Fcer1g (Fc epsilon receptor Ig) - Rat Genome Database

Name: Fcer1g
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Fcer1g (Fc epsilon receptor Ig) Rattus norvegicus

Analyze

Symbol:

Fcer1g

Name:

Fc epsilon receptor Ig

RGD ID:

2599

Description:

Enables protein heterodimerization activity and protein homodimerization activity. Predicted to be involved in several processes, including antigen processing and presentation of exogenous peptide antigen via MHC class II; cell surface receptor signaling pathway; and defense response to other organism. Predicted to act upstream of or within several processes, including negative regulation of mast cell apoptotic process; positive regulation of cytokine production; and positive regulation of immune effector process. Part of Fc-gamma receptor III complex. Orthologous to human FCER1G (Fc epsilon receptor Ig); PARTICIPATES IN Fc epsilon receptor mediated signaling pathway; asthma pathway; tuberculosis pathway; INTERACTS WITH 1-naphthyl isothiocyanate; 17beta-estradiol; 17beta-estradiol 3-benzoate.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Fc fragment of Ige high affinity I receptor for gamma polypeptide; Fc fragment of IgE receptor Ig; Fc fragment of IgE, high affinity I, receptor for; Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide; Fc receptor gamma-chain; Fc receptor, IgE, high affinity I, gamma polypeptide; fc-epsilon RI-gamma; fceRI gamma; fcRgamma; gamma polypeptide; high affinity immunoglobulin epsilon receptor subunit gamma; igE Fc receptor subunit gamma; MGC188226

RGD Orthologs

Alliance Genes

More Info

more info ...

Candidate Gene For:

Glom27

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	13	83,649,447 - 83,654,248 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	83,649,449 - 83,671,443 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	86,155,292 - 86,160,092 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	87,553,532 - 87,558,332 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	84,785,150 - 84,789,956 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	89,601,894 - 89,606,326 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	89,601,896 - 89,606,326 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	94,228,759 - 94,233,459 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	87,119,464 - 87,123,902 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	87,308,348 - 87,312,727 (-)	NCBI
Celera	13	83,280,630 - 83,285,062 (-)	NCBI		Celera
Cytogenetic Map	13	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autoimmune interstitial lung, joint, and kidney disease (ISO)

drug allergy (ISO)

Experimental Liver Cirrhosis (ISO)

gastrointestinal stromal tumor (ISO)

genetic disease (ISO)

Genetic Predisposition to Disease (ISO)

parathyroid carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,1-dichloroethene (ISO)

1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

17beta-estradiol 3-benzoate (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,5-hexanedione (EXP)

3,3',5,5'-tetrabromobisphenol A (EXP)

4,4'-diaminodiphenylmethane (EXP,ISO)

4,4'-sulfonyldiphenol (EXP,ISO)

5-aza-2'-deoxycytidine (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acetylsalicylic acid (ISO)

aldehydo-D-glucose (ISO)

all-trans-retinoic acid (ISO)

amitrole (EXP)

ammonium chloride (EXP)

amphetamine (EXP)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsenous acid (ISO)

beclomethasone (EXP)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP,ISO)

calcitriol (ISO)

carbon nanotube (ISO)

chlordecone (ISO)

choline (ISO)

cisplatin (EXP)

citalopram (ISO)

copper atom (EXP)

copper(0) (EXP)

Cuprizon (EXP)

cyclophosphamide (ISO)

D-glucose (ISO)

dexamethasone (ISO)

dextran sulfate (ISO)

diarsenic trioxide (ISO)

diclofenac (ISO)

diethylstilbestrol (ISO)

diquat (ISO)

diuron (EXP)

fenbuconazole (ISO)

folic acid (ISO)

fulvestrant (ISO)

ginkgolide B (EXP)

glucose (ISO)

ketotifen (EXP)

L-methionine (ISO)

lipopolysaccharide (ISO)

mercury atom (ISO)

mercury(0) (ISO)

methimazole (EXP)

methotrexate (ISO)

methylmercury chloride (EXP)

N-nitrosodiethylamine (EXP)

N-nitrosodimethylamine (EXP)

nickel atom (ISO)

nilotinib (ISO)

ochratoxin A (EXP)

ozone (EXP,ISO)

paracetamol (ISO)

perfluorooctane-1-sulfonic acid (ISO)

probucol (ISO)

quercetin (ISO)

resveratrol (EXP)

serpentine asbestos (ISO)

silicon dioxide (EXP)

sodium arsenite (ISO)

sodium dichromate (EXP)

streptozocin (EXP)

tamibarotene (ISO)

testosterone (EXP)

testosterone enanthate (ISO)

tetrachloromethane (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triphenyl phosphate (EXP)

troglitazone (ISO)

tungsten (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antigen processing and presentation of exogenous peptide antigen via MHC class I (IBA,ISO)

antigen processing and presentation of exogenous peptide antigen via MHC class II (IBA,ISO)

cell surface receptor signaling pathway (ISO)

cellular response to low-density lipoprotein particle stimulus (ISO,ISS)

defense response to bacterium (IBA,ISO)

Fc receptor mediated stimulatory signaling pathway (IBA,ISO)

Fc-epsilon receptor signaling pathway (IEA,ISO)

Fc-gamma receptor signaling pathway (IBA,ISO)

immunoglobulin mediated immune response (IBA,ISO)

innate immune response (IBA,IEA,ISO)

integrin-mediated signaling pathway (ISO)

interleukin-3-mediated signaling pathway (ISO,ISS)

mast cell activation (ISO)

mast cell apoptotic process (ISO)

mast cell degranulation (ISO)

negative regulation of mast cell apoptotic process (ISO)

neutrophil activation involved in immune response (IBA,ISO)

neutrophil chemotaxis (IBA,ISO)

osteoclast differentiation (ISO)

phagocytosis, engulfment (ISO)

positive regulation of immune response (ISO)

positive regulation of interleukin-10 production (ISO)

positive regulation of interleukin-4 production (ISO,ISS)

positive regulation of interleukin-6 production (ISO)

positive regulation of mast cell cytokine production (ISO)

positive regulation of mast cell degranulation (ISO)

positive regulation of phagocytosis (IBA,ISO)

positive regulation of protein localization to cell surface (ISO)

positive regulation of tumor necrosis factor production (ISO)

positive regulation of type I hypersensitivity (ISO)

positive regulation of type IIa hypersensitivity (ISO)

positive regulation of type III hypersensitivity (ISO)

protein localization to plasma membrane (ISO)

receptor internalization (ISO,ISS)

regulation of immune response (ISO)

regulation of platelet activation (IBA,ISO)

serotonin secretion by platelet (ISO)

signal transduction (ISO)

T cell differentiation involved in immune response (IBA,ISO)

Cellular Component

cell surface (ISO)

external side of plasma membrane (IBA,ISO)

Fc-epsilon receptor I complex (IBA,IEA,ISO)

Fc-gamma receptor III complex (IDA,ISO)

plasma membrane (ISO)

Molecular Function

identical protein binding (ISO)

IgE binding (IEA,ISO)

IgE receptor activity (IBA,IEA,ISO)

IgG binding (IBA,ISO)

protein binding (IPI,ISO)

protein heterodimerization activity (IDA)

protein homodimerization activity (IDA,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

asthma pathway (IEA)

Fc epsilon receptor mediated signaling pathway (IEA,ISO)

tuberculosis pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Complete structure and expression in transfected cells of high affinity IgE receptor.	Blank U, etal., Nature 1989 Jan 12;337(6203):187-9.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Analysis of Fc gamma RIII (CD16) membrane expression and association with CD3 zeta and Fc epsilon RI-gamma by site-directed mutation.	Lanier LL, etal., J Immunol. 1991 Mar 1;146(5):1571-6.
5.	Mincle, the receptor for mycobacterial cord factor, forms a functional receptor complex with MCL and FcεRI-γ.	Lobato-Pascual A, etal., Eur J Immunol. 2013 Dec;43(12):3167-74. doi: 10.1002/eji.201343752. Epub 2013 Aug 26.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	Online Mendelian Inheritance in Man, OMIM (TM).	Online Mendelian Inheritance in Man, OMIM (TM).
9.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
10.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
11.	GOA pipeline	RGD automated data pipeline
12.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:1535625	PMID:2527850	PMID:8976192	PMID:9000133	PMID:9171347	PMID:10229794	PMID:10395649	PMID:11237803	PMID:11420040	PMID:11901193	PMID:11911823	PMID:11911824
PMID:12192036	PMID:12477932	PMID:14643301	PMID:14764707	PMID:14967045	PMID:15184345	PMID:15339843	PMID:16735691	PMID:17086186	PMID:17365510	PMID:17543387	PMID:19098920
PMID:19356729	PMID:21841309	PMID:22964482	PMID:23395392	PMID:23602766	PMID:28033741	PMID:28393919

Genomics

Comparative Map Data

Fcer1g
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	13	83,649,447 - 83,654,248 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	83,649,449 - 83,671,443 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	86,155,292 - 86,160,092 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	87,553,532 - 87,558,332 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	84,785,150 - 84,789,956 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	89,601,894 - 89,606,326 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	89,601,896 - 89,606,326 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	94,228,759 - 94,233,459 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	87,119,464 - 87,123,902 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	87,308,348 - 87,312,727 (-)	NCBI
Celera	13	83,280,630 - 83,285,062 (-)	NCBI		Celera
Cytogenetic Map	13	q24	NCBI

FCER1G
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	161,215,295 - 161,219,245 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	161,215,234 - 161,220,699 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	161,185,085 - 161,189,035 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	159,451,711 - 159,455,662 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	157,998,159 - 158,002,111	NCBI
Celera	1	134,252,239 - 134,256,190 (+)	NCBI		Celera
Cytogenetic Map	1	q23.3	NCBI
HuRef	1	132,542,035 - 132,545,988 (+)	NCBI		HuRef
CHM1_1	1	162,581,340 - 162,585,295 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	160,352,747 - 160,356,700 (+)	NCBI		T2T-CHM13v2.0

Fcer1g
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	171,057,141 - 171,061,918 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	171,057,141 - 171,061,934 (-)	Ensembl		GRCm39 Ensembl
GRCm38	1	171,229,572 - 171,234,349 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	171,229,572 - 171,234,365 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	173,159,703 - 173,164,480 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	173,066,247 - 173,071,024 (-)	NCBI		MGSCv36	mm8
Celera	1	173,677,711 - 173,690,567 (-)	NCBI		Celera
Cytogenetic Map	1	H3	NCBI
cM Map	1	79.23	NCBI

Fcer1g
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955468	12,971,931 - 12,975,206 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955468	12,971,931 - 12,975,206 (+)	NCBI	ChiLan1.0	ChiLan1.0

FCER1G
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	1	88,323,067 - 88,327,094 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	136,627,672 - 136,631,696 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	140,539,555 - 140,543,545 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	140,539,555 - 140,544,810 (+)	Ensembl	panpan1.1		panPan2

FCER1G
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	38	21,267,841 - 21,271,036 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	38	21,268,001 - 21,270,940 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	38	21,342,857 - 21,345,796 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	38	21,385,844 - 21,388,784 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	38	21,385,844 - 21,388,784 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UNSW_CanFamBas_1.0	38	21,688,132 - 21,691,072 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	38	22,097,280 - 22,100,221 (-)	NCBI		UU_Cfam_GSD_1.0

Fcer1g
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	7,305,613 - 7,309,317 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936903	514,761 - 517,948 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936903	514,278 - 517,975 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FCER1G
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	89,242,472 - 89,246,450 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	89,242,467 - 89,246,344 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	97,099,149 - 97,103,026 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FCER1G
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	2,763,412 - 2,767,774 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	2,763,417 - 2,767,248 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	1,811,779 - 1,815,687 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fcer1g
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624794	168,564 - 172,034 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624794	168,564 - 172,433 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Fcer1g
27 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	52
Count of miRNA genes:	43
Interacting mature miRNAs:	46
Transcripts:	ENSRNOT00000029179
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	1	101056920	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	1	101056920	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	101056920	Rat
1581570	Eae17	Experimental allergic encephalomyelitis QTL 17	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	13	8897350	101631289	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	20605871	101339738	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	30395351	101056920	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	31241331	93395974	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	31241331	93395974	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	31241331	93395974	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	31241331	93395974	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	39754544	84754544	Rat
12879444	Bp397	Blood pressure QTL 397			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45049404	90049404	Rat
12879471	Bp398	Blood pressure QTL 398			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45514719	90514719	Rat
12879441	Bp396	Blood pressure QTL 396			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45699983	90699983	Rat
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	46088046	91088046	Rat
71119	Thym2	Thymus enlargement QTL 2	3.8		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	13	46197976	84753113	Rat
1641901	Alcrsp6	Alcohol response QTL 6			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	13	52362171	97362171	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	56056920	101056920	Rat
738026	Lnnr5	Liver neoplastic nodule remodeling QTL 5	3.29		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	59874408	85581182	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	61825626	106807694	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	65103704	106807694	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	65103704	106807694	Rat
8655945	Rf61	Renal function QTL 61	3.6		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	13	69060519	86800898	Rat
1331783	Bp221	Blood pressure QTL 221	3.72886		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	69060519	86800898	Rat
1300166	Kidm6	Kidney mass QTL 6	3.93		kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	13	69060519	86800898	Rat
8655959	Pur32	Proteinuria QTL 32	8.4		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	74023918	97213863	Rat
738027	Lnnr6	Liver neoplastic nodule remodeling QTL 6	3.3		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	74862117	85581182	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	74862117	101339893	Rat
4889606	Gluco63	Glucose level QTL 63	2.86	0.003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	80753256	106807694	Rat

Markers in Region

RH129161

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	83,649,476 - 83,649,659 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	89,601,924 - 89,602,106	NCBI	Rnor6.0
Rnor_5.0	13	94,228,789 - 94,228,971	UniSTS	Rnor5.0
RGSC_v3.4	13	87,119,494 - 87,119,676	UniSTS	RGSC3.4
Celera	13	83,280,660 - 83,280,842	UniSTS
RH 3.4 Map	13	551.5	UniSTS
Cytogenetic Map	13	q24	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	25	48	36	19	36		2	62	34	31	11
Low		18	9	5		5	8	9	12	1	10		8
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001131001	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NR_175264	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039090390	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC099236	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC160864	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000245	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L04306	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000029179 ⟹ ENSRNOP00000036716

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	83,649,449 - 83,653,880 (-)	Ensembl
Rnor_6.0 Ensembl	13	89,601,896 - 89,606,326 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000098830 ⟹ ENSRNOP00000077355

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	83,649,449 - 83,671,443 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000103864 ⟹ ENSRNOP00000096825

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	83,649,449 - 83,654,299 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000103998 ⟹ ENSRNOP00000088147

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	83,649,449 - 83,651,748 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000108934 ⟹ ENSRNOP00000089806

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	83,649,449 - 83,666,844 (-)	Ensembl

RefSeq Acc Id:

NM_001131001 ⟹ NP_001124473

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	13	83,649,447 - 83,653,863 (-)	NCBI
Rnor_6.0	13	89,601,894 - 89,606,326 (-)	NCBI
Rnor_5.0	13	94,228,759 - 94,233,459 (-)	NCBI
RGSC_v3.4	13	87,119,464 - 87,123,902 (-)	RGD
Celera	13	83,280,630 - 83,285,062 (-)	RGD

Sequence:

show sequence

GGGAACTGTTCGTGGGTACAGCTGTGCAGCTCTGTCTTAGCGCGTGATCACCAGCCCCCAGCGC
TGCAGCCCCCGCCCAGGATGATCCCAGCGGTGATCTTGTTCTTGCTCCTTTTGGTGGAAGAAGC
AGCTGCCCTAGGAGAGCCGCAGCTCTGCTATATCCTGGATGCCATCCTGTTTTTGTATGGTATT
GTCCTTACCCTGCTCTACTGTCGACTCAAGATCCAGGTCCGAAAGGCAGACATAGCCAGCCGTG
AGAAATCAGATGCTGTCTACACGGGCCTGAACACCCGGAACCAGGAGACATATGAGACTCTGAA
ACATGAGAAACCACCCCAATAGCTTTACAACACGTGTTCTCAGCTGCATTCCTTTTCCGCTTTT
AATTCTCTCCTCGCCCTCATGATTGACGTGGCTGTGCTACCTCCGTGCTTCTGGAACTAGCTGA
CCTTATTCCCAGAACCATGCTAGGCTCTAAATCAATGTCCCCATATCCACCAAAGACTTACTCA
CTGACATTTCTCTTCTCCCATCCTCCTTTGCTTCATTCCTCTTTCCTTCCCTGATCCTCTGTGC
TCACTAAACAATGGGAAGGGATTACCCCCCAATAAAGCTGCCAGAGATCACGCTCAAAAAAAAA
AAAAAAAAAAAAAAAAA

hide sequence

RefSeq Acc Id:

NR_175264

RefSeq Status:

VALIDATED

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	13	83,649,447 - 83,654,248 (-)	NCBI

RefSeq Acc Id:

XM_039090390 ⟹ XP_038946318

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	13	83,649,447 - 83,654,215 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001124473	(Get FASTA)	NCBI Sequence Viewer
	XP_038946318	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI60864	(Get FASTA)	NCBI Sequence Viewer
	EDL94613	(Get FASTA)	NCBI Sequence Viewer
	P20411	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001124473 ⟸ NM_001131001
- Peptide Label:	precursor
- UniProtKB:	P20411 (UniProtKB/Swiss-Prot), B1H251 (UniProtKB/TrEMBL), A0A8I6AI77 (UniProtKB/TrEMBL)
- Sequence:	show sequence MIPAVILFLLLLVEEAAALGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKADIASREKSDAV YTGLNTRNQETYETLKHEKPPQ hide sequence

RefSeq Acc Id:

ENSRNOP00000036716 ⟸ ENSRNOT00000029179

RefSeq Acc Id:	XP_038946318 ⟸ XM_039090390
- Peptide Label:	isoform X2
- UniProtKB:	A0A8I6GIE3 (UniProtKB/TrEMBL), A0A8I6AI77 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000077355 ⟸ ENSRNOT00000098830

RefSeq Acc Id:

ENSRNOP00000088147 ⟸ ENSRNOT00000103998

RefSeq Acc Id:

ENSRNOP00000096825 ⟸ ENSRNOT00000103864

RefSeq Acc Id:

ENSRNOP00000089806 ⟸ ENSRNOT00000108934

Protein Domains

ITAM

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P20411-F1-model_v2	AlphaFold	P20411	1-86	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2599	AgrOrtholog
BioCyc Gene	G2FUF-17382	BioCyc
Ensembl Genes	ENSRNOG00000024159	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000036716.4	UniProtKB/TrEMBL
	ENSRNOP00000077355.1	UniProtKB/TrEMBL
	ENSRNOP00000088147.1	UniProtKB/TrEMBL
	ENSRNOP00000089806	ENTREZGENE
	ENSRNOP00000089806.1	UniProtKB/TrEMBL
	ENSRNOP00000096825.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000029179.4	UniProtKB/TrEMBL
	ENSRNOT00000098830.1	UniProtKB/TrEMBL
	ENSRNOT00000103864	ENTREZGENE
	ENSRNOT00000103864.1	UniProtKB/TrEMBL
	ENSRNOT00000103998.1	UniProtKB/TrEMBL
	ENSRNOT00000108934	ENTREZGENE
	ENSRNOT00000108934.1	UniProtKB/TrEMBL
InterPro	CD3_zeta/IgE_Fc_rcpt_gamma	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	FCER1G	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Phos_immunorcpt_sig_ITAM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25441	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	25441	ENTREZGENE
PANTHER	HIGH AFFINITY IMMUNOGLOBULIN EPSILON RECEPTOR SUBUNIT GAMMA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR16803	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	ITAM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	TCR_zetazeta	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Fcer1g	PhenoGen
PROSITE	ITAM_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	ITAM	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I5YBS0_RAT	UniProtKB/TrEMBL
	A0A8I6AI77	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6ARQ1_RAT	UniProtKB/TrEMBL
	A0A8I6GIE3	ENTREZGENE, UniProtKB/TrEMBL
	A0A8L2QIN1_RAT	UniProtKB/TrEMBL
	B1H251	ENTREZGENE, UniProtKB/TrEMBL
	FCERG_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-11-11	Fcer1g	Fc epsilon receptor Ig	Fcer1g	Fc fragment of IgE receptor Ig	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-01-20	Fcer1g	Fc fragment of IgE receptor Ig	Fcer1g	Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2009-06-15	Fcer1g	Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide	LOC498279	similar to NADH dehydrogenase (ubiquinone) Fe-S protein 2	Data Merged	1643240	APPROVED
2008-09-25	Fcer1g	Fc fragment of IgE, high affinity I, receptor for; gamma polypeptide	Fcer1g	Fc receptor, IgE, high affinity I, gamma polypeptide	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC498279	similar to NADH dehydrogenase (ubiquinone) Fe-S protein 2			Symbol and Name status set to provisional	70820	PROVISIONAL
2002-06-10	Fcer1g	Fc fragment of Ige, high affinity I, receptor for gamma polypeptide			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_physical_interaction	tetrameric complex composed of one alpha subunit, one beta subunit and a dimer of disulphide-linked gamma subunits	728449

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)