Fcer1a (Fc epsilon receptor Ia) - Rat Genome Database

Name: Fcer1a
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Fcer1a (Fc epsilon receptor Ia) Rattus norvegicus

Analyze

Symbol:

Fcer1a

Name:

Fc epsilon receptor Ia (Ensembl:Fc fragment of IgE receptor Ia)

RGD ID:

2597

Description:

Predicted to enable IgE binding activity and high-affinity IgE receptor activity. Predicted to be involved in several processes, including eosinophil degranulation; type 2 immune response; and type I hypersensitivity. Predicted to act upstream of or within several processes, including leukotriene biosynthetic process; positive regulation of immune effector process; and positive regulation of macromolecule metabolic process. Predicted to be located in external side of plasma membrane. Orthologous to human FCER1A (Fc epsilon receptor Ia); PARTICIPATES IN Fc epsilon receptor mediated signaling pathway; asthma pathway; INTERACTS WITH 1,2-dimethylhydrazine; 17alpha-ethynylestradiol; ammonium chloride.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

alpha polypeptide; Fc fragment of Ige high affinity I receptor for alpha polypeptide; Fc fragment of IgE receptor Ia; Fc fragment of IgE, high affinity I, receptor for; Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide; Fc receptor, IgE, high affinity I, alpha polypeptide; fc-epsilon RI-alpha; fcERI; high affinity immunoglobulin epsilon receptor subunit alpha; igE Fc receptor subunit alpha; Iger01; RATIGER01

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FCER1A (Fc epsilon receptor Ia)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Fcer1a (Fc receptor, IgE, high affinity I, alpha polypeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Fcer1a (Fc fragment of IgE receptor Ia)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FCER1A (Fc epsilon receptor Ia)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FCER1A (Fc epsilon receptor Ia)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fcer1a (Fc fragment of IgE receptor Ia)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FCER1A (Fc epsilon receptor Ia)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FCER1A (Fc fragment of IgE receptor Ia)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Fcer1a (Fc fragment of IgE receptor Ia)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Fcer1a (Fc receptor, IgE, high affinity I, alpha polypeptide)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	FCER1A (Fc epsilon receptor Ia)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	zgc:154125	Alliance	DIOPT (Ensembl Compara\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	fcgr1	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	XB5946283 [provisional:fcrl5]	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	XB5960289 [provisional:fcrl4]	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	fcrl3	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	13	85,686,099 - 85,692,394 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	85,686,092 - 85,692,351 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	88,184,100 - 88,190,371 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	13	89,584,404 - 89,590,675 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	13	86,769,081 - 86,775,353 (-)	NCBI	Rnor_WKY
Rnor_6.0	13	91,727,253 - 91,737,106 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	91,730,925 - 91,737,053 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	96,245,261 - 96,251,522 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	89,429,982 - 89,436,507 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	89,618,865 - 89,625,338 (-)	NCBI
Celera	13	85,289,763 - 85,295,958 (-)	NCBI		Celera
RH 3.4 Map	13	566.1	RGD
Cytogenetic Map	13	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

asthma (ISO)

autoimmune interstitial lung, joint, and kidney disease (ISO)

drug allergy (ISO)

Drug Eruptions (ISO)

gastrointestinal stromal tumor (ISO)

genetic disease (ISO)

parathyroid carcinoma (ISO)

rhinitis (ISO)

urticaria (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (EXP,ISO)

17alpha-ethynylestradiol (EXP)

4,4'-diaminodiphenylmethane (ISO)

acetylsalicylic acid (ISO)

ammonium chloride (EXP)

astemizole (EXP)

benzo[a]pyrene (ISO)

bisphenol A (EXP)

butyric acid (ISO)

CGP 52608 (ISO)

disodium selenite (ISO)

flavonoids (EXP)

furan (EXP)

gamma-tocopherol (ISO)

genistein (ISO)

hexachlorobenzene (EXP)

histamine (ISO)

ketorolac (ISO)

N,N,N',N'-tetrakis(2-pyridylmethyl)ethylenediamine (ISO)

N-methyl-N'-nitro-N-nitrosoguanidine (EXP)

resveratrol (ISO)

Ro 31-8220 (ISO)

sarin (ISO)

sodium arsenite (ISO)

tebuconazole (ISO)

tocopherol (ISO)

valproic acid (ISO)

zinc atom (ISO)

zinc sulfate (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

calcium-mediated signaling (ISO)

cell surface receptor signaling pathway (IBA,ISO)

eosinophil degranulation (ISO)

establishment of localization in cell (ISO)

immune response (TAS)

leukotriene biosynthetic process (ISO)

mast cell degranulation (ISO)

peptidyl-tyrosine phosphorylation (ISO)

positive regulation of calcium-mediated signaling (ISO)

positive regulation of granulocyte macrophage colony-stimulating factor production (ISO)

positive regulation of interleukin-3 production (ISO)

positive regulation of JUN kinase activity (ISO)

positive regulation of MAP kinase activity (ISO)

positive regulation of mast cell cytokine production (ISO)

positive regulation of mast cell degranulation (ISO)

positive regulation of peptidyl-tyrosine phosphorylation (ISO)

positive regulation of type I hypersensitivity (ISO)

serotonin secretion (ISO)

signal transduction (ISO)

type 2 immune response (ISO)

type I hypersensitivity (ISO)

Cellular Component

cell surface (ISO)

external side of plasma membrane (ISO)

extracellular region (IEA)

membrane (IEA)

plasma membrane (ISO)

Molecular Function

high-affinity IgE receptor activity (ISO,TAS)

IgE binding (ISO,TAS)

IgE receptor activity (ISO)

protein binding (ISO)

transmembrane signaling receptor activity (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

asthma pathway (IEA)

Fc epsilon receptor mediated signaling pathway (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Mast cell-associated alveolar inflammation in patients with atopic uncontrolled asthma.	Andersson CK, etal., J Allergy Clin Immunol. 2011 Mar 7.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	A cDNA presumptively coding for the alpha subunit of the receptor with high affinity for immunoglobulin E.	Kinet JP, etal., Biochemistry 1987 Jul 28;26(15):4605-10.
5.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
6.	cDNA heterogeneity suggests structural variants related to the high-affinity IgE receptor.	Liu FT, etal., Proc Natl Acad Sci U S A 1988 Aug;85(15):5639-43.
7.	FcepsilonRI levels and frequencies of peripheral blood dendritic cell populations in allergic rhinitis.	Lundberg K, etal., Hum Immunol. 2010 Oct;71(10):931-3. Epub 2010 Jul 30.
8.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
9.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.	Online Mendelian Inheritance in Man, OMIM (TM).	Online Mendelian Inheritance in Man, OMIM (TM).
11.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
12.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
13.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Human and rat mast cell high-affinity immunoglobulin E receptors: characterization of putative alpha-chain gene products.	Shimizu A, etal., Proc Natl Acad Sci U S A 1988 Mar;85(6):1907-11.
16.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
17.	The gene for the rat mast cell high affinity IgE receptor alpha chain. Structure and alternative mRNA splicing patterns.	Tepler I, etal., J Biol Chem 1989 Apr 5;264(10):5912-5.

Additional References at PubMed

PMID:1535625	PMID:2527850	PMID:7506729	PMID:8252632	PMID:9000133	PMID:12192036	PMID:17728245	PMID:18042342	PMID:18243321	PMID:18675457	PMID:20173038	PMID:20643056
PMID:20733205	PMID:21349584	PMID:22417871	PMID:22613973	PMID:22820943	PMID:24497038	PMID:24791697	PMID:25289695	PMID:29029788

Genomics

Comparative Map Data

Fcer1a
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	13	85,686,099 - 85,692,394 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	85,686,092 - 85,692,351 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	88,184,100 - 88,190,371 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	13	89,584,404 - 89,590,675 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	13	86,769,081 - 86,775,353 (-)	NCBI	Rnor_WKY
Rnor_6.0	13	91,727,253 - 91,737,106 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	91,730,925 - 91,737,053 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	96,245,261 - 96,251,522 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	89,429,982 - 89,436,507 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	13	89,618,865 - 89,625,338 (-)	NCBI
Celera	13	85,289,763 - 85,295,958 (-)	NCBI		Celera
RH 3.4 Map	13	566.1	RGD
Cytogenetic Map	13	q24	NCBI

FCER1A
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	159,283,575 - 159,308,202 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	1	159,289,714 - 159,308,224 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	159,253,365 - 159,277,992 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	157,526,128 - 157,544,638 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	156,072,576 - 156,091,086	NCBI
Celera	1	132,329,745 - 132,348,256 (+)	NCBI		Celera
Cytogenetic Map	1	q23.2	NCBI
HuRef	1	130,610,827 - 130,635,025 (+)	NCBI		HuRef
CHM1_1	1	160,649,107 - 160,673,443 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	158,420,606 - 158,445,236 (+)	NCBI		T2T-CHM13v2.0

Fcer1a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	173,048,836 - 173,054,799 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	173,048,851 - 173,054,781 (-)	Ensembl		GRCm39 Ensembl
GRCm38	1	173,221,269 - 173,227,232 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	173,221,284 - 173,227,214 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	175,151,402 - 175,157,360 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	175,057,959 - 175,063,889 (-)	NCBI		MGSCv36	mm8
Celera	1	176,073,170 - 176,079,126 (-)	NCBI		Celera
Cytogenetic Map	1	H3	NCBI
cM Map	1	80.33	NCBI

Fcer1a
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955468	11,094,788 - 11,101,173 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955468	11,094,792 - 11,101,191 (+)	NCBI	ChiLan1.0	ChiLan1.0

FCER1A
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	1	90,282,608 - 90,287,847 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	134,655,230 - 134,660,961 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	138,439,921 - 138,458,258 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	138,439,921 - 138,458,258 (+)	Ensembl	panpan1.1		panPan2

FCER1A
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	38	22,683,478 - 22,688,842 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	38	22,683,477 - 22,690,763 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	38	22,695,550 - 22,700,839 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	38	22,806,067 - 22,811,504 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	38	22,806,065 - 22,811,449 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	38	22,570,794 - 22,576,081 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	38	23,105,066 - 23,110,355 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	38	23,556,483 - 23,561,775 (-)	NCBI		UU_Cfam_GSD_1.0

Fcer1a
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	5,547,639 - 5,553,180 (+)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936740	1,201,370 - 1,206,871 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FCER1A
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	91,118,879 - 91,125,437 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	91,118,867 - 91,125,448 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	99,069,615 - 99,075,656 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FCER1A
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	4,635,316 - 4,640,787 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	4,635,328 - 4,640,590 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	3,775,204 - 3,780,592 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Fcer1a
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624794	2,002,928 - 2,008,940 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624794	2,003,031 - 2,008,930 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Fcer1a
27 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	21
Count of miRNA genes:	21
Interacting mature miRNAs:	21
Transcripts:	ENSRNOT00000058090
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	1	101056920	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	1	101056920	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	101056920	Rat
1581570	Eae17	Experimental allergic encephalomyelitis QTL 17	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	13	8897350	101631289	Rat
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	20605871	101339738	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	30395351	101056920	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	13	31241331	93395974	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	31241331	93395974	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	31241331	93395974	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	31241331	93395974	Rat
12879444	Bp397	Blood pressure QTL 397			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45049404	90049404	Rat
12879471	Bp398	Blood pressure QTL 398			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45514719	90514719	Rat
12879441	Bp396	Blood pressure QTL 396			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45699983	90699983	Rat
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	46088046	91088046	Rat
1641901	Alcrsp6	Alcohol response QTL 6			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	13	52362171	97362171	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	56056920	101056920	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	61825626	106807694	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	65103704	106807694	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	65103704	106807694	Rat
8655945	Rf61	Renal function QTL 61	3.6		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	13	69060519	86800898	Rat
1331783	Bp221	Blood pressure QTL 221	3.72886		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	69060519	86800898	Rat
1300166	Kidm6	Kidney mass QTL 6	3.93		kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	13	69060519	86800898	Rat
8655959	Pur32	Proteinuria QTL 32	8.4		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	74023918	97213863	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	74862117	101339893	Rat
4889606	Gluco63	Glucose level QTL 63	2.86	0.003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	80753256	106807694	Rat
1302791	Stl29	Serum triglyceride level QTL 29	3.3	0.0011	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	13	84730788	86800898	Rat

Markers in Region

D13Wox17

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	85,685,895 - 85,686,118 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	91,730,639 - 91,730,861	NCBI	Rnor6.0
Rnor_5.0	13	96,245,057 - 96,245,279	UniSTS	Rnor5.0
RGSC_v3.4	13	89,429,778 - 89,430,000	UniSTS	RGSC3.4
Celera	13	85,289,559 - 85,289,781	UniSTS
Cytogenetic Map	13	q24	UniSTS

RH94548

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	85,686,160 - 85,686,259 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	91,730,904 - 91,731,002	NCBI	Rnor6.0
Rnor_5.0	13	96,245,322 - 96,245,420	UniSTS	Rnor5.0
RGSC_v3.4	13	89,430,043 - 89,430,141	UniSTS	RGSC3.4
Celera	13	85,289,824 - 85,289,922	UniSTS
RH 3.4 Map	13	566.1	UniSTS
Cytogenetic Map	13	q24	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium
Low	2	7	12	1	15	1	3	3			8	9	3
Below cutoff	1	9	15	11	4	11	5	6	9	6	11	2	5

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012724	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008769780	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008769781	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039090373	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AH003183	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	J03606	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000245	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M17153	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M21622	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M21623	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000058090 ⟹ ENSRNOP00000054898

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	85,686,092 - 85,690,892 (-)	Ensembl
Rnor_6.0 Ensembl	13	91,730,925 - 91,735,361 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000083561 ⟹ ENSRNOP00000069343

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	85,686,092 - 85,692,349 (-)	Ensembl
Rnor_6.0 Ensembl	13	91,731,160 - 91,737,053 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000104245 ⟹ ENSRNOP00000092868

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	85,686,100 - 85,692,351 (-)	Ensembl

RefSeq Acc Id:

NM_012724 ⟹ NP_036856

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	13	85,686,100 - 85,692,351 (-)	NCBI
Rnor_6.0	13	91,730,843 - 91,737,106 (-)	NCBI
Rnor_5.0	13	96,245,261 - 96,251,522 (-)	NCBI
RGSC_v3.4	13	89,429,982 - 89,436,507 (-)	RGD
Celera	13	85,289,763 - 85,295,958 (-)	RGD

Sequence:

show sequence

ACTTTTGAAGCCGTAGCTCACTGGTGCAGTTAGCACCTGAAGGCACAGGGGCAATGGATACTGG
AGGATCTGCCCGGCTGTGCCTAGCATTAGTGCTCATATCTCTGGGTGTCATGCTAACAGCCACT
CAGAAATCTGTAGTGTCCTTGGACCCACCGTGGATTAGAATACTTACAGGAGATAAAGTGACTC
TTATATGCAATGGGAACAATTCCTCTCAAATGAACTCTACTAAATGGATCCACAATGATAGCAT
CTCTAATGTGAAATCGTCACATTGGGTCATTGTGAGTGCCACCATTCAAGACAGTGGAAAATAC
ATATGTCAGAAGCAAGGATTTTATAAGAGCAAACCTGTGTACTTGAACGTGATGCAAGAGTGGC
TGCTGCTCCAATCTTCTGCTGACGTGGTCTTAGACAATGGATCCTTTGACATCAGATGCCGTAG
CTGGAAGAAATGGAAAGTCCACAAGGTGATCTACTACAAGGACGACATTGCTTTCAAGTACTCT
TATGACAGCAACAACATCTCCATTAGAAAGGCCACATTTAATGACAGTGGCAGCTACCACTGCA
CAGGCTATTTGAACAAGGTTGAATGTAAATCTGATAAATTCAGTATTGCTGTAGTAAAAGATTA
CACAATTGAGTATCGTTGGCTACAACTCATTTTCCCATCATTGGCGGTGATTCTGTTTGCTGTG
GACACTGGGTTATGGTTCTCAACCCACAAACAGTTCGAATCCATCTTGAAGATTCAGAAGACTG
GAAAAGGCAAAAAAAAAGGTTGAAACCTAACTCTTAACCAAGGTATATAAAGGAACTAATGTCA
TCGCTTAAGAGACAATTCTTAACAATTATTTCCCACAGTATCTTCAATAGCCTTTCAACTGTCA
AAGGACACTCATGTTATCCATAGAAATGTCTGTACCCCAGGAATTGCATAAATGCTTCATTAAA
CCAACAGCAGCTGGTTAAGTGACATGCAATAAATAACAAATACTCAATAAACACTGGTTTAAGA
AGTTAAAGAATGAGCTGATTGCTTTGTCTATATCTGTAAAAGAGAAGTACAATTTGAATAAAGT
ATGGAATCATGTAGAATGGT

hide sequence

RefSeq Acc Id:

XM_039090373 ⟹ XP_038946301

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	13	85,686,099 - 85,692,394 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_036856	(Get FASTA)	NCBI Sequence Viewer
	XP_038946301	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41146	(Get FASTA)	NCBI Sequence Viewer
	AAA41147	(Get FASTA)	NCBI Sequence Viewer
	AAA41582	(Get FASTA)	NCBI Sequence Viewer
	AAA42045	(Get FASTA)	NCBI Sequence Viewer
	AAA74562	(Get FASTA)	NCBI Sequence Viewer
	EDL94735	(Get FASTA)	NCBI Sequence Viewer
	EDL94736	(Get FASTA)	NCBI Sequence Viewer
	EDL94737	(Get FASTA)	NCBI Sequence Viewer
	P12371	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_036856 ⟸ NM_012724
- Peptide Label:	precursor
- UniProtKB:	P12840 (UniProtKB/Swiss-Prot), P12371 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MDTGGSARLCLALVLISLGVMLTATQKSVVSLDPPWIRILTGDKVTLICNGNNSSQMNSTKWIH NDSISNVKSSHWVIVSATIQDSGKYICQKQGFYKSKPVYLNVMQEWLLLQSSADVVLDNGSFDI RCRSWKKWKVHKVIYYKDDIAFKYSYDSNNISIRKATFNDSGSYHCTGYLNKVECKSDKFSIAV VKDYTIEYRWLQLIFPSLAVILFAVDTGLWFSTHKQFESILKIQKTGKGKKKG hide sequence

RefSeq Acc Id:

ENSRNOP00000054898 ⟸ ENSRNOT00000058090

RefSeq Acc Id:

ENSRNOP00000069343 ⟸ ENSRNOT00000083561

RefSeq Acc Id:	XP_038946301 ⟸ XM_039090373
- Peptide Label:	isoform X1
- UniProtKB:	A0A0G2JV43 (UniProtKB/TrEMBL)

RefSeq Acc Id:

ENSRNOP00000092868 ⟸ ENSRNOT00000104245

Protein Domains

Ig-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P12371-F1-model_v2	AlphaFold	P12371	1-245	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2597	AgrOrtholog
BioCyc Gene	G2FUF-17280	BioCyc
Ensembl Genes	ENSRNOG00000009177	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000054898.5	UniProtKB/TrEMBL
	ENSRNOP00000069343	ENTREZGENE
	ENSRNOP00000069343.2	UniProtKB/TrEMBL
	ENSRNOP00000092868	ENTREZGENE
	ENSRNOP00000092868.1	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000058090.5	UniProtKB/TrEMBL
	ENSRNOT00000083561	ENTREZGENE
	ENSRNOT00000083561.2	UniProtKB/TrEMBL
	ENSRNOT00000104245	ENTREZGENE
	ENSRNOT00000104245.1	UniProtKB/Swiss-Prot
Gene3D-CATH	2.60.40.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	Ig-like_dom	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig-like_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig-like_fold	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Ig_sub	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25047	UniProtKB/Swiss-Prot
NCBI Gene	25047	ENTREZGENE
PANTHER	HIGH AFFINITY IMMUNOGLOBULIN EPSILON RECEPTOR SUBUNIT ALPHA	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	IMMUNOGLOBULIN FC RECEPTOR	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Ig_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Fcer1a	PhenoGen
PROSITE	IG_LIKE	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	SM00409	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF48726	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
TIGR	TC238566
UniProt	A0A0G2JV43	ENTREZGENE, UniProtKB/TrEMBL
	F1LSQ5_RAT	UniProtKB/TrEMBL
	FCERA_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	P12840	ENTREZGENE
UniProt Secondary	P12840	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-11-11	Fcer1a	Fc epsilon receptor Ia	Fcer1a	Fc fragment of IgE receptor Ia	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-01-20	Fcer1a	Fc fragment of IgE receptor Ia	Fcer1a	Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-25	Fcer1a	Fc fragment of IgE, high affinity I, receptor for; alpha polypeptide	Fcer1a	Fc receptor, IgE, high affinity I, alpha polypeptide	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Fcer1a	Fc fragment of Ige, high affinity I, receptor for, alpha polypeptide			Symbol and Name status set to approved	70586	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)