Advanced Search (OLGA)

Gene: Fgf18 (fibroblast growth factor 18) Rattus norvegicus

Analyze

Symbol:

Fgf18

Name:

fibroblast growth factor 18

RGD ID:

2608

Description:

Predicted to enable growth factor activity; type 1 fibroblast growth factor receptor binding activity; and type 2 fibroblast growth factor receptor binding activity. Involved in nervous system development and positive regulation of hepatocyte proliferation. Located in cytoplasm and nucleus. Orthologous to human FGF18 (fibroblast growth factor 18); PARTICIPATES IN fibroblast growth factor signaling pathway; melanoma pathway; mitogen activated protein kinase signaling pathway; INTERACTS WITH all-trans-retinoic acid; alpha-Zearalanol; ammonium chloride.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

FGF-18

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FGF18 (fibroblast growth factor 18)	HGNC	Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, Panther
Mus musculus (house mouse):	Fgf18 (fibroblast growth factor 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Fgf18 (fibroblast growth factor 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FGF18 (fibroblast growth factor 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FGF18 (fibroblast growth factor 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fgf18 (fibroblast growth factor 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FGF18 (fibroblast growth factor 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FGF18 (fibroblast growth factor 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fgf18 (fibroblast growth factor 18)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	FGF18 (fibroblast growth factor 18)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Fgf18 (fibroblast growth factor 18)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fgf18b (fibroblast growth factor 18b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fgf18a (fibroblast growth factor 18a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	egl-17	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	18,210,240 - 18,241,929 (-)	NCBI		GRCr8
mRatBN7.2	10	17,706,011 - 17,737,702 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	17,706,174 - 17,736,818 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	22,455,024 - 22,484,592 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	21,943,626 - 21,973,192 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	17,432,271 - 17,461,845 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	18,047,109 - 18,082,290 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	18,047,109 - 18,063,391 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	17,932,880 - 17,967,318 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	10	17,348,236 - 17,383,370 (-)	NCBI		Celera
Cytogenetic Map	10	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

RGD Manual Disease Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fgf18	Rat	lung adenocarcinoma		ISO	RGD:737083	9068941	mRNA:decreased expression:lung (human)	RGD	PMID:19296538\|REF_RGD_ID:150429981

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fgf18	Rat	Dwarfism		ISO	RGD:737083	8554872	ClinVar Annotator: match by term: Short stature	ClinVar
Fgf18	Rat	hydrocephalus		ISO	RGD:737083	8554872	ClinVar Annotator: match by term: Congenital hydrocephalus	ClinVar	PMID:29983323

Imported Disease Annotations - CTD

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fgf18	Rat	Diaphragmatic Hernia		ISO	RGD:737083	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:17303798
Fgf18	Rat	malignant mesothelioma		ISO	RGD:737083	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:25756049
Fgf18	Rat	osteoarthritis		ISO	RGD:737083	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:30664745
Fgf18	Rat	polycystic ovary syndrome		ISO	RGD:737083	11554173	CTD Direct Evidence: marker/mechanism	CTD	PMID:21411543

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fgf18	Rat	(+)-taxifolin	decreases expression	ISO	RGD:737083	6480464	taxifolin results in decreased expression of FGF18 mRNA	CTD	PMID:17541156
Fgf18	Rat	(-)-epigallocatechin 3-gallate	multiple interactions	ISO	RGD:737083	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of FGF18 mRNA	CTD	PMID:22079256
Fgf18	Rat	1,2-dimethylhydrazine	increases expression	ISO	RGD:737084	6480464	1,2-Dimethylhydrazine results in increased expression of FGF18 mRNA	CTD	PMID:22206623
Fgf18	Rat	17beta-estradiol	affects expression	ISO	RGD:737083	6480464	Estradiol affects the expression of FGF18 mRNA	CTD	PMID:25321415
Fgf18	Rat	17beta-estradiol	increases expression	ISO	RGD:737083	6480464	Estradiol results in increased expression of FGF18 mRNA	CTD	PMID:31614463
Fgf18	Rat	17beta-estradiol	multiple interactions	ISO	RGD:737083	6480464	[Progesterone co-treated with Estradiol] results in decreased expression of FGF18 mRNA	CTD	PMID:17404688
Fgf18	Rat	2,3,7,8-tetrachlorodibenzodioxine	decreases expression	ISO	RGD:737084	6480464	Tetrachlorodibenzodioxin results in decreased expression of FGF18 mRNA	CTD	PMID:19933214
Fgf18	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:737083	6480464	Tetrachlorodibenzodioxin results in increased expression of FGF18 mRNA	CTD	PMID:36370075
Fgf18	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:737083	6480464	Tetrachlorodibenzodioxin affects the expression of FGF18 mRNA	CTD	PMID:30203000
Fgf18	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	increases expression	ISO	RGD:737083	6480464	2,2',4,4',5-brominated diphenyl ether results in increased expression of FGF18 mRNA	CTD	PMID:26705709
Fgf18	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	RGD:737084	6480464	2,2',4,4',5-brominated diphenyl ether affects the expression of FGF18 mRNA	CTD	PMID:38648751
Fgf18	Rat	2-tert-butylhydroquinone	decreases expression	ISO	RGD:737084	6480464	2-tert-butylhydroquinone results in decreased expression of FGF18 mRNA	CTD	PMID:16014739
Fgf18	Rat	3,3',5-triiodo-L-thyronine	multiple interactions	ISO	RGD:737084	6480464	Triiodothyronine promotes the reaction [FGF18 protein results in increased phosphorylation of MAPK1 protein]; Triiodothyronine promotes more ...	CTD	PMID:16150908
Fgf18	Rat	3-methylcholanthrene	multiple interactions	ISO	RGD:737084	6480464	[Methylcholanthrene co-treated with Tetradecanoylphorbol Acetate] results in increased expression of FGF18 mRNA	CTD	PMID:23519560
Fgf18	Rat	3-Nitrobenzanthrone	affects expression	ISO	RGD:737083	6480464	3-nitrobenzanthrone affects the expression of FGF18 mRNA	CTD	PMID:34036453
Fgf18	Rat	actinomycin D	multiple interactions	ISO	RGD:737083	6480464	[Dactinomycin co-treated with nutlin 3] results in increased expression of FGF18 mRNA	CTD	PMID:38460933
Fgf18	Rat	aflatoxin B1	decreases methylation	ISO	RGD:737083	6480464	Aflatoxin B1 results in decreased methylation of FGF18 gene	CTD	PMID:27153756
Fgf18	Rat	aflatoxin B1	increases methylation	ISO	RGD:737083	6480464	Aflatoxin B1 results in increased methylation of FGF18 intron	CTD	PMID:30157460
Fgf18	Rat	Aflatoxin B2 alpha	increases methylation	ISO	RGD:737083	6480464	aflatoxin B2 results in increased methylation of FGF18 intron	CTD	PMID:30157460
Fgf18	Rat	all-trans-retinoic acid	increases expression	ISO	RGD:737083	6480464	Tretinoin results in increased expression of FGF18 mRNA	CTD	PMID:21934132
Fgf18	Rat	all-trans-retinoic acid	increases expression	EXP		6480464	Tretinoin results in increased expression of FGF18 mRNA	CTD	PMID:20488242
Fgf18	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in increased expression of FGF18 mRNA	CTD	PMID:35163327
Fgf18	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of FGF18 mRNA	CTD	PMID:16483693
Fgf18	Rat	aristolochic acid A	increases expression	ISO	RGD:737083	6480464	aristolochic acid I results in increased expression of FGF18 mRNA	CTD	PMID:33212167
Fgf18	Rat	Azoxymethane	multiple interactions	ISO	RGD:737084	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of FGF18 more ...	CTD	PMID:29950665
Fgf18	Rat	benzo[a]pyrene	decreases expression	ISO	RGD:737084	6480464	Benzo(a)pyrene results in decreased expression of FGF18 mRNA	CTD	PMID:21569818
Fgf18	Rat	benzo[a]pyrene	affects methylation	ISO	RGD:737083	6480464	Benzo(a)pyrene affects the methylation of FGF18 intron	CTD	PMID:30157460
Fgf18	Rat	benzo[a]pyrene	increases methylation	ISO	RGD:737083	6480464	Benzo(a)pyrene results in increased methylation of FGF18 promoter	CTD	PMID:27901495
Fgf18	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	RGD:737084	6480464	Diethylhexyl Phthalate results in decreased expression of FGF18 mRNA	CTD	PMID:34319233
Fgf18	Rat	bisphenol A	affects expression	ISO	RGD:737083	6480464	bisphenol A affects the expression of FGF18 mRNA	CTD	PMID:20170705
Fgf18	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of FGF18 mRNA	CTD	PMID:34973380
Fgf18	Rat	bisphenol A	multiple interactions	ISO	RGD:737084	6480464	Fulvestrant inhibits the reaction [bisphenol A results in increased expression of FGF18 mRNA]	CTD	PMID:30892605
Fgf18	Rat	bisphenol A	decreases expression	EXP		6480464	bisphenol A results in decreased expression of FGF18 mRNA	CTD	PMID:25181051
Fgf18	Rat	bisphenol A	increases expression	ISO	RGD:737084	6480464	bisphenol A results in increased expression of FGF18 mRNA	CTD	PMID:27022677\|PMID:30892605\|PMID:32156529
Fgf18	Rat	buta-1,3-diene	decreases expression	ISO	RGD:737084	6480464	1,3-butadiene results in decreased expression of FGF18 mRNA	CTD	PMID:29038090
Fgf18	Rat	butanal	increases expression	ISO	RGD:737083	6480464	butyraldehyde results in increased expression of FGF18 mRNA	CTD	PMID:26079696
Fgf18	Rat	cadmium atom	multiple interactions	ISO	RGD:737083	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of FGF18 more ...	CTD	PMID:35301059
Fgf18	Rat	cadmium dichloride	multiple interactions	ISO	RGD:737083	6480464	[Cadmium Chloride results in increased abundance of Cadmium] which results in decreased expression of FGF18 more ...	CTD	PMID:35301059
Fgf18	Rat	cantharidin	decreases expression	ISO	RGD:737084	6480464	Cantharidin results in decreased expression of FGF18 mRNA	CTD	PMID:36907384
Fgf18	Rat	carbamazepine	affects expression	ISO	RGD:737083	6480464	Carbamazepine affects the expression of FGF18 mRNA	CTD	PMID:25979313
Fgf18	Rat	carbon nanotube	decreases expression	ISO	RGD:737084	6480464	Nanotubes, Carbon analog results in decreased expression of FGF18 mRNA	CTD	PMID:25554681
Fgf18	Rat	carbon nanotube	affects expression	ISO	RGD:737084	6480464	Nanotubes, Carbon affects the expression of FGF18 mRNA	CTD	PMID:25554681
Fgf18	Rat	chloroprene	decreases expression	ISO	RGD:737084	6480464	Chloroprene results in decreased expression of FGF18 mRNA	CTD	PMID:23125180
Fgf18	Rat	chlorpyrifos	affects expression	EXP		6480464	Chlorpyrifos affects the expression of FGF18 mRNA	CTD	PMID:18502319
Fgf18	Rat	chondroitin sulfate	affects binding	ISO	RGD:737084	6480464	[Chondroitin Sulfates binds to Dermatan Sulfate] which binds to FGF18 protein; Chondroitin Sulfates analog binds more ...	CTD	PMID:12221095\|PMID:15385557
Fgf18	Rat	cisplatin	increases expression	ISO	RGD:737083	6480464	Cisplatin results in increased expression of FGF18 mRNA	CTD	PMID:27392435
Fgf18	Rat	copper(II) sulfate	affects expression	ISO	RGD:737083	6480464	Copper Sulfate affects the expression of FGF18 mRNA	CTD	PMID:19549813
Fgf18	Rat	cordycepin	decreases expression	ISO	RGD:737084	6480464	cordycepin results in decreased expression of FGF18 mRNA	CTD	PMID:33172093
Fgf18	Rat	Cuprizon	decreases expression	EXP		6480464	Cuprizone results in decreased expression of FGF18 mRNA	CTD	PMID:26577399
Fgf18	Rat	cyclosporin A	decreases expression	ISO	RGD:737083	6480464	Cyclosporine results in decreased expression of FGF18 mRNA	CTD	PMID:22147139
Fgf18	Rat	cyclosporin A	decreases methylation	ISO	RGD:737083	6480464	Cyclosporine results in decreased methylation of FGF18 promoter	CTD	PMID:27989131
Fgf18	Rat	dermatan sulfate	affects binding	ISO	RGD:737084	6480464	[Chondroitin Sulfates binds to Dermatan Sulfate] which binds to FGF18 protein	CTD	PMID:15385557
Fgf18	Rat	dextran sulfate	multiple interactions	ISO	RGD:737084	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of FGF18 more ...	CTD	PMID:29950665
Fgf18	Rat	diethyl malate	affects expression	ISO	RGD:737084	6480464	diethyl malate affects the expression of FGF18 mRNA	CTD	PMID:24814887
Fgf18	Rat	diethyl malate	multiple interactions	ISO	RGD:737084	6480464	S-ethyl glutathione inhibits the reaction [diethyl malate affects the expression of FGF18 mRNA]	CTD	PMID:24814887
Fgf18	Rat	diquat	increases expression	ISO	RGD:737084	6480464	Diquat results in increased expression of FGF18 mRNA	CTD	PMID:36851058
Fgf18	Rat	diuron	decreases expression	EXP		6480464	Diuron results in decreased expression of FGF18 mRNA	CTD	PMID:25152437
Fgf18	Rat	dorsomorphin	multiple interactions	ISO	RGD:737083	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Fgf18	Rat	doxorubicin	decreases expression	ISO	RGD:737083	6480464	Doxorubicin results in decreased expression of FGF18 mRNA	CTD	PMID:29803840
Fgf18	Rat	entinostat	increases expression	ISO	RGD:737083	6480464	entinostat results in increased expression of FGF18 mRNA	CTD	PMID:26272509
Fgf18	Rat	entinostat	multiple interactions	ISO	RGD:737083	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Fgf18	Rat	epoxiconazole	increases expression	ISO	RGD:737084	6480464	epoxiconazole results in increased expression of FGF18 mRNA	CTD	PMID:35436446
Fgf18	Rat	fluoranthene	decreases expression	ISO	RGD:737084	6480464	fluoranthene results in decreased expression of FGF18 mRNA	CTD	PMID:28329830
Fgf18	Rat	fluoranthene	multiple interactions	ISO	RGD:737084	6480464	[1-methylanthracene co-treated with fluoranthene] results in decreased expression of FGF18 mRNA	CTD	PMID:28329830
Fgf18	Rat	fulvestrant	multiple interactions	ISO	RGD:737084	6480464	Fulvestrant inhibits the reaction [bisphenol A results in increased expression of FGF18 mRNA]	CTD	PMID:30892605
Fgf18	Rat	Glutathione ethyl ester	multiple interactions	ISO	RGD:737084	6480464	S-ethyl glutathione inhibits the reaction [diethyl malate affects the expression of FGF18 mRNA]	CTD	PMID:24814887
Fgf18	Rat	lead diacetate	decreases expression	ISO	RGD:737084	6480464	lead acetate results in decreased expression of FGF18 mRNA	CTD	PMID:22609695
Fgf18	Rat	Licochalcone B	increases expression	ISO	RGD:737083	6480464	licochalcone B results in increased expression of FGF18 mRNA	CTD	PMID:33647349
Fgf18	Rat	lipopolysaccharide	increases expression	ISO	RGD:737083	6480464	Lipopolysaccharides results in increased expression of FGF18 mRNA	CTD	PMID:35811015
Fgf18	Rat	lipopolysaccharide	multiple interactions	ISO	RGD:737083	6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of FGF18 mRNA; [S-(1,2-dichlorovinyl)cysteine more ...	CTD	PMID:35811015
Fgf18	Rat	methylmercury chloride	affects expression	EXP		6480464	methylmercuric chloride affects the expression of FGF18 mRNA	CTD	PMID:20864626
Fgf18	Rat	methylmercury chloride	increases expression	ISO	RGD:737083	6480464	methylmercuric chloride results in increased expression of FGF18 mRNA	CTD	PMID:28001369
Fgf18	Rat	mono(2-ethylhexyl) phthalate	decreases expression	ISO	RGD:737083	6480464	mono-(2-ethylhexyl)phthalate results in decreased expression of FGF18 mRNA	CTD	PMID:36695872
Fgf18	Rat	nickel atom	decreases expression	EXP		6480464	Nickel results in decreased expression of FGF18 mRNA	CTD	PMID:19130878
Fgf18	Rat	nitrofen	decreases expression	EXP		6480464	nitrofen results in decreased expression of FGF18 mRNA; nitrofen results in decreased expression of FGF18 more ...	CTD	PMID:23979401
Fgf18	Rat	Nor-9-carboxy-delta9-THC	multiple interactions	ISO	RGD:737083	6480464	[Cannabinoids results in increased abundance of 11-nor-delta(9)-tetrahydrocannabinol-9-carboxylic acid] which affects the methylation of FGF18 gene	CTD	PMID:30521419
Fgf18	Rat	Nutlin-3	multiple interactions	ISO	RGD:737083	6480464	[Dactinomycin co-treated with nutlin 3] results in increased expression of FGF18 mRNA	CTD	PMID:38460933
Fgf18	Rat	ochratoxin A	increases expression	ISO	RGD:737083	6480464	ochratoxin A results in increased expression of FGF18 mRNA	CTD	PMID:22124623
Fgf18	Rat	ochratoxin A	increases expression	EXP		6480464	ochratoxin A results in increased expression of FGF18 mRNA	CTD	PMID:22124623
Fgf18	Rat	okadaic acid	increases expression	ISO	RGD:737083	6480464	Okadaic Acid results in increased expression of FGF18 mRNA	CTD	PMID:38832940
Fgf18	Rat	panobinostat	multiple interactions	ISO	RGD:737083	6480464	[NOG protein co-treated with Panobinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Fgf18	Rat	pentanal	increases expression	ISO	RGD:737083	6480464	pentanal results in increased expression of FGF18 mRNA	CTD	PMID:26079696
Fgf18	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] results in increased expression of FGF18 mRNA	CTD	PMID:35163327
Fgf18	Rat	phenylephrine	increases expression	EXP		6480464	Phenylephrine results in increased expression of FGF18 mRNA	CTD	PMID:18158353
Fgf18	Rat	phenylmercury acetate	increases expression	ISO	RGD:737083	6480464	Phenylmercuric Acetate results in increased expression of FGF18 mRNA	CTD	PMID:26272509
Fgf18	Rat	phenylmercury acetate	multiple interactions	ISO	RGD:737083	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Fgf18	Rat	phorbol 13-acetate 12-myristate	multiple interactions	ISO	RGD:737084	6480464	[Methylcholanthrene co-treated with Tetradecanoylphorbol Acetate] results in increased expression of FGF18 mRNA	CTD	PMID:23519560
Fgf18	Rat	potassium chromate	increases expression	ISO	RGD:737083	6480464	potassium chromate(VI) results in increased expression of FGF18 mRNA	CTD	PMID:22079256
Fgf18	Rat	potassium chromate	multiple interactions	ISO	RGD:737083	6480464	[potassium chromate(VI) co-treated with epigallocatechin gallate] results in increased expression of FGF18 mRNA	CTD	PMID:22079256
Fgf18	Rat	progesterone	multiple interactions	ISO	RGD:737083	6480464	[Progesterone co-treated with Estradiol] results in decreased expression of FGF18 mRNA	CTD	PMID:17404688
Fgf18	Rat	progesterone	decreases expression	ISO	RGD:737083	6480464	Progesterone results in decreased expression of FGF18 mRNA	CTD	PMID:18037150
Fgf18	Rat	quercetin	increases expression	ISO	RGD:737083	6480464	Quercetin results in increased expression of FGF18 mRNA	CTD	PMID:21632981
Fgf18	Rat	S-(1,2-dichlorovinyl)-L-cysteine	multiple interactions	ISO	RGD:737083	6480464	[S-(1,2-dichlorovinyl)cysteine affects the susceptibility to Lipopolysaccharides] which results in increased expression of FGF18 mRNA; [S-(1,2-dichlorovinyl)cysteine more ...	CTD	PMID:35811015
Fgf18	Rat	SB 431542	multiple interactions	ISO	RGD:737083	6480464	[NOG protein co-treated with entinostat co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased expression more ...	CTD	PMID:27188386
Fgf18	Rat	silicon dioxide	increases expression	ISO	RGD:737083	6480464	Silicon Dioxide analog results in increased expression of FGF18 mRNA	CTD	PMID:23806026
Fgf18	Rat	sodium arsenite	increases expression	ISO	RGD:737083	6480464	sodium arsenite results in increased expression of FGF18 mRNA	CTD	PMID:38568856
Fgf18	Rat	sodium arsenite	decreases expression	ISO	RGD:737084	6480464	sodium arsenite results in decreased expression of FGF18 mRNA	CTD	PMID:37682722
Fgf18	Rat	Theaflavin 3,3'-digallate	affects expression	ISO	RGD:737083	6480464	theaflavin-3,3'-digallate affects the expression of FGF18 mRNA	CTD	PMID:34925699
Fgf18	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of FGF18 mRNA	CTD	PMID:34492290
Fgf18	Rat	thiram	increases expression	ISO	RGD:737083	6480464	Thiram results in increased expression of FGF18 mRNA	CTD	PMID:38568856
Fgf18	Rat	titanium dioxide	multiple interactions	ISO	RGD:737084	6480464	[titanium dioxide co-treated with Azoxymethane co-treated with Dextran Sulfate] results in decreased expression of FGF18 more ...	CTD	PMID:29950665
Fgf18	Rat	trichostatin A	increases expression	ISO	RGD:737083	6480464	trichostatin A results in increased expression of FGF18 mRNA	CTD	PMID:24935251
Fgf18	Rat	triptonide	increases expression	ISO	RGD:737084	6480464	triptonide results in increased expression of FGF18 mRNA	CTD	PMID:33045310
Fgf18	Rat	urethane	increases expression	ISO	RGD:737083	6480464	Urethane results in increased expression of FGF18 mRNA	CTD	PMID:28818685
Fgf18	Rat	valproic acid	affects expression	ISO	RGD:737083	6480464	Valproic Acid affects the expression of FGF18 mRNA	CTD	PMID:25979313
Fgf18	Rat	valproic acid	increases expression	ISO	RGD:737083	6480464	Valproic Acid results in increased expression of FGF18 mRNA	CTD	PMID:24383497\|PMID:24935251
Fgf18	Rat	vorinostat	decreases expression	ISO	RGD:737083	6480464	vorinostat results in decreased expression of FGF18 mRNA	CTD	PMID:27188386
Fgf18	Rat	vorinostat	increases expression	ISO	RGD:737083	6480464	vorinostat results in increased expression of FGF18 mRNA	CTD	PMID:18769122
Fgf18	Rat	zoledronic acid	increases expression	ISO	RGD:737083	6480464	zoledronic acid results in increased expression of FGF18 mRNA	CTD	PMID:24714768

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fgf18	Rat	angiogenesis	acts_upstream_of_or_within	ISO	RGD:737084	1624291	MGI:2178751 PMID:17014841	RGD	PMID:17014841
Fgf18	Rat	cell population proliferation	acts_upstream_of	ISO	RGD:737084	1624291	MGI:2178751 PMID:17014841	RGD	PMID:17014841
Fgf18	Rat	chondrocyte development	acts_upstream_of_or_within	ISO	RGD:737084	1624291	MGI:2178751 PMID:17014841	RGD	PMID:17014841
Fgf18	Rat	chondrocyte differentiation	acts_upstream_of	ISO	RGD:737084	1624291	MGI:95524 PMID:15781473	RGD	PMID:15781473
Fgf18	Rat	endochondral ossification	acts_upstream_of_or_within	ISO	RGD:737084	1624291	MGI:2178751 PMID:17014841	RGD	PMID:17014841
Fgf18	Rat	ERK1 and ERK2 cascade	acts_upstream_of	ISO	RGD:737084	1624291	PMID:11741978	RGD	PMID:11741978
Fgf18	Rat	fibroblast growth factor receptor signaling pathway	acts_upstream_of_or_within	ISO	RGD:737084	1624291	MGI:95524 PMID:15781473	RGD	PMID:15781473
Fgf18	Rat	fibroblast growth factor receptor signaling pathway	involved_in	IBA	FB:FBgn0014135\|MGI:104723\|MGI:1099809\|MGI:1202401\|MGI:1277980\|MGI:1861377\|MGI:1891427\|MGI:95517\|MGI:99604\|PANTHER:PTN000160075\|RGD:2609\|RGD:2610\|RGD:71052\|RGD:71068\|UniProtKB:O15520\|UniProtKB:O95750\|UniProtKB:P05230\|UniProtKB:P08620\|UniProtKB:P09038\|UniProtKB:P10767\|UniProtKB:P11487\|UniProtKB:P12034\|UniProtKB:P21781\|UniProtKB:P31371\|UniProtKB:P55075\|UniProtKB:Q8AXC5\|WB:WBGene00002881	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fgf18	Rat	intramembranous ossification	acts_upstream_of_or_within	ISO	RGD:737084	1624291	MGI:2178751 PMID:17014841	RGD	PMID:17014841
Fgf18	Rat	lung development	acts_upstream_of_or_within	ISO	RGD:737084	1624291	MGI:2179607 PMID:15336546	RGD	PMID:15336546
Fgf18	Rat	nervous system development		IMP		69834		RGD
Fgf18	Rat	neurogenesis	involved_in	IBA	FB:FBgn0014135\|MGI:109178\|MGI:1099809\|MGI:1891346\|MGI:95516\|MGI:95519\|MGI:99604\|PANTHER:PTN000160075\|RGD:70891\|UniProtKB:P48800\|UniProtKB:P55075\|ZFIN:ZDB-GENE-030729-32\|ZFIN:ZDB-GENE-060427-3\|ZFIN:ZDB-GENE-980526-178\|ZFIN:ZDB-GENE-990415-72	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fgf18	Rat	ossification	acts_upstream_of_or_within	ISO	RGD:737084	1624291	MGI:2178751\|MGI:2179607 PMID:11937493, PMID:11937494	RGD	PMID:11937493\|PMID:11937494
Fgf18	Rat	positive regulation of angiogenesis	involved_in	ISO	RGD:737083	1624291	RNAcentral:URS00004A5A07_9606 PMID:25449503	RGD	PMID:25449503
Fgf18	Rat	positive regulation of blood vessel endothelial cell migration	involved_in	ISO	RGD:737083	1624291	RNAcentral:URS00004A5A07_9606 PMID:25449503	RGD	PMID:25449503
Fgf18	Rat	positive regulation of cell population proliferation	involved_in	IBA	FB:FBgn0014135\|MGI:104723\|MGI:1099809\|MGI:1202401\|MGI:1277980\|MGI:1861377\|MGI:95515\|MGI:95516\|MGI:95517\|MGI:95518\|MGI:95521\|MGI:99604\|PANTHER:PTN000160075\|RGD:2605\|RGD:2608\|RGD:2609\|RGD:2610\|RGD:61805\|RGD:71052\|RGD:71068\|UniProtKB:O15520\|UniProtKB:O95750\|UniProtKB:P05230\|UniProtKB:P08620\|UniProtKB:P09038\|UniProtKB:P10767\|UniProtKB:P11487\|UniProtKB:P12034\|UniProtKB:P21781\|UniProtKB:P31371\|UniProtKB:P55075\|ZFIN:ZDB-GENE-030729-32	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fgf18	Rat	positive regulation of cell population proliferation	acts_upstream_of_or_within	ISO	RGD:737084	1624291	MGI:2178751 PMID:17014841	RGD	PMID:17014841
Fgf18	Rat	positive regulation of chondrocyte differentiation	acts_upstream_of_or_within	ISO	RGD:737084	1624291	MGI:95524 PMID:15781473	RGD	PMID:15781473
Fgf18	Rat	positive regulation of endothelial cell chemotaxis to fibroblast growth factor	involved_in	ISO	RGD:737083	1624291	PMID:16756958	RGD	PMID:16756958
Fgf18	Rat	positive regulation of ERK1 and ERK2 cascade	acts_upstream_of_or_within	ISO	RGD:737084	1624291	PMID:11741978	RGD	PMID:11741978
Fgf18	Rat	positive regulation of hepatocyte proliferation	involved_in	IDA		10047366	PMID:16756958	UniProt
Fgf18	Rat	positive regulation of MAP kinase activity	involved_in	ISO	RGD:737083	1624291	PMID:16756958	RGD	PMID:16756958
Fgf18	Rat	positive regulation of MAPK cascade	involved_in	IBA	MGI:1099809\|MGI:1277980\|MGI:1861377\|MGI:1891427\|MGI:95516\|MGI:99604\|PANTHER:PTN000160075\|RGD:2609\|RGD:71068\|UniProtKB:O15520\|UniProtKB:O76093\|UniProtKB:O95750\|UniProtKB:P05230\|UniProtKB:P08620\|UniProtKB:P09038\|UniProtKB:Q9NSA1	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fgf18	Rat	positive regulation of vascular endothelial growth factor receptor signaling pathway	acts_upstream_of_or_within	ISO	RGD:737084	1624291	MGI:2178751 PMID:17014841	RGD	PMID:17014841
Fgf18	Rat	regulation of cell migration	involved_in	IBA	MGI:1099809\|MGI:95516\|PANTHER:PTN000160075\|RGD:2610\|UniProtKB:O15520\|UniProtKB:O43320\|UniProtKB:O76093\|UniProtKB:P05230\|UniProtKB:P08620\|UniProtKB:P09038\|UniProtKB:P21781\|WB:WBGene00001185\|ZFIN:ZDB-GENE-980526-178\|ZFIN:ZDB-GENE-990415-72	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fgf18	Rat	regulation of endothelial cell proliferation	NOT\|involved_in	ISO	RGD:737083	1624291	PMID:16756958	RGD	PMID:16756958
Fgf18	Rat	regulation of sprouting angiogenesis	NOT\|involved_in	ISO	RGD:737083	1624291	PMID:16756958	RGD	PMID:16756958
Fgf18	Rat	signal transduction	involved_in	IEA	GO:0008083	1600115	GO_REF:0000108	GOC	GO_REF:0000108
Fgf18	Rat	vascular endothelial growth factor receptor signaling pathway	acts_upstream_of	ISO	RGD:737084	1624291	MGI:2178751 PMID:17014841	RGD	PMID:17014841

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fgf18	Rat	cytoplasm	located_in	IDA		10047366	PMID:16756958	UniProt
Fgf18	Rat	cytoplasm	is_active_in	IBA	MGI:109178\|MGI:109189\|MGI:1914362\|MGI:95517\|MGI:95521\|PANTHER:PTN000160075\|RGD:2608\|UniProtKB:P05230\|UniProtKB:P48800\|UniProtKB:Q92913\|WB:WBGene00002881\|ZFIN:ZDB-GENE-990415-72	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fgf18	Rat	extracellular region	located_in	IEA	UniProtKB-SubCell:SL-0243	1600115	GO_REF:0000044	UniProt	GO_REF:0000044
Fgf18	Rat	extracellular region	located_in	IEA	UniProtKB-KW:KW-0964	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fgf18	Rat	extracellular space	is_active_in	IBA	MGI:1099809\|MGI:1861377\|MGI:1891427\|MGI:95515\|MGI:95516\|PANTHER:PTN000160075\|RGD:2609\|RGD:61805\|RGD:620175\|RGD:620178\|UniProtKB:E1BDA6\|UniProtKB:O15520\|UniProtKB:P05230\|UniProtKB:P09038\|UniProtKB:P31371\|UniProtKB:P48800\|UniProtKB:P55075\|UniProtKB:Q9GZV9\|WB:WBGene00001185\|WB:WBGene00002881\|ZFIN:ZDB-GENE-980526-178\|ZFIN:ZDB-GENE-990415-72	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fgf18	Rat	nucleolus	located_in	ISO	RGD:737083	1624291		RGD	GO_REF:0000054
Fgf18	Rat	nucleus	located_in	IDA		10047366	PMID:16756958	UniProt

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fgf18	Rat	fibroblast growth factor receptor binding		NAS		69834		RGD
Fgf18	Rat	growth factor activity	enables	IEA	InterPro:IPR002209	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Fgf18	Rat	growth factor activity	enables	IBA	MGI:95516\|PANTHER:PTN000160075\|RGD:2605\|RGD:2610\|RGD:61805\|RGD:620129\|RGD:620165\|RGD:71068\|UniProtKB:O15520\|UniProtKB:P05230\|UniProtKB:P09038\|UniProtKB:P55075\|WB:WBGene00002881	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fgf18	Rat	growth factor activity	enables	IEA	UniProtKB-KW:KW-0339	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Fgf18	Rat	type 1 fibroblast growth factor receptor binding	enables	ISO	RGD:737083	1624291	PMID:16384934	RGD	PMID:16384934
Fgf18	Rat	type 1 fibroblast growth factor receptor binding	enables	IBA	PANTHER:PTN007510376\|UniProtKB:O60258\|UniProtKB:O76093\|UniProtKB:P55075	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Fgf18	Rat	type 2 fibroblast growth factor receptor binding	enables	ISO	RGD:737083	1624291	PMID:16384934	RGD	PMID:16384934
Fgf18	Rat	type 2 fibroblast growth factor receptor binding	enables	IBA	PANTHER:PTN007510376\|UniProtKB:O60258\|UniProtKB:O76093\|UniProtKB:P55075	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033

Molecular Pathway Annotations Click to see Annotation Detail View

Imported Annotations - KEGG (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fgf18	Rat	melanoma pathway		IEA		6907045		KEGG	rno:05218
Fgf18	Rat	mitogen activated protein kinase signaling pathway		IEA		6907045		KEGG	rno:04010

Imported Annotations - PID (archival)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Fgf18	Rat	fibroblast growth factor signaling pathway		ISO	RGD:737083	6484113		PID	PID:200220

Disease Annotations Click to see Annotation Detail View

Diaphragmatic Hernia (ISO)

Dwarfism (ISO)

hydrocephalus (ISO)

lung adenocarcinoma (ISO)

malignant mesothelioma (ISO)

osteoarthritis (ISO)

polycystic ovary syndrome (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-taxifolin (ISO)

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-tert-butylhydroquinone (ISO)

3,3',5-triiodo-L-thyronine (ISO)

3-methylcholanthrene (ISO)

3-Nitrobenzanthrone (ISO)

actinomycin D (ISO)

aflatoxin B1 (ISO)

Aflatoxin B2 alpha (ISO)

all-trans-retinoic acid (EXP,ISO)

alpha-Zearalanol (EXP)

ammonium chloride (EXP)

aristolochic acid A (ISO)

Azoxymethane (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

buta-1,3-diene (ISO)

butanal (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

cantharidin (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chloroprene (ISO)

chlorpyrifos (EXP)

chondroitin sulfate (ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

cordycepin (ISO)

Cuprizon (EXP)

cyclosporin A (ISO)

dermatan sulfate (ISO)

dextran sulfate (ISO)

diethyl malate (ISO)

diquat (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

entinostat (ISO)

epoxiconazole (ISO)

fluoranthene (ISO)

fulvestrant (ISO)

Glutathione ethyl ester (ISO)

lead diacetate (ISO)

Licochalcone B (ISO)

lipopolysaccharide (ISO)

methylmercury chloride (EXP,ISO)

mono(2-ethylhexyl) phthalate (ISO)

nickel atom (EXP)

nitrofen (EXP)

Nor-9-carboxy-delta9-THC (ISO)

Nutlin-3 (ISO)

ochratoxin A (EXP,ISO)

okadaic acid (ISO)

panobinostat (ISO)

pentanal (ISO)

perfluorooctanoic acid (EXP)

phenylephrine (EXP)

phenylmercury acetate (ISO)

phorbol 13-acetate 12-myristate (ISO)

potassium chromate (ISO)

progesterone (ISO)

quercetin (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

Theaflavin 3,3'-digallate (ISO)

thioacetamide (EXP)

thiram (ISO)

titanium dioxide (ISO)

trichostatin A (ISO)

triptonide (ISO)

urethane (ISO)

valproic acid (ISO)

vorinostat (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

angiogenesis (ISO)

cell population proliferation (ISO)

chondrocyte development (ISO)

chondrocyte differentiation (ISO)

endochondral ossification (ISO)

ERK1 and ERK2 cascade (ISO)

fibroblast growth factor receptor signaling pathway (IBA,ISO)

intramembranous ossification (ISO)

lung development (ISO)

nervous system development (IMP)

neurogenesis (IBA)

ossification (ISO)

positive regulation of angiogenesis (ISO)

positive regulation of blood vessel endothelial cell migration (ISO)

positive regulation of cell population proliferation (IBA,ISO)

positive regulation of chondrocyte differentiation (ISO)

positive regulation of endothelial cell chemotaxis to fibroblast growth factor (ISO)

positive regulation of ERK1 and ERK2 cascade (ISO)

positive regulation of hepatocyte proliferation (IDA)

positive regulation of MAP kinase activity (ISO)

positive regulation of MAPK cascade (IBA)

positive regulation of vascular endothelial growth factor receptor signaling pathway (ISO)

regulation of cell migration (IBA)

regulation of endothelial cell proliferation (ISO)

regulation of sprouting angiogenesis (ISO)

signal transduction (IEA)

vascular endothelial growth factor receptor signaling pathway (ISO)

Cellular Component

cytoplasm (IBA,IDA)

extracellular region (IEA)

extracellular space (IBA)

nucleolus (ISO)

nucleus (IDA)

Molecular Function

fibroblast growth factor receptor binding (NAS)

growth factor activity (IBA,IEA)

type 1 fibroblast growth factor receptor binding (IBA,ISO)

type 2 fibroblast growth factor receptor binding (IBA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

fibroblast growth factor signaling pathway (ISO)

melanoma pathway (IEA)

mitogen activated protein kinase signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Fibroblast growth factor 16 and 18 are expressed in human cardiovascular tissues and induce on endothelial cells migration but not proliferation.	Antoine M, etal., Biochem Biophys Res Commun. 2006 Jul 21;346(1):224-33. Epub 2006 May 26.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
5.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
6.	Structure and expression of the mRNA encoding a novel fibroblast growth factor, FGF-18.	Ohbayashi N, etal., J Biol Chem 1998 Jul 17;273(29):18161-4.
7.	Online Mendelian Inheritance in Man, OMIM (TM).	Online Mendelian Inheritance in Man, OMIM (TM).
8.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
9.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
10.	GOA pipeline	RGD automated data pipeline
11.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
12.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data

Additional References at PubMed

PMID:11741978	PMID:11937493	PMID:11937494	PMID:12738892	PMID:15252029	PMID:15336546	PMID:15447937	PMID:15781473	PMID:16019430	PMID:16384934	PMID:17014841	PMID:23979401
PMID:25449503

Genomics

Comparative Map Data

Fgf18
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	10	18,210,240 - 18,241,929 (-)	NCBI		GRCr8
mRatBN7.2	10	17,706,011 - 17,737,702 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	10	17,706,174 - 17,736,818 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	10	22,455,024 - 22,484,592 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	10	21,943,626 - 21,973,192 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	10	17,432,271 - 17,461,845 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	10	18,047,109 - 18,082,290 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	10	18,047,109 - 18,063,391 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	10	17,932,880 - 17,967,318 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	10	17,348,236 - 17,383,370 (-)	NCBI		Celera
Cytogenetic Map	10	q12	NCBI

FGF18
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	171,419,647 - 171,457,626 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	5	171,419,647 - 171,457,626 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	170,846,651 - 170,884,630 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	170,779,272 - 170,816,781 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	5	170,779,271 - 170,816,781	NCBI
Celera	5	166,879,014 - 166,916,982 (+)	NCBI		Celera
Cytogenetic Map	5	q35.1	NCBI
HuRef	5	165,944,447 - 165,981,862 (+)	NCBI		HuRef
CHM1_1	5	170,279,191 - 170,317,159 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	5	171,959,977 - 171,997,979 (+)	NCBI		T2T-CHM13v2.0

Fgf18
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	11	33,066,970 - 33,097,400 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	11	33,067,430 - 33,097,400 (-)	Ensembl		GRCm39 Ensembl
GRCm38	11	33,116,970 - 33,147,400 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	11	33,117,430 - 33,147,400 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	11	33,017,430 - 33,047,400 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	11	33,017,430 - 33,047,400 (-)	NCBI		MGSCv36	mm8
Celera	11	35,529,642 - 35,559,689 (-)	NCBI		Celera
Cytogenetic Map	11	A4	NCBI
cM Map	11	19.21	NCBI

Fgf18
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955408	24,225,459 - 24,260,092 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955408	24,225,459 - 24,260,057 (+)	NCBI	ChiLan1.0	ChiLan1.0

FGF18
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	4	166,553,461 - 166,591,129 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	5	164,693,000 - 164,730,916 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	5	166,765,061 - 166,802,277 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

FGF18
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	4	40,714,891 - 40,748,892 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	4	40,715,060 - 40,748,518 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	4	40,660,286 - 40,697,075 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	4	41,089,249 - 41,126,052 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	4	41,091,859 - 41,126,139 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	4	40,904,218 - 40,941,026 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	4	41,094,435 - 41,131,275 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	4	41,604,558 - 41,641,375 (-)	NCBI		UU_Cfam_GSD_1.0

Fgf18
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	94,954,910 - 94,983,832 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936609	3,677,237 - 3,706,517 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936609	3,677,661 - 3,706,511 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FGF18
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	16	52,725,356 - 52,759,791 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	16	52,724,867 - 52,760,246 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	16	56,920,916 - 56,956,478 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FGF18
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	73,584,223 - 73,620,881 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	73,584,766 - 73,620,069 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	5,019,198 - 5,060,806 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fgf18
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624733	18,599,557 - 18,633,016 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624733	18,599,186 - 18,633,065 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Fgf18
212 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	26
Count of miRNA genes:	24
Interacting mature miRNAs:	26
Transcripts:	ENSRNOT00000072297
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
6893352	Bw100	Body weight QTL 100	0.33	0.6	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
9589136	Insul27	Insulin level QTL 27	10.46	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	10	11474010	56474010	Rat
631564	Apr3	Acute phase response QTL 3	3.9		blood interleukin-6 amount (VT:0008595)	plasma interleukin-6 level (CMO:0001927)	10	15275955	60275955	Rat
8662860	Vetf10	Vascular elastic tissue fragility QTL 10			artery integrity trait (VT:0010639)	number of ruptures of the internal elastic lamina of the abdominal aorta and iliac arteries (CMO:0002562)	10	6154182	73453136	Rat
2313066	Bss63	Bone structure and strength QTL 63	1.4	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	10	5387014	50387014	Rat
631554	Bp133	Blood pressure QTL 133		0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	743364	63851208	Rat
2313064	Bmd71	Bone mineral density QTL 71	0.9	0.0001	tibia mineral mass (VT:1000283)	compact volumetric bone mineral density (CMO:0001730)	10	5387014	50387014	Rat
70223	Bp57	Blood pressure QTL 57	5		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	10	1	80676123	Rat
1354587	Kidm21	Kidney mass QTL 21	3.3		kidney mass (VT:0002707)	right kidney wet weight (CMO:0000082)	10	15028513	60430477	Rat
6893350	Bw99	Body weight QTL 99	0.87	0.16	body mass (VT:0001259)	body weight (CMO:0000012)	1	15906665	60906665	Rat
634329	Pia15	Pristane induced arthritis QTL 15	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	1	24158324	Rat
1578761	Stresp21	Stress response QTL 21	3.3		thymus mass (VT:0004954)	thymus wet weight (CMO:0000855)	10	6375746	51375746	Rat
2293680	Bss40	Bone structure and strength QTL 40	5.66	0.0001	femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	10	1	35225947	Rat
7387235	Uae41	Urinary albumin excretion QTL 41	5.26	0.1874	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	10	1	29497586	Rat
2298544	Neuinf9	Neuroinflammation QTL 9	4.6		nervous system integrity trait (VT:0010566)	spinal cord complement component 1, q subcomponent, B chain mRNA level (CMO:0002126)	10	5801990	62146030	Rat
737823	Alc12	Alcohol consumption QTL 12	4.5		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	17245513	19388279	Rat
10401803	Kidm50	Kidney mass QTL 50			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	10	418344	45418344	Rat
737820	Alc9	Alcohol consumption QTL 9	2.2		consumption behavior trait (VT:0002069)	ethanol drink intake rate (CMO:0001407)	10	5144027	19233348	Rat
2313081	Bss64	Bone structure and strength QTL 64	1.3	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	10	5387014	50387014	Rat
634327	Hc4	Hypercalciuria QTL 4	2.4		urine calcium amount (VT:0002985)	urine calcium excretion rate (CMO:0000763)	10	1	38328221	Rat
2313095	Bss62	Bone structure and strength QTL 62	1.5	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
1576304	Schws7	Schwannoma susceptibility QTL 7		0.0115	nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	10	4765527	19816042	Rat
7411611	Foco17	Food consumption QTL 17	18.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	10	1	42315980	Rat
2301967	Cm73	Cardiac mass QTL 73	4.55		heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	10	14487011	89062041	Rat
2303118	Mamtr7	Mammary tumor resistance QTL 7		0.003	mammary gland integrity trait (VT:0010552)	mammary tumor growth rate (CMO:0000344)	10	9658275	104670812	Rat
631268	Cia21	Collagen induced arthritis QTL 21	3.1		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	14487011	104060283	Rat
9590268	Scort13	Serum corticosterone level QTL 13	3.26	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
2313104	Bss61	Bone structure and strength QTL 61	0.9	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	10	5387014	50387014	Rat
61427	Cia16	Collagen induced arthritis QTL 16	3.2		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	10	6357896	96121100	Rat
9590310	Scort19	Serum corticosterone level QTL 19	6.3	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	10	11474010	56474010	Rat
2316949	Gluco60	Glucose level QTL 60	3.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	10	14487011	107057807	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	79	78	47	25	47	6	206	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019199	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085733	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085734	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039085735	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005489768	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB004638	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473948	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000010	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000072297 ⟹ ENSRNOP00000064983

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	17,706,174 - 17,723,728 (-)	Ensembl
Rnor_6.0 Ensembl	10	18,047,109 - 18,063,391 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103123 ⟹ ENSRNOP00000084264

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	10	17,706,174 - 17,736,818 (-)	Ensembl

RefSeq Acc Id:

NM_019199 ⟹ NP_062072

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	18,210,497 - 18,240,882 (-)	NCBI
mRatBN7.2	10	17,706,268 - 17,736,655 (-)	NCBI
Rnor_6.0	10	18,047,109 - 18,082,290 (-)	NCBI
Rnor_5.0	10	17,932,880 - 17,967,318 (-)	NCBI
Celera	10	17,348,236 - 17,383,370 (-)	RGD

Sequence:

show sequence

ATGTATTCAGCGCCCTCCGCCTGCACTTGCCTGTGTTTACACTTTCTACTGCTGTGCTTCCAGG
TTCAGGTGTTGGCAGCCGAGGAGAACGTGGACTTCCGCATCCATGTGGAGAACCAGACTCGGGC
TCGCGATGATGTGAGTCGGAAGCAGCTGCGCTTGTACCAGCTCTACAGCAGGACCAGTGGGAAG
CACATTCAAGTCCTGGGCCGTAGGATCAGTGCCCGTGGCGAGGACGGGGACAAGTATGCCCAGC
TCCTAGTGGAGACGGATACCTTCGGGAGTCAAGTCCGGATCAAGGGCAAAGAGACAGAGTTCTA
CCTGTGTATGAACCGAAAAGGCAAGCTCGTGGGGAAGCCTGATGGTACTAGCAAGGAGTGCGTG
TTCATTGAGAAGGTTCTGGAAAACAACTACACGGCCCTGATGTCAGCCAAGTACTCAGGCTGGT
ACGTGGGCTTCACCAAGAAGGGGCGGCCTCGCAAGGGTCCCAAGACCCGCGAAAACCAGCAAGA
TGTGCACTTCATGAAGCGTTACCCCAAGGGACAGACTGAGCTGCAGAAGCCCTTCAAGTACACC
ACAGTTACTAAGCGATCCCGGCGGATCCGCCCCACTCACCCCGGCTAG

hide sequence

RefSeq Acc Id:

XM_039085733 ⟹ XP_038941661

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	18,211,404 - 18,241,929 (-)	NCBI
mRatBN7.2	10	17,707,168 - 17,737,702 (-)	NCBI

RefSeq Acc Id:

XM_039085734 ⟹ XP_038941662

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	18,210,240 - 18,240,493 (-)	NCBI
mRatBN7.2	10	17,706,011 - 17,736,275 (-)	NCBI

RefSeq Acc Id:

XM_039085735 ⟹ XP_038941663

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	18,210,240 - 18,241,918 (-)	NCBI
mRatBN7.2	10	17,706,011 - 17,737,692 (-)	NCBI

RefSeq Acc Id:

XR_005489768

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	10	18,211,404 - 18,241,919 (-)	NCBI
mRatBN7.2	10	17,707,168 - 17,737,692 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_062072	(Get FASTA)	NCBI Sequence Viewer
	XP_038941661	(Get FASTA)	NCBI Sequence Viewer
	XP_038941662	(Get FASTA)	NCBI Sequence Viewer
	XP_038941663	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	BAA31979	(Get FASTA)	NCBI Sequence Viewer
	EDM04066	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000084264
	ENSRNOP00000084264.1
GenBank Protein	O88182	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_062072 ⟸ NM_019199
- Peptide Label:	precursor
- UniProtKB:	O88182 (UniProtKB/Swiss-Prot), M0R6D5 (UniProtKB/TrEMBL)
- Sequence:	show sequence MYSAPSACTCLCLHFLLLCFQVQVLAAEENVDFRIHVENQTRARDDVSRKQLRLYQLYSRTSGK HIQVLGRRISARGEDGDKYAQLLVETDTFGSQVRIKGKETEFYLCMNRKGKLVGKPDGTSKECV FIEKVLENNYTALMSAKYSGWYVGFTKKGRPRKGPKTRENQQDVHFMKRYPKGQTELQKPFKYT TVTKRSRRIRPTHPG hide sequence

Ensembl Acc Id:

ENSRNOP00000064983 ⟸ ENSRNOT00000072297

RefSeq Acc Id:	XP_038941663 ⟸ XM_039085735
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038941662 ⟸ XM_039085734
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038941661 ⟸ XM_039085733
- Peptide Label:	isoform X1

Ensembl Acc Id:

ENSRNOP00000084264 ⟸ ENSRNOT00000103123

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-O88182-F1-model_v2	AlphaFold	O88182	1-207	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2608	AgrOrtholog
BioCyc Gene	G2FUF-25610	BioCyc
Ensembl Genes	ENSRNOG00000048389	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000103123	ENTREZGENE
	ENSRNOT00000103123.1	UniProtKB/Swiss-Prot
Gene3D-CATH	2.80.10.50	UniProtKB/Swiss-Prot
InterPro	Fibroblast_GF_fam	UniProtKB/Swiss-Prot
	IL1/FGF	UniProtKB/Swiss-Prot
KEGG Report	rno:29369	UniProtKB/Swiss-Prot
NCBI Gene	29369	ENTREZGENE
PANTHER	PTHR11486	UniProtKB/Swiss-Prot
Pfam	FGF	UniProtKB/Swiss-Prot
PhenoGen	Fgf18	PhenoGen
PRINTS	IL1HBGF	UniProtKB/Swiss-Prot
PROSITE	HBGF_FGF	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000048389	RatGTEx
SMART	FGF	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF50353	UniProtKB/Swiss-Prot
TIGR	TC220071
UniProt	A6HDG1_RAT	UniProtKB/TrEMBL
	FGF18_RAT	UniProtKB/Swiss-Prot
	M0R6D5	ENTREZGENE, UniProtKB/TrEMBL
	O88182	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2002-06-10	Fgf18	fibroblast growth factor 18			Name updated	70584	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	mRNA expressed primarily in lung of adults	69834
gene_homology	shares 99% aa sequence identity with human FGF18, and 99.5% with mouse Fgf18	69834

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)