2UJE9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063133848 ⟸ XM_063277778
- Peptide Label:	isoform X1
- UniProtKB:	Q5BK87 (UniProtKB/Swiss-Prot), P06762 (UniProtKB/Swiss-Prot), A6JY98 (UniProtKB/TrEMBL), A0A8L2UJE9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063133850 ⟸ XM_063277780
- Peptide Label:	isoform X1
- UniProtKB:	Q5BK87 (UniProtKB/Swiss-Prot), P06762 (UniProtKB/Swiss-Prot), A6JY98 (UniProtKB/TrEMBL), A0A8L2UJE9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063133847 ⟸ XM_063277777
- Peptide Label:	isoform X1
- UniProtKB:	Q5BK87 (UniProtKB/Swiss-Prot), P06762 (UniProtKB/Swiss-Prot), A6JY98 (UniProtKB/TrEMBL), A0A8L2UJE9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063133845 ⟸ XM_063277775
- Peptide Label:	isoform X1
- UniProtKB:	Q5BK87 (UniProtKB/Swiss-Prot), P06762 (UniProtKB/Swiss-Prot), A6JY98 (UniProtKB/TrEMBL), A0A8L2UJE9 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063133846 ⟸ XM_063277776
- Peptide Label:	isoform X1
- UniProtKB:	Q5BK87 (UniProtKB/Swiss-Prot), P06762 (UniProtKB/Swiss-Prot), A6JY98 (UniProtKB/TrEMBL), A0A8L2UJE9 (UniProtKB/TrEMBL)

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P06762-F1-model_v2	AlphaFold	P06762	1-289	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

6849794

Promoter ID:

EP31003

Type:

single initiation site

Name:

RN_HO1

Description:

Heme oxygenase, HMOX1 gene.

SO ACC ID:

SO:0000170

Source:

EPD (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Nuclease protection with homologous sequence ladder; Sequencing of a full-length cDNA; Nuclease protection; RNA Pol II in vitro system; low-precision; data

Regulation:

spleen ; (induced by or strongly expressed in) heme, (induced by or strongly expressed in) heavy metals

Position:

Rat Assembly	Chr	Position (strand)	Source
RGSC_v3.4	19	13,963,127 - 13,963,187	EPD

RGD ID:

13700960

Promoter ID:

EPDNEW_R11484

Type:

single initiation site

Name:

Hmox1_1

Description:

heme oxygenase 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	19	14,508,622 - 14,508,682	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2806	AgrOrtholog
BioCyc Gene	G2FUF-6420	BioCyc
BioCyc Pathway	PWY-5874 [heme degradation I]	BioCyc
BioCyc Pathway Image	PWY-5874	BioCyc
Ensembl Genes	ENSRNOG00000014117	Ensembl, ENTREZGENE
Ensembl Transcript	ENSRNOT00000019192	ENTREZGENE
Gene3D-CATH	1.20.910.10	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7384448	IMAGE-MGC_LOAD
InterPro	Haem_Oase	UniProtKB/Swiss-Prot
	Haem_Oase-like	UniProtKB/Swiss-Prot
	Haem_Oase-like_multi-hlx	UniProtKB/Swiss-Prot
	Haem_oxygenase_CS	UniProtKB/Swiss-Prot
KEGG Report	rno:24451	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108752	IMAGE-MGC_LOAD
NCBI Gene	24451	ENTREZGENE
PANTHER	HEME OXYGENASE 1	UniProtKB/Swiss-Prot
	PTHR10720	UniProtKB/Swiss-Prot
Pfam	Heme_oxygenase	UniProtKB/Swiss-Prot
PhenoGen	Hmox1	PhenoGen
PIRSF	Haem_Oase	UniProtKB/Swiss-Prot
PRINTS	HAEMOXYGNASE	UniProtKB/Swiss-Prot
PROSITE	HEME_OXYGENASE	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000014117	RatGTEx
Superfamily-SCOP	SSF48613	UniProtKB/Swiss-Prot
TIGR	TC218454
UniProt	A0A8L2UJE9	ENTREZGENE, UniProtKB/TrEMBL
	A6JY98	ENTREZGENE, UniProtKB/TrEMBL
	HMOX1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q5BK87	ENTREZGENE
UniProt Secondary	Q5BK87	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2015-04-08	Hmox1	heme oxygenase 1	Hmox1	heme oxygenase (decycling) 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Hmox1	heme oxygenase (decycling) 1		heme oxygenase 1	Name updated	1299863	APPROVED
2002-06-10	Hmox1	Heme oxygenase			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_disease	may be involved in hepatopulmonary syndrome caused by liver cirrhosis	625603
gene_expression	expressed in the liver and the lung	625603
gene_function	catalyzes the rate limiting stage during the oxidative degradation of heme to biliverdin	625603
gene_function	catalyzes the initial and rate-limiting step in the oxidative degradation of heme to biliverdin	625603
gene_function	catalyzes the initial and rate-limiting step in the oxidative degradation of heme to biliverdin	625731
gene_function	cleaves heme to form biliverdin and carbon monoxide	628519
gene_function	produces biliverdin-IX, divalent iron, and carbon monoxide (CO) through oxidative cleavage of protoheme-IX, the prosthetic group of cytochromes P450	625692
gene_pathway	gene expression after reoxygenation (A-R) is mediated by ERK, JNK, and p38 MAPK pathways	625603
gene_process	may contribute to increased hypertension in salt-sensitive Dahl rats on high-salt diet by increasing carbon monoxide which in turn decreases vascular nitric oxide (NO) formation	625603
gene_process	mediates germ cell apoptosis through carbon monoxide (CO) production in Leydig cells	625692
gene_process	mediates the host defense against oxidant injury	625731
gene_process	provides intestinal preconditioning as a protective effect during hemorrhagic shock	625633
gene_regulation	expression in the lung was increased 5 weeks after common bile duct ligation whereas in the liver after 2 weeks expression stayed elevated till 5 weeks	625603
gene_regulation	expression regulated by nitric oxide	625603
gene_regulation	has three isoforms, Hmox1 (HO-1) is inducible but Hmox2 (HO-2) and Hmox3 (HO-3) are primarily constitutive	625603
gene_regulation	expression is induced by stress	625603
gene_regulation	increased after ischemial, oxidant stress, and intestinal preconditioning; induced by heavy metals, endotoxin, heat shock, cytokines and prostaglandins	625603
gene_regulation	increased vascular expression in Dahl sal-sensitive rats exposed to high-salt diet	625603

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

BioCyc Pathways

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - MGI

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

BioCyc Pathways

Mammalian Phenotype