Galr2 (galanin receptor 2) - Rat Genome Database

Name: Galr2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: Galr2 (galanin receptor 2) Rattus norvegicus

Analyze

Symbol:

Galr2

Name:

galanin receptor 2

RGD ID:

2657

Description:

Enables galanin receptor activity and neuropeptide binding activity. Involved in several processes, including adenylate cyclase-activating G protein-coupled receptor signaling pathway; inositol phosphate metabolic process; and phosphatidylinositol metabolic process. Predicted to be located in cilium. Orthologous to human GALR2 (galanin receptor 2); INTERACTS WITH 2,2',4,4'-Tetrabromodiphenyl ether; 2,3,7,8-tetrachlorodibenzodioxine; 6-propyl-2-thiouracil.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

GAL2-R; galanin receptor type 2; GALR-2; LOC103690156

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	GALR2 (galanin receptor 2)	RGD	RGD
Mus musculus (house mouse):	Galr2 (galanin receptor 2)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Galr2 (galanin receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	GALR2 (galanin receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	GALR2 (galanin receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Galr2 (galanin receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	GALR2 (galanin receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	GALR2 (galanin receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Galr2 (galanin receptor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	GALR3 (galanin receptor 3)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	GALR2 (galanin receptor 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Galr2 (galanin receptor 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	AstA-R1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|SonicParanoid)
Danio rerio (zebrafish):	galr2a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	npr-9	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|SonicParanoid)
Drosophila melanogaster (fruit fly):	AstA-R2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoInspector\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	galr2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

NCBI Annotation Information:

Note: In Rnor_6.0 (AR 105), the loci 29234 and 103690156 are placed twice on chromosome 10. This is likely an assembly error and not a true gene duplication. [28 May 2015]

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	102,012,086 - 102,016,057 (+)	NCBI		GRCr8
mRatBN7.2	10	101,513,689 - 101,517,176 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	101,514,471 - 101,517,176 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	106,571,364 - 106,573,793 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	106,034,454 - 106,036,883 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	101,435,666 - 101,438,094 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	105,156,793 - 105,159,221 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	105,156,632 - 105,237,611 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	104,900,150 - 104,902,315 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	106,394,006 - 106,396,171 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	106,408,502 - 106,410,685 (+)	NCBI
Celera	10	100,087,566 - 100,089,731 (+)	NCBI		Celera
Cytogenetic Map	10	q32.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

major depressive disorder (ISO)

Severe Congenital Neutropenia 10 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

6-propyl-2-thiouracil (EXP)

acetaldehyde (ISO)

ammonium chloride (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

beta-naphthoflavone (ISO)

bexarotene (EXP)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

butanal (ISO)

capsaicin (EXP)

clotrimazole (EXP)

decabromodiphenyl ether (EXP)

deoxynivalenol (EXP)

dibutyl phthalate (EXP)

Dicyclohexyl phthalate (EXP)

diethylstilbestrol (ISO)

flusilazole (ISO)

formaldehyde (ISO)

furan (EXP)

genistein (EXP,ISO)

gentamycin (EXP)

ketamine (EXP)

lead diacetate (ISO)

Licochalcone B (ISO)

methimazole (EXP)

methoxychlor (EXP)

methylmercury chloride (ISO)

Nonylphenol (EXP)

oxidopamine (EXP)

ozone (ISO)

paracetamol (EXP)

quercetin (ISO)

rac-lactic acid (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

Soman (EXP)

sulfadimethoxine (EXP)

thapsigargin (ISO)

tributylstannane (EXP)

triptonide (ISO)

tunicamycin (ISO)

urethane (ISO)

valproic acid (ISO)

zearalenone (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-activating G protein-coupled receptor signaling pathway (IMP)

adenylate cyclase-modulating G protein-coupled receptor signaling pathway (IBA)

G protein-coupled receptor signaling pathway (IDA)

galanin-activated signaling pathway (ISO)

inositol phosphate metabolic process (IDA)

neuron projection development (ISO)

neuropeptide signaling pathway (IBA)

phosphatidylinositol metabolic process (IDA)

phospholipase C-activating G protein-coupled receptor signaling pathway (ISO)

positive regulation of cytosolic calcium ion concentration (IDA)

positive regulation of transcription by RNA polymerase II (ISO,ISS)

Cellular Component

cilium (ISO)

plasma membrane (IBA,IEA)

Molecular Function

galanin receptor activity (IBA,IDA,IMP,ISO)

neuropeptide binding (IDA,IMP)

peptide hormone binding (ISO,ISS)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Galanin enhances corticosterone secretion from dispersed rat adrenocortical cells through the activation of GAL-R1 and GAL-R2 receptors coupled to the adenylate cyclase-dependent signaling cascade.	Andreis PG, etal., Int J Mol Med. 2007 Jan;19(1):149-55.
2.	Two genes in the rat homologous to human NKG2.	Berg SF, etal., Eur J Immunol 1998 Feb;28(2):444-50
3.	Expression of GalR1 and GalR2 galanin receptor messenger ribonucleic acid in proopiomelanocortin neurons of the rat arcuate nucleus: effect of testosterone.	Bouret S, etal., Endocrinology 2000 May;141(5):1780-94
4.	Cloning, pharmacological characterization and distribution of a novel galanin receptor.	Fathi Z, etal., Brain Res Mol Brain Res 1997 Nov;51(1-2):49-59.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
7.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
8.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
9.	Medical College of Ohio's SSLP Data file transfer	Rapp J, Dene H,Direct Electronic Data transfer Feb.(5)2001 . Medical College of Ohio Department of Physiology and Molecular Medicine.
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Expression cloning of a rat hypothalamic galanin receptor coupled to phosphoinositide turnover.	Smith KE, etal., J Biol Chem 1997 Sep 26;272(39):24612-6.
13.	Differential intracellular signaling of the GalR1 and GalR2 galanin receptor subtypes.	Wang S, etal., Biochemistry. 1998 May 12;37(19):6711-7.
14.	Molecular cloning and pharmacological characterization of a new galanin receptor subtype.	Wang S, etal., Mol Pharmacol 1997 Sep;52(3):337-43.
15.	Visualization of a functionally enhanced GFP-tagged galanin R2 receptor in PC12 cells: constitutive and ligand-induced internalization.	Xia S, etal., Proc Natl Acad Sci U S A. 2004 Oct 19;101(42):15207-12. Epub 2004 Oct 7.

Additional References at PubMed

PMID:9108306	PMID:9473722	PMID:9832121	PMID:12533601	PMID:15885774	PMID:15944003	PMID:15944004	PMID:16248891	PMID:16626647	PMID:17287581	PMID:17993248	PMID:18172432
PMID:18272487	PMID:20974494	PMID:21496293	PMID:21894515	PMID:24517231	PMID:24602615	PMID:26666529	PMID:27349435	PMID:28062253	PMID:28154160	PMID:28378856	PMID:29928003
PMID:33632048

Genomics

Comparative Map Data

Galr2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	102,012,086 - 102,016,057 (+)	NCBI		GRCr8
mRatBN7.2	10	101,513,689 - 101,517,176 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	101,514,471 - 101,517,176 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	106,571,364 - 106,573,793 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	106,034,454 - 106,036,883 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	101,435,666 - 101,438,094 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	105,156,793 - 105,159,221 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	105,156,632 - 105,237,611 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	104,900,150 - 104,902,315 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	10	106,394,006 - 106,396,171 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	10	106,408,502 - 106,410,685 (+)	NCBI
Celera	10	100,087,566 - 100,089,731 (+)	NCBI		Celera
Cytogenetic Map	10	q32.1	NCBI

GALR2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	17	76,071,962 - 76,077,537 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	17	76,074,781 - 76,077,537 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	17	74,070,862 - 74,073,618 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	17	71,582,487 - 71,585,168 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	17	71,582,486 - 71,585,168	NCBI
Celera	17	70,664,718 - 70,667,399 (+)	NCBI		Celera
Cytogenetic Map	17	q25.1	NCBI
HuRef	17	69,499,823 - 69,502,494 (+)	NCBI		HuRef
CHM1_1	17	74,135,817 - 74,138,498 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	17	76,964,823 - 76,974,102 (+)	NCBI		T2T-CHM13v2.0

Galr2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	116,170,520 - 116,174,776 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	116,171,765 - 116,174,764 (+)	Ensembl		GRCm39 Ensembl
GRCm38	11	116,280,106 - 116,283,950 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	116,280,939 - 116,283,938 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	116,142,253 - 116,145,252 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	116,097,029 - 116,100,005 (+)	NCBI		MGSCv36	mm8
Celera	11	128,045,589 - 128,048,587 (+)	NCBI		Celera
Cytogenetic Map	11	E2	NCBI
cM Map	11	81.1	NCBI

Galr2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955506	6,172,366 - 6,176,084 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955506	6,172,366 - 6,178,061 (-)	NCBI	ChiLan1.0	ChiLan1.0

GALR2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	19	92,114,145 - 92,123,133 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	17	96,939,371 - 96,948,006 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	17	70,019,383 - 70,028,689 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	17	75,578,072 - 75,580,806 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	17	75,578,072 - 75,580,806 (+)	Ensembl	panpan1.1		panPan2

GALR2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	9	4,559,710 - 4,562,474 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	9	4,560,067 - 4,562,463 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	9	5,240,420 - 5,242,990 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	9	5,230,227 - 5,232,798 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	9	5,230,403 - 5,232,798 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	9	5,270,157 - 5,272,724 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	9	5,379,443 - 5,382,005 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	9	5,440,143 - 5,442,711 (-)	NCBI		UU_Cfam_GSD_1.0

Galr2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405602	5,172,746 - 5,175,859 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936594	1,236,061 - 1,239,113 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936594	1,236,281 - 1,239,213 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

GALR2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	12	5,359,582 - 5,363,095 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	12	5,360,232 - 5,364,396 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	12	5,262,826 - 5,267,911 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

GALR2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	16	45,599,934 - 45,603,207 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	16	45,600,038 - 45,602,561 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666077	16,346,223 - 16,349,480 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Galr2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624801	5,983,254 - 5,985,596 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624801	5,982,870 - 5,987,756 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Galr2
10 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	195
Count of miRNA genes:	119
Interacting mature miRNAs:	128
Transcripts:	ENSRNOT00000012523, ENSRNOT00000075548
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat
61354	Pia10	Pristane induced arthritis QTL 10		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
631267	Cia20	Collagen induced arthritis QTL 20	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
61325	Aia5	Adjuvant induced arthritis QTL 5		0.01	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	23444813	104060283	Rat
1331791	Cm31	Cardiac mass QTL 31	3.84606		heart mass (VT:0007028)	heart wet weight (CMO:0000069)	10	29299504	107211142	Rat
1576308	Schws1	Schwannoma susceptibility QTL 1		0.0041	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	40035094	102359817	Rat
631269	Cia22	Collagen induced arthritis QTL 22	8.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
631270	Cia23	Collagen induced arthritis QTL 23	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	40035094	104060283	Rat
1298078	Stresp5	Stress response QTL 5	2.99	0.00025	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	42045676	104670812	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	51770177	107211142	Rat
61387	Bp1	Blood pressure QTL 1	5.1		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	10	51770177	107211142	Rat
70171	Cari1	Carrageenan-induced inflammation QTL 1	4.9	0.0005	hypodermis integrity trait (VT:0010550)	inflammatory exudate volume (CMO:0001429)	10	53797385	107211142	Rat
2312662	Slep8	Serum leptin concentration QTL 8		0.05	blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	10	57134272	102134272	Rat
2312668	Scl65	Serum cholesterol level QTL 65		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	10	57134272	102134272	Rat
2312672	Insul15	Insulin level QTL 15		0.01	blood insulin amount (VT:0001560)	serum insulin level (CMO:0000358)	10	57134272	102134272	Rat
1549831	Bss6	Bone structure and strength QTL 6	4		lumbar vertebra strength trait (VT:0010574)	vertebra ultimate force (CMO:0001678)	10	57576521	102576521	Rat
2293698	Bss43	Bone structure and strength QTL 43	5.33	0.0001	lumbar vertebra size trait (VT:0010518)	lumbar vertebra cross-sectional area (CMO:0001689)	10	59209888	104209888	Rat
2313103	Bss80	Bone structure and strength QTL 80	2	0.0001	tibia strength trait (VT:1000284)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	10	62057807	107057807	Rat
2313105	Bss79	Bone structure and strength QTL 79	1.8	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	62057807	107057807	Rat
61449	Ciaa2	CIA Autoantibody QTL 2	7.1		blood autoantibody amount (VT:0003725)	calculated serum anti-type 2 collagen antibody titer (CMO:0001279)	10	63221094	107211142	Rat
2317029	Aia19	Adjuvant induced arthritis QTL 19	2.98		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	10	66978955	107211142	Rat
2317039	Aia6	Adjuvant induced arthritis QTL 6	4.31		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	10	66978955	107211142	Rat
10450498	Bp384	Blood pressure QTL 384		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	67750049	107211142	Rat
1642980	Bp300	Blood pressure QTL 300			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68383129	107211142	Rat
61396	Bp9	Blood pressure QTL 9	4.8	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	68420376	107211142	Rat
2300172	Bmd57	Bone mineral density QTL 57	9.8	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	10	69738412	107211142	Rat
2293646	Bss25	Bone structure and strength QTL 25	10.96	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	10	69738412	107211142	Rat
2293663	Bss33	Bone structure and strength QTL 33	9.34	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	10	69738412	107211142	Rat
6893366	Bw106	Body weight QTL 106	0.3	0.47	body mass (VT:0001259)	body weight (CMO:0000012)	10	70199100	107211142	Rat
70193	Mcs7	Mammary carcinoma susceptibility QTL 7	2.38		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	72224939	107211142	Rat
2298548	Neuinf7	Neuroinflammation QTL 7	3.4		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	10	72224939	107211142	Rat
2292438	Bp311	Blood pressure QTL 311			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	76246085	107211142	Rat
1302404	Cia27	Collagen induced arthritis QTL 27	2.6	0.0045	joint integrity trait (VT:0010548)	experimental arthritis severity measurement (CMO:0001459)	10	76452683	107211142	Rat
4889492	Pancm2	Pancreatic morphology QTL 2	3.2		pancreatic beta cell morphology trait (VT:0005217)	ratio of insulin-positive cell area to total area of splenic region of pancreas (CMO:0001814)	10	76748906	107211142	Rat
2303589	Bw87	Body weight QTL 87	2		body mass (VT:0001259)	body weight (CMO:0000012)	10	81285008	107211142	Rat
2317754	Glom25	Glomerulus QTL 25	3.5		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	10	82685200	107211142	Rat
1600367	Mcs15	Mammary carcinoma susceptibility QTL 15	4.5		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	10	85565469	103884409	Rat
631538	Oia5	Oil induced arthritis QTL 5			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87055121	107211142	Rat
61363	Oia3	Oil induced arthritis QTL 3		0.001	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	87307617	107211142	Rat
634320	Niddm49	Non-insulin dependent diabetes mellitus QTL 49	4.41		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	10	88539139	107211142	Rat
12880395	Cm109	Cardiac mass QTL 109		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	10	90404397	107211142	Rat
12880396	Am13	Aortic mass QTL 13		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	10	90404397	107211142	Rat
12880398	Kidm67	Kidney mass QTL 67		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	10	90404397	107211142	Rat
12880384	Cm107	Cardiac mass QTL 107		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)		90404397	107211142	Rat
12880385	Cm108	Cardiac mass QTL 108		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)		90404397	107211142	Rat
1579915	Bp280	Blood pressure QTL 280		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90404397	107211142	Rat
1300137	Bp186	Blood pressure QTL 186	3.57		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	10	90627439	107057807	Rat
724530	Bp149	Blood pressure QTL 149		0.0001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	90627439	107211142	Rat
61436	Cia5	Collagen induced arthritis QTL 5	4.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	91228102	104060283	Rat
1354641	Bvd2	Brain ventricular dilatation QTL 2	6.36	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	10	93223816	107057807	Rat
10450493	Bp382	Blood pressure QTL 382		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	94759759	107211142	Rat
2292436	Bp310	Blood pressure QTL 310			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	10	94759759	107211142	Rat
1576307	Cia28	Collagen induced arthritis QTL 28			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96120911	104060283	Rat
1576313	Pia25	Pristane induced arthritis QTL 25			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	96120911	104060283	Rat
1578663	Bss18	Bone structure and strength QTL 18	3.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	10	96703043	107057807	Rat
1578672	Bmd16	Bone mineral density QTL 16	6.2		femur mineral mass (VT:0010011)	compact volumetric bone mineral density (CMO:0001730)	10	96703043	107057807	Rat
631539	Oia6	Oil induced arthritis QTL 6			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	97010147	104670812	Rat

Markers in Region

Galr2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	101,514,753 - 101,514,983 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	105,235,266 - 105,235,495	NCBI	Rnor6.0
Rnor_6.0	10	105,156,799 - 105,157,028	NCBI	Rnor6.0
Rnor_5.0	10	104,825,387 - 104,825,616	UniSTS	Rnor5.0
Rnor_5.0	10	104,900,147 - 104,900,376	UniSTS	Rnor5.0
RGSC_v3.4	10	106,394,003 - 106,394,232	UniSTS	RGSC3.4
Celera	10	100,087,563 - 100,087,792	UniSTS
Cytogenetic Map	10	q32.3	UniSTS

RH131561

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	10	101,516,894 - 101,517,074 (+)	MAPPER	mRatBN7.2
Rnor_6.0	10	105,237,407 - 105,237,586	NCBI	Rnor6.0
Rnor_6.0	10	105,158,940 - 105,159,119	NCBI	Rnor6.0
Rnor_5.0	10	104,827,528 - 104,827,707	UniSTS	Rnor5.0
Rnor_5.0	10	104,902,288 - 104,902,467	UniSTS	Rnor5.0
RGSC_v3.4	10	106,396,144 - 106,396,323	UniSTS	RGSC3.4
Celera	10	100,089,704 - 100,089,883	UniSTS
Cytogenetic Map	10	q32.3	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium
Low	3		14		10				30	3	17	9
Below cutoff		25	19	17	9	17	8	11	38	32	19	2	8

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019172	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085710	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085711	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF008548	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF010318	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	KR258739	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U94322	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Y15248	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000012523 ⟹ ENSRNOP00000012523

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	10	105,156,822 - 105,158,947 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000075548 ⟹ ENSRNOP00000067445

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	10	105,235,289 - 105,237,414 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000086288 ⟹ ENSRNOP00000073780

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	101,514,471 - 101,517,176 (+)	Ensembl
Rnor_6.0 Ensembl	10	105,156,632 - 105,237,611 (+)	Ensembl

RefSeq Acc Id:

NM_019172 ⟹ NP_062045

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	102,013,626 - 102,016,054 (+)	NCBI
mRatBN7.2	10	101,514,748 - 101,517,176 (+)	NCBI
Rnor_6.0	10	105,156,793 - 105,159,221 (+)	NCBI
Rnor_5.0	10	104,900,150 - 104,902,315 (+)	NCBI
RGSC_v3.4	10	106,394,006 - 106,396,171 (+)	RGD
Celera	10	100,087,566 - 100,089,731 (+)	RGD

Sequence:

show sequence

GCGGGAGCGGCGTCCACTTTGGTGATACCATGAATGGCTCCGGCAGCCAGGGCGCGGAGAACAC
GAGCCAGGAAGGCGGTAGCGGCGGCTGGCAGCCTGAGGCGGTCCTTGTACCCCTATTTTTCGCG
CTCATCTTCCTCGTGGGCACCGTGGGCAACGCGCTGGTGCTGGCGGTGCTGCTGCGCGGCGGCC
AGGCGGTCAGCACCACCAACCTGTTCATCCTCAACCTGGGCGTGGCCGACCTGTGTTTCATCCT
GTGCTGCGTGCCTTTCCAGGCCACCATCTACACCCTGGACGACTGGGTGTTCGGCTCGCTGCTC
TGCAAGGCTGTTCATTTCCTCATCTTTCTCACTATGCACGCCAGCAGCTTCACGCTGGCCGCCG
TCTCCCTGGACAGGTATCTGGCCATCCGCTACCCGCTGCACTCCCGAGAGTTGCGCACACCTCG
AAACGCGCTGGCCGCCATCGGGCTCATCTGGGGGCTAGCACTGCTCTTCTCCGGGCCCTACCTG
AGCTACTACCGTCAGTCGCAGCTGGCCAACCTGACAGTATGCCACCCAGCATGGAGCGCACCTC
GACGTCGAGCCATGGACCTCTGCACCTTCGTCTTTAGCTACCTGCTGCCAGTGCTAGTCCTCAG
TCTGACCTATGCGCGTACCCTGCGCTACCTCTGGCGCACAGTCGACCCGGTGACTGCAGGCTCA
GGTTCCCAGCGCGCCAAACGCAAGGTGACACGGATGATCATCATCGTGGCGGTGCTTTTCTGCC
TCTGTTGGATGCCCCACCACGCGCTTATCCTCTGCGTGTGGTTTGGTCGCTTCCCGCTCACGCG
TGCCACTTACGCGTTGCGCATCCTTTCACACCTAGTTTCCTATGCCAACTCCTGTGTCAACCCC
ATCGTTTACGCTCTGGTCTCCAAGCATTTCCGTAAAGGTTTCCGCAAAATCTGCGCGGGCCTGC
TGCGCCCTGCCCCGAGGCGAGCTTCGGGCCGAGTGAGCATCCTGGCGCCTGGGAACCATAGTGG
CAGCATGCTGGAACAGGAATCCACAGACCTGACACAGGTGAGCGAGGCAGCCGGGCCCCTTGTC
CCACCACCCGCACTTCCCAACTGCACAGCCTCGAGTAGAACCCTGGATCCGGCTTGTTAAAGGA
CCAAAGGGCATCTAACAGCTTCTAGACAGTGTGGCCCGAGGATCCCTGGGGGTTATGCTTGAAC
GTTACAGGGTTGAGGCTAAAGACTGAGGATTGATTGTAGGGAACCTCCAGTTATTAAACGGTGC
GGATTGCTAGAGGGTGGCATAGTCCTTCAATCCTGGCACCCGAAAAGCAGATGCAGGAGCAGGA
GCAGGAGCAAAGCCAGCCATGGAGTTTGAGGCCTGCTTGAACTACCTGAGATCCAATAATAAAA
CATTTCATATGCTG

hide sequence

RefSeq Acc Id:

XM_039085710 ⟹ XP_038941638

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	102,013,886 - 102,016,057 (+)	NCBI
mRatBN7.2	10	101,515,008 - 101,517,176 (+)	NCBI

RefSeq Acc Id:

XM_039085711 ⟹ XP_038941639

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	102,012,086 - 102,016,057 (+)	NCBI
mRatBN7.2	10	101,513,689 - 101,517,176 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_062045	(Get FASTA)	NCBI Sequence Viewer
	XP_038941638	(Get FASTA)	NCBI Sequence Viewer
	XP_038941639	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB53220	(Get FASTA)	NCBI Sequence Viewer
	AAB62573	(Get FASTA)	NCBI Sequence Viewer
	AAC53358	(Get FASTA)	NCBI Sequence Viewer
	CAA75532	(Get FASTA)	NCBI Sequence Viewer
	EDM06659	(Get FASTA)	NCBI Sequence Viewer
	EDM06660	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000073780
	ENSRNOP00000073780.1
	ENSRNOP00055043589
	ENSRNOP00060039575
	ENSRNOP00065026372
GenBank Protein	O08726	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_062045 ⟸ NM_019172

- UniProtKB:

O08726 (UniProtKB/Swiss-Prot), A6HKV4 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNGSGSQGAENTSQEGGSGGWQPEAVLVPLFFALIFLVGTVGNALVLAVLLRGGQAVSTTNLFI
LNLGVADLCFILCCVPFQATIYTLDDWVFGSLLCKAVHFLIFLTMHASSFTLAAVSLDRYLAIR
YPLHSRELRTPRNALAAIGLIWGLALLFSGPYLSYYRQSQLANLTVCHPAWSAPRRRAMDLCTF
VFSYLLPVLVLSLTYARTLRYLWRTVDPVTAGSGSQRAKRKVTRMIIIVAVLFCLCWMPHHALI
LCVWFGRFPLTRATYALRILSHLVSYANSCVNPIVYALVSKHFRKGFRKICAGLLRPAPRRASG
RVSILAPGNHSGSMLEQESTDLTQVSEAAGPLVPPPALPNCTASSRTLDPAC

hide sequence

RefSeq Acc Id:	XP_038941639 ⟸ XM_039085711
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038941638 ⟸ XM_039085710
- Peptide Label:	isoform X1
- UniProtKB:	A6HKV5 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000073780 ⟸ ENSRNOT00000086288

RefSeq Acc Id:

ENSRNOP00000012523 ⟸ ENSRNOT00000012523

RefSeq Acc Id:

ENSRNOP00000067445 ⟸ ENSRNOT00000075548

Protein Domains

G-protein coupled receptors family 1 profile

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O08726-F1-model_v2	AlphaFold	O08726	1-372	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2657	AgrOrtholog
BioCyc Gene	G2FUF-22615	BioCyc
Ensembl Genes	ENSRNOG00000061733	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00055030390	UniProtKB/Swiss-Prot
	ENSRNOG00060027415	UniProtKB/Swiss-Prot
	ENSRNOG00065019595	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000086288	ENTREZGENE
	ENSRNOT00000086288.2	UniProtKB/Swiss-Prot
	ENSRNOT00055052730	UniProtKB/Swiss-Prot
	ENSRNOT00060047561	UniProtKB/Swiss-Prot
	ENSRNOT00065032999	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	GAL2_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Galanin_rcpt	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:29234	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	29234	ENTREZGENE
PANTHER	G-PROTEIN COUPLED RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GALANIN RECEPTOR TYPE 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	7tm_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Galr2	PhenoGen
PRINTS	GALANIN2R	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GALANINR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	GPCRRHODOPSN	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	G_PROTEIN_RECEP_F1_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000061733	RatGTEx
	ENSRNOG00055030390	RatGTEx
	ENSRNOG00060027415	RatGTEx
	ENSRNOG00065019595	RatGTEx
SMART	7TM_GPCR_Srsx	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A6HKV4	ENTREZGENE, UniProtKB/TrEMBL
	A6HKV5	ENTREZGENE, UniProtKB/TrEMBL
	GALR2_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-03-09	Galr2	galanin receptor 2	LOC103690156	galanin receptor type 2	Data merged from RGD:9251670	737654	PROVISIONAL
2014-08-25	LOC103690156	galanin receptor type 2			Symbol and Name status set to provisional	70820	PROVISIONAL
2002-06-10	Galr2	galanin receptor 2			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in the brain	69841
gene_expression	expressed by POMC (precursor molecule for the opioid peptide beta-endorphin) neurons in the rostral parts of the nucleus	61034
gene_function	receptor for neuropeptide galanin	69841
gene_process	involved in the control of pituitary functions and feeding behavior and in modulating POMC neuron activity	69841
gene_regulation	expression modulated by testosterone	61034

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD