Fabp1 (fatty acid binding protein 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Fabp1 (fatty acid binding protein 1) Rattus norvegicus

Analyze

Symbol:

Fabp1

Name:

fatty acid binding protein 1

RGD ID:

2590

Description:

Enables several functions, including long-chain fatty acid transporter activity; monocarboxylic acid binding activity; and phospholipid binding activity. Involved in intestinal absorption; long-chain fatty acid transport; and positive regulation of fatty acid beta-oxidation. Located in apical cortex and peroxisomal matrix. Part of protein-containing complex. Orthologous to human FABP1 (fatty acid binding protein 1); PARTICIPATES IN eicosanoid signaling pathway via peroxisome proliferator-activated receptor gamma; INTERACTS WITH (+)-schisandrin B; 1,2-dimethylhydrazine; 1-naphthyl isothiocyanate.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Fabplg; Fatty acid binding protein 1 liver; fatty acid binding protein 1, liver; fatty acid-binding protein 1; fatty acid-binding protein, liver; fatty-acid-binding protein; L-FABP; liver-type fatty acid-binding protein; MGC108756; p14; RATFABPLG; SCP; SCP.; squalene- and sterol-carrier protein; Z-protein

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	FABP1 (fatty acid binding protein 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Fabp1 (fatty acid binding protein 1, liver)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	FABP1 (fatty acid binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	FABP1 (fatty acid binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Fabp1 (fatty acid binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	FABP1 (fatty acid binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	FABP1 (fatty acid binding protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Fabp1 (fatty acid binding protein 1, liver)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	FABP1 (fatty acid binding protein 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	fabp1b.1 (fatty acid binding protein 1b, tandem duplicate 1)	Alliance	DIOPT (Hieranoid\|OMA\|OrthoInspector\|PANTHER)
Danio rerio (zebrafish):	fabp1a (fatty acid binding protein 1a, liver)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	fabp1	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Is Marker For:

Strains: BB.WOKW-(D4Got41-Fabp1)/K
QTLs: Bw53

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	103,191,015 - 103,194,791 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	103,191,006 - 103,194,788 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	108,579,494 - 108,583,270 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	104,354,593 - 104,358,369 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	102,960,918 - 102,964,694 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	99,063,181 - 99,066,957 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	99,063,181 - 99,066,954 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	163,840,329 - 163,844,105 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	104,412,200 - 104,415,981 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	104,656,680 - 104,660,462 (+)	NCBI
Celera	4	92,366,948 - 92,370,724 (+)	NCBI		Celera
Cytogenetic Map	4	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acute kidney tubular necrosis (ISO)

Acute Liver Failure (ISO)

end stage renal disease (IEP,ISO)

fatty liver disease (ISO)

genetic disease (ISO)

hypertension (ISO)

IgA glomerulonephritis (ISO)

lipid storage disease (ISO)

obesity (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

1,2-dimethylhydrazine (EXP,ISO)

1-[(4-chlorophenyl)-phenylmethyl]-4-methylpiperazine (ISO)

1-[3-(dimethylamino)propyl]-1-(4-fluorophenyl)-1,3-dihydro-2-benzofuran-5-carbonitrile (ISO)

1-chloro-2,4-dinitrobenzene (ISO)

1-naphthyl isothiocyanate (EXP)

11-hydroxy-Delta(9)-tetrahydrocannabinol (EXP,ISO)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (EXP,ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-arachidonoylglycerol (ISO)

2-oleoylglycerol (ISO)

3,3',4,4',5-pentachlorobiphenyl (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO)

5-Hydroxythalidomide (ISO)

6-(4-chlorophenyl)imidazo[2,1-b][1,3]thiazole-5-carbaldehyde O-(3,4-dichlorobenzyl)oxime (ISO)

8-Br-cAMP (ISO)

acetamide (EXP)

aflatoxin B1 (ISO)

aldehydo-D-glucose (ISO)

amiodarone (ISO)

amitriptyline (ISO)

ammonium chloride (EXP)

anandamide (EXP,ISO)

anthracen-2-amine (EXP)

arotinoid acid (ISO)

azathioprine (ISO)

belinostat (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

benzylpenicillin (ISO)

bexarotene (EXP)

bezafibrate (EXP,ISO)

bis(2-ethylhexyl) phthalate (EXP,ISO)

bisphenol A (EXP,ISO)

bosentan (ISO)

bromobenzene (EXP)

buta-1,3-diene (ISO)

cadmium atom (ISO)

cadmium dichloride (EXP,ISO)

cannabidiol (ISO)

captan (ISO)

carbon nanotube (ISO)

carnosic acid (ISO)

CHIR 99021 (ISO)

chloroform (EXP)

chloroprene (ISO)

chlorothalonil (ISO)

chlorpromazine (ISO)

cholesterol (EXP)

choline (ISO)

ciglitazone (ISO)

ciprofibrate (EXP,ISO)

cisplatin (EXP,ISO)

citalopram (ISO)

clofibrate (EXP,ISO)

Clofop (ISO)

clomipramine (ISO)

clozapine (ISO)

cobalt dichloride (EXP,ISO)

copper(II) sulfate (ISO)

corn oil (EXP)

cortisol (ISO)

cyclosporin A (EXP,ISO)

cylindrospermopsin (ISO)

D-glucose (ISO)

DAUDA (ISO)

dehydroepiandrosterone sulfate (ISO)

dexamethasone (EXP)

dibenz[a,h]anthracene (ISO)

dibenzo[a,l]pyrene (ISO)

dichlorine (EXP)

dichloroacetic acid (ISO)

diclofenac (ISO)

dicoumarol (EXP)

dicrotophos (ISO)

diethyl maleate (EXP)

difenoconazole (ISO)

dimethylarsinic acid (ISO)

dioxygen (ISO)

dipentyl phthalate (EXP)

diquat (ISO)

doxepin (ISO)

entinostat (ISO)

erythromycin A (ISO)

erythromycin estolate (EXP)

ethanol (EXP,ISO)

farnesol (ISO)

fenofibrate (EXP,ISO)

flecainide (ISO)

fluoranthene (ISO)

fluoxetine (ISO)

folic acid (ISO)

folpet (ISO)

fumonisin B1 (ISO)

furan (EXP)

genistein (ISO)

glucose (ISO)

glyphosate (ISO)

griseofulvin (ISO)

GW 4064 (ISO)

GW 501516 (ISO)

GW 7647 (EXP,ISO)

hexadecanoic acid (ISO)

hydrazine (EXP)

hydrogen peroxide (ISO)

imipramine (ISO)

indometacin (EXP)

irinotecan (EXP)

ketoconazole (EXP,ISO)

L-ascorbic acid (ISO)

L-ascorbic acid 2-phosphate (ISO)

L-methionine (ISO)

Lasiocarpine (ISO)

linalool (ISO)

linoleic acid (ISO)

lipopolysaccharide (ISO)

loratadine (ISO)

LY294002 (ISO)

menadione (ISO)

methapyrilene (EXP,ISO)

methotrexate (EXP,ISO)

methylarsonic acid (ISO)

methylmercury chloride (ISO)

microcystin-LR (ISO)

Muraglitazar (EXP)

N-nitrosodiethylamine (EXP)

N-nitrosodimethylamine (ISO)

N-nitrosomorpholine (EXP)

N-Nitrosopyrrolidine (ISO)

nickel dichloride (EXP)

nicotinamide (EXP)

nicotinic acid (EXP)

nitrofen (EXP)

Nor-9-carboxy-delta9-THC (EXP,ISO)

O-methyleugenol (ISO)

olanzapine (ISO)

oleic acid (EXP,ISO)

orlistat (ISO)

ozone (EXP,ISO)

paclitaxel (ISO)

paracetamol (EXP,ISO)

pentamidine (ISO)

perflubutane (ISO)

perfluorobutyric acid (ISO)

perfluorodecanoic acid (ISO)

perfluorododecanoic acid (ISO)

perfluoroheptanoic acid (ISO)

perfluorohexanesulfonic acid (ISO)

perfluorohexanoic acid (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (EXP,ISO)

perfluorooctanoic acid (EXP,ISO)

perfluoropentanoic acid (ISO)

perfluoroundecanoic acid (ISO)

perhexiline (ISO)

phenobarbital (EXP)

phytanic acid (ISO)

pirinixic acid (EXP,ISO)

potassium dichromate (ISO)

pravastatin (ISO)

pregnenolone 16alpha-carbonitrile (ISO)

procymidone (ISO)

Propiverine (EXP)

pyrazinecarboxamide (EXP)

quercetin (ISO)

quinidine (ISO)

rotenone (EXP)

sarpogrelate (ISO)

SB 431542 (ISO)

sertraline (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenate (ISO)

sodium arsenite (ISO)

sodium cholate (EXP)

sodium dichromate (EXP,ISO)

spermine (ISO)

sulindac sulfide (ISO)

tamoxifen (EXP,ISO)

Tesaglitazar (EXP,ISO)

tetrachloroethene (ISO)

tetrachloromethane (EXP)

tetracycline (EXP,ISO)

tetraphene (ISO)

theophylline (EXP)

thioacetamide (EXP)

thioridazine (ISO)

titanium dioxide (ISO)

toluene 2,4-diisocyanate (ISO)

trichloroethene (ISO)

trimellitic anhydride (ISO)

Triptolide (ISO)

troglitazone (EXP,ISO)

urethane (ISO)

valproic acid (EXP,ISO)

warfarin (EXP)

XAV939 (ISO)

zaragozic acid A (EXP,ISO)

zearalenone (ISO)

zimeldine (ISO)

zinc atom (EXP,ISO)

zinc dichloride (ISO)

zinc(0) (EXP,ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cellular oxidant detoxification (IEA)

cellular response to hydrogen peroxide (ISO)

cellular response to hypoxia (ISO)

fatty acid transport (IBA)

intestinal absorption (IDA)

long-chain fatty acid transport (IMP)

lysophospholipid transport (IEA)

negative regulation of apoptotic process (ISO)

positive regulation of fatty acid beta-oxidation (IDA)

positive regulation of hydrolase activity (IDA)

response to vitamin B3 (IEP)

Cellular Component

apical cortex (IDA)

cytoplasm (ISO)

cytosol (IBA,ISO)

nucleoplasm (IEA,ISO)

nucleus (IBA,ISO)

peroxisomal matrix (IDA)

protein-containing complex (IDA)

Molecular Function

antioxidant activity (ISO)

bile acid binding (IMP)

chromatin binding (ISO)

fatty acid binding (IBA,IDA,IPI)

heterocyclic compound binding (IDA,IPI)

long-chain fatty acid transporter activity (IMP)

lysophospholipid:sodium symporter activity (IC)

oleic acid binding (IPI)

phospholipid binding (IMP)

protein binding (IPI,ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

eicosanoid signaling pathway via peroxisome proliferator-activated receptor gamma (IEA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

enhanced liver regeneration (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	Intestinal fatty acid binding protein may favor differential apical fatty acid binding in the intestine.	Alpers DH, etal., Biochim Biophys Acta. 2000 Jan 31;1483(3):352-62.
2.	Localization of a portion of the liver isoform of fatty-acid-binding protein (L-FABP) to peroxisomes.	Antonenkov VD, etal., Biochem J. 2006 Mar 1;394(Pt 2):475-84.
3.	Liver fatty acid binding protein is the mitosis-associated polypeptide target of a carcinogen in rat hepatocytes.	Bassuk JA, etal., Proc Natl Acad Sci U S A 1987 Nov;84(21):7547-51.
4.	Niacin improves renal lipid metabolism and slows progression in chronic kidney disease.	Cho KH, etal., Biochim Biophys Acta. 2010 Jan;1800(1):6-15. Epub 2009 Oct 28.
5.	The alpha-helical domain of liver fatty acid binding protein is responsible for the diffusion-mediated transfer of fatty acids to phospholipid membranes.	Corsico B, etal., Biochemistry. 2004 Mar 30;43(12):3600-7.
6.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
8.	Analyzing the structures, functions and evolution of two abundant gastrointestinal fatty acid binding proteins with recombinant DNA and computational techniques.	Gordon JI and Lowe JB, Chem Phys Lipids 1985 Aug 30;38(1-2):137-58.
9.	The nucleotide sequence of rat liver fatty acid binding protein mRNA.	Gordon JI, etal., J Biol Chem 1983 Mar 10;258(5):3356-63.
10.	The effect of charge reversal mutations in the alpha-helical region of liver fatty acid binding protein on the binding of fatty-acyl CoAs, lysophospholipids and bile acids.	Hagan RM, etal., Mol Cell Biochem. 2002 Oct;239(1-2):55-60.
11.	Urinary excretion of liver fatty acid-binding protein in health-check participants.	Ishimitsu T, etal., Clin Exp Nephrol. 2005 Mar;9(1):34-9.
12.	Translational control of the circadian rhythm of liver sterol carrier protein. Analysis of mRNA sequences with a specific cDNA probe.	McGuire DM, etal., J Biol Chem 1985 May 10;260(9):5435-9.
13.	Liver-type fatty acid binding protein interacts with hepatocyte nuclear factor 4alpha.	McIntosh AL, etal., FEBS Lett. 2013 Nov 29;587(23):3787-91. doi: 10.1016/j.febslet.2013.09.043. Epub 2013 Oct 15.
14.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
15.	Identification by photoaffinity labeling of fatty acid-binding protein as a potential warfarin receptor in rat liver.	Myszka DG and Swenson RP, J Biol Chem. 1991 Nov 5;266(31):20725-31.
16.	Urinary liver-type fatty acid-binding protein: discrimination between IgA nephropathy and thin basement membrane nephropathy.	Nakamura T, etal., Am J Nephrol. 2005 Sep-Oct;25(5):447-50. Epub 2005 Aug 23.
17.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
18.	Protection against Western diet-induced obesity and hepatic steatosis in liver fatty acid-binding protein knockout mice.	Newberry EP, etal., Hepatology. 2006 Nov;44(5):1191-205.
19.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
20.	GOA pipeline	RGD automated data pipeline
21.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
22.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
23.	Phosphorylation of Sar1b protein releases liver fatty acid-binding protein from multiprotein complex in intestinal cytosol enabling it to bind to endoplasmic reticulum (ER) and bud the pre-chylomicron transport vesicle.	Siddiqi S and Mansbach CM 2nd, J Biol Chem. 2012 Mar 23;287(13):10178-88. doi: 10.1074/jbc.M111.327247. Epub 2012 Feb 1.
24.	The nucleotide sequence of the rat liver fatty acid-binding protein gene. Evidence that exon 1 encodes an oligopeptide domain shared by a family of proteins which bind hydrophobic ligands.	Sweetser DA, etal., J Biol Chem 1986 Apr 25;261(12):5553-61.
25.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
26.	The crystal structure of the liver fatty acid-binding protein. A complex with two bound oleates.	Thompson J, etal., J Biol Chem. 1997 Mar 14;272(11):7140-50.
27.	Enhanced expression of cytosolic fatty acid binding protein and fatty acid uptake during liver regeneration in rats.	Wang G, etal., Mol Cell Biochem. 2004 Jul;262(1-2):41-9.

Additional References at PubMed

PMID:1898328	PMID:6641731	PMID:7084456	PMID:8117116	PMID:12477932	PMID:15489334	PMID:15522233	PMID:16175609	PMID:16396499	PMID:16603485	PMID:16940177	PMID:16950764
PMID:17272516	PMID:17449472	PMID:17551764	PMID:17927211	PMID:19056867	PMID:20628144	PMID:21102658	PMID:21226535	PMID:23376485	PMID:23533145	PMID:23658011	PMID:27117865
PMID:32405506	PMID:37076661

Genomics

Comparative Map Data

Fabp1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	4	103,191,015 - 103,194,791 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	4	103,191,006 - 103,194,788 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	4	108,579,494 - 108,583,270 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	4	104,354,593 - 104,358,369 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	4	102,960,918 - 102,964,694 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	4	99,063,181 - 99,066,957 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	4	99,063,181 - 99,066,954 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	4	163,840,329 - 163,844,105 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	4	104,412,200 - 104,415,981 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	4	104,656,680 - 104,660,462 (+)	NCBI
Celera	4	92,366,948 - 92,370,724 (+)	NCBI		Celera
Cytogenetic Map	4	q32	NCBI

FABP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	88,122,982 - 88,128,062 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	2	88,122,982 - 88,128,062 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	88,422,501 - 88,427,581 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	88,203,625 - 88,208,693 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	2	88,261,771 - 88,266,840	NCBI
Celera	2	88,358,422 - 88,363,490 (+)	NCBI		Celera
Cytogenetic Map	2	p11.2	NCBI
HuRef	2	87,344,752 - 87,349,901 (-)	NCBI		HuRef
CHM1_1	2	88,351,787 - 88,356,936 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	88,134,227 - 88,181,784 (-)	NCBI		T2T-CHM13v2.0

Fabp1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	71,176,863 - 71,182,018 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	71,176,811 - 71,182,007 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	71,199,879 - 71,205,034 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	71,199,827 - 71,205,023 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	71,149,882 - 71,155,017 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	71,129,467 - 71,134,602 (+)	NCBI		MGSCv36	mm8
Celera	6	73,279,169 - 73,284,304 (+)	NCBI		Celera
Cytogenetic Map	6	C1	NCBI
cM Map	6	32.14	NCBI

FABP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	2A	39,134,991 - 39,182,472 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	2A	87,256,032 - 87,303,505 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	2A	89,165,308 - 89,170,448 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	89,165,315 - 89,170,448 (-)	Ensembl	panpan1.1		panPan2

FABP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	38,242,119 - 38,247,969 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	38,242,119 - 38,247,962 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	37,927,199 - 37,933,049 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	38,974,817 - 38,980,672 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	38,974,817 - 38,980,665 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	17	38,141,305 - 38,147,138 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	17	38,177,707 - 38,183,562 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	38,525,592 - 38,531,443 (+)	NCBI		UU_Cfam_GSD_1.0

Fabp1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	80,115,372 - 80,120,099 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936712	738,348 - 743,955 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936712	738,361 - 743,073 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

FABP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	57,850,499 - 57,854,956 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	57,850,511 - 57,854,966 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	60,622,675 - 60,627,082 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

FABP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	18,660,058 - 18,666,730 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	18,659,836 - 18,667,127 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666080	1,109,470 - 1,116,478 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in Fabp1
18 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	70
Count of miRNA genes:	59
Interacting mature miRNAs:	63
Transcripts:	ENSRNOT00000008840
Prediction methods:	Microtar, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2303168	Bp330	Blood pressure QTL 330	4.25	0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	5214602	146446691	Rat
2316958	Gluco58	Glucose level QTL 58	10		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	11320076	180699135	Rat
12798520	Anxrr55	Anxiety related response QTL 55	4.45	0.01	locomotor behavior trait (VT:0001392)	number of rearing movements with lid-pushing in an experimental apparatus (CMO:0002715)	4	32583980	114627242	Rat
8655961	Kidm43	Kidney mass QTL 43	18		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	4	36303261	103194984	Rat
1358352	Srcrt3	Stress Responsive Cort QTL 3	2.29		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	38465774	146803430	Rat
1300139	Hrtrt6	Heart rate QTL 6	2.85		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	4	39524264	116179656	Rat
1576305	Emca6	Estrogen-induced mammary cancer QTL 6	5.8		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	4	44463720	155883716	Rat
1354612	Foco1	Food consumption QTL 1	8.87		eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	4	44463908	148090542	Rat
1354660	Salc1	Saline consumption QTL 1	11.26		drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	4	44463908	148090542	Rat
2312567	Glom19	Glomerulus QTL 19	1.9	0.006	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	4	45456990	146803430	Rat
1298082	Stresp4	Stress response QTL 4			blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	4	50119848	146803430	Rat
70200	Alc18	Alcohol consumption QTL 18	9.2		drinking behavior trait (VT:0001422)	ethanol intake volume to total fluid intake volume ratio (CMO:0001591)	4	56647873	149491524	Rat
1641833	Alc21	Alcohol consumption QTL 21	8.6	0.0001	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	56698790	126192555	Rat
738009	Sach4	Saccharine consumption QTL 4	4.9	0.000016	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	4	59948935	154902892	Rat
738016	Alc16	Alcohol consumption QTL 16	3.6	0.00015	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
738031	Alc14	Alcohol consumption QTL 14	7.6	0.00003	consumption behavior trait (VT:0002069)	ethanol drink intake rate to body weight ratio (CMO:0001616)	4	59948935	154902892	Rat
1578657	Bss12	Bone structure and strength QTL 12	8.9		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	4	60220938	105220938	Rat
1578658	Bss13	Bone structure and strength QTL 13	8		femur strength trait (VT:0010010)	femoral neck polar moment of inertia (CMO:0001670)	4	60220938	105220938	Rat
2300179	Bmd50	Bone mineral density QTL 50	5.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	4	60928534	105928534	Rat
1549843	Bw53	Body weight QTL 53		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	61697658	103194791	Rat
1549839	Bw52	Body weight QTL 52		0.0001	body mass (VT:0001259)	body weight gain (CMO:0000420)	4	61697658	115089733	Rat
61418	Pia5	Pristane induced arthritis QTL 5	4.5		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	62277855	128289560	Rat
6478743	Anxrr40	Anxiety related response QTL 40		0.83076	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
6478772	Anxrr49	Anxiety related response QTL 49		0.15488	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
6478684	Anxrr30	Anxiety related response QTL 30		0.00087	defecation behavior trait (VT:0010462)	defecation rate (CMO:0000998)	4	62753847	107753847	Rat
631651	Bp124	Blood pressure QTL 124	3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	62879517	107879517	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	percent change in mean arterial blood pressure (CMO:0002035)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	percent change in systolic blood pressure (CMO:0000747)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in pulse pressure (CMO:0001882)	4	62933508	114921294	Rat
70192	BpQTLcluster5	Blood pressure QTL cluster 5	4.183		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	4	62933508	114921294	Rat
631674	Iddm14	Insulin dependent diabetes mellitus QTL 14			blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	4	64528739	157573521	Rat
61330	Eau1	Experimental allergic uveoretinitis QTL 1		0.0003	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	4	70362013	132642728	Rat
634344	Hcar7	Hepatocarcinoma resistance QTL 7	7.8		liver integrity trait (VT:0010547)	liver tumorous lesion area to total liver area ratio (CMO:0001075)	4	70808386	115808386	Rat
634344	Hcar7	Hepatocarcinoma resistance QTL 7	7.8		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	4	70808386	115808386	Rat
631646	Stl4	Serum triglyceride level QTL 4	6.5	0.0001	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	4	73169846	132642728	Rat
724522	Bp146	Blood pressure QTL 146	2.2	0.0021	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	73630210	118630210	Rat
2302051	Pia28	Pristane induced arthritis QTL 28	5.3	0.001	blood autoantibody amount (VT:0003725)	serum immunoglobulin G-type rheumatoid factor level relative to an arbitrary reference serum (CMO:0002112)	4	73630210	118630210	Rat
70167	Bw22	Body weight QTL 22	3.1		body mass (VT:0001259)	body weight (CMO:0000012)	4	76647384	117676292	Rat
1357342	Bw40	Body weight QTL 40		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	4	76647384	117676292	Rat
631662	Hcar2	Hepatocarcinoma resistance QTL 2	3.1	0.0003	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	4	78878504	123878504	Rat
631556	Bp135	Blood pressure QTL 135		0.017	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	4	78881294	117676292	Rat
738015	Pia9	Pristane induced arthritis QTL 9	4.5	0.048	joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	80694870	125694870	Rat
2306899	Bp338	Blood pressure QTL 338		0.071	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	4	81006124	120102625	Rat
1641919	Alc22	Alcohol consumption QTL 22		0.0005	drinking behavior trait (VT:0001422)	ethanol drink intake rate (CMO:0001407)	4	81192555	126192555	Rat
70177	Xhs1	X-ray hypersensitivity QTL 1	25.1		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	82798864	152731274	Rat
1576316	Ept5	Estrogen-induced pituitary tumorigenesis QTL 5	3.8		pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	4	83428419	177635233	Rat
634334	Xhs3	X-ray hypersensitivity QTL 3	10		intestine integrity trait (VT:0010554)	post-insult time to onset of moribundity (CMO:0001896)	4	84728680	129854654	Rat
1582232	Gluco25	Glucose level QTL 25	3.6	0.0023	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	4	85253748	148090731	Rat
12798523	Anxrr56	Anxiety related response QTL 56	2.83	0.05	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	4	85253748	150276390	Rat
1358202	Gluco11	Glucose level QTL 11	2.4	0.02	adipocyte glucose uptake trait (VT:0004185)	absolute change in adipocyte glucose uptake (CMO:0000873)	4	85379421	167139601	Rat
61476	Aia3	Adjuvant induced arthritis QTL 3	3.9		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	86730991	131730991	Rat
1578662	Bss15	Bone structure and strength QTL 15	19.6		femur width (VT:1000666)	femoral neck width (CMO:0001695)	4	87327165	132327165	Rat
1578670	Bss14	Bone structure and strength QTL 14	16.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	4	87327165	132327165	Rat
2317587	Eae26	Experimental allergic encephalomyelitis QTL 26			nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis severity score (CMO:0001419)	4	88656681	103194984	Rat
1578655	Bmd11	Bone mineral density QTL 11	11		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	4	90850165	135850165	Rat
634335	Anxrr16	Anxiety related response QTL 16	7.22		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	4	93308457	167139447	Rat
631689	Scl4	Serum cholesterol level QTL 4	1.9	0.008	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	4	95174120	140174120	Rat
8662350	Eae35	Experimental allergic encephalomyelitis QTL 35	6.2		blood tumor necrosis factor amount (VT:0008552)	inflammatory exudate tumor necrosis factor level (CMO:0001435)	4	100834579	103761084	Rat
61434	Cia3	Collagen induced arthritis QTL 3	4.8		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	4	103194656	148194656	Rat

Markers in Region

D4Mit12

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	103,194,805 - 103,194,984 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	99,066,972 - 99,067,150	NCBI	Rnor6.0
Rnor_5.0	4	163,844,120 - 163,844,298	UniSTS	Rnor5.0
RGSC_v3.4	4	104,415,992 - 104,416,171	RGD	RGSC3.4
RGSC_v3.4	4	104,415,993 - 104,416,171	UniSTS	RGSC3.4
RGSC_v3.1	4	104,660,473 - 104,660,652	RGD
Celera	4	92,370,739 - 92,370,917	UniSTS
SHRSP x BN Map	4	48.75	UniSTS
SHRSP x BN Map	4	48.75	RGD
FHH x ACI Map	4	60.18	RGD
Cytogenetic Map	4	q32	UniSTS

D4Wox20

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	103,194,798 - 103,194,942 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	99,066,965 - 99,067,108	NCBI	Rnor6.0
Rnor_5.0	4	163,844,113 - 163,844,256	UniSTS	Rnor5.0
RGSC_v3.4	4	104,415,985 - 104,416,129	RGD	RGSC3.4
RGSC_v3.4	4	104,415,986 - 104,416,129	UniSTS	RGSC3.4
Celera	4	92,370,732 - 92,370,875	UniSTS
Cytogenetic Map	4	q32	UniSTS

D4Arb21

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	4	103,194,656 - 103,194,936 (+)	MAPPER	mRatBN7.2
Rnor_6.0	4	99,066,823 - 99,067,102	NCBI	Rnor6.0
Rnor_5.0	4	163,843,971 - 163,844,250	UniSTS	Rnor5.0
RGSC_v3.4	4	104,415,843 - 104,416,123	RGD	RGSC3.4
RGSC_v3.4	4	104,415,844 - 104,416,123	UniSTS	RGSC3.4
RGSC_v3.1	4	104,660,324 - 104,660,604	RGD
Celera	4	92,370,590 - 92,370,869	UniSTS
Cytogenetic Map	4	q32	UniSTS

Related Rat Strains

The following Strains have been annotated to Fabp1

BB.WOKW-(D4Got41-Fabp1)/K

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High	1		23	23		23
Medium	2	1	16	14		14	3	3	2	1	3	3	3
Low		9	18	4	17	4	5	8	13	15	18	5	5
Below cutoff		7			1				4	15	8	1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012556	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC120448	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC086947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473957	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209859	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209983	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ210522	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211310	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ211342	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000148	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M10951	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M13501	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M17899	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	M35991	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	V01235	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000008840 ⟹ ENSRNOP00000008841

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	4	103,191,006 - 103,194,788 (+)	Ensembl
Rnor_6.0 Ensembl	4	99,063,181 - 99,066,954 (+)	Ensembl

RefSeq Acc Id:

NM_012556 ⟹ NP_036688

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	4	103,191,015 - 103,194,791 (+)	NCBI
Rnor_6.0	4	99,063,181 - 99,066,957 (+)	NCBI
Rnor_5.0	4	163,840,329 - 163,844,105 (+)	NCBI
RGSC_v3.4	4	104,412,200 - 104,415,981 (+)	RGD
Celera	4	92,366,948 - 92,370,724 (+)	NCBI

Sequence:

show sequence

GTTGTGGTCAGCTGTGGAAAGGAAACCTCATTGCCACCATGAACTTCTCCGGCAAGTACCAAGT
GCAGAGCCAAGAGAACTTTGAGCCCTTCATGAAGGCGATGGGTCTGCCTGAGGACCTCATCCAG
AAAGGGAAGGACATCAAGGGGGTGTCAGAAATCGTGCATGAAGGGAAGAAAGTCAAACTCACCA
TCACCTATGGGTCCAAGGTGATCCACAATGAGTTCACCTTGGGGGAGGAGTGCGAACTGGAGAC
CATGACTGGGGAAAAGGTCAAGGCAGTGGTTAAGATGGAGGGTGACAATAAAATGGTGACAACT
TTCAAAGGCATAAAGTCCGTGACTGAATTCAATGGAGACACAATCACCAATACCATGACACTGG
GTGACATCGTCTACAAGAGAGTCAGCAAGAGAATTTAGACAAGGCTGTATTTCATATTCTTTTA
CAGTATAAAATTAATACAATAAAGTTACCTCTGTTTTGAAAAAAAAAAAAAAAAAAAAAAAAAA
AAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_036688	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA41134	(Get FASTA)	NCBI Sequence Viewer
	AAA41135	(Get FASTA)	NCBI Sequence Viewer
	AAA41140	(Get FASTA)	NCBI Sequence Viewer
	AAA42119	(Get FASTA)	NCBI Sequence Viewer
	AAH86947	(Get FASTA)	NCBI Sequence Viewer
	CAA24545	(Get FASTA)	NCBI Sequence Viewer
	EDL90984	(Get FASTA)	NCBI Sequence Viewer
	P02692	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_036688 ⟸ NM_012556
- UniProtKB:	P02692 (UniProtKB/Swiss-Prot), A6IA66 (UniProtKB/TrEMBL)
- Sequence:	show sequence MNFSGKYQVQSQENFEPFMKAMGLPEDLIQKGKDIKGVSEIVHEGKKVKLTITYGSKVIHNEFT LGEECELETMTGEKVKAVVKMEGDNKMVTTFKGIKSVTEFNGDTITNTMTLGDIVYKRVSKRI hide sequence

RefSeq Acc Id:

ENSRNOP00000008841 ⟸ ENSRNOT00000008840

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P02692-F1-model_v2	AlphaFold	P02692	1-127	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2590	AgrOrtholog
BioCyc Gene	G2FUF-44192	BioCyc
Ensembl Genes	ENSRNOG00000006675	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000008841	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000008840	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	2.40.128.20	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7325407	IMAGE-MGC_LOAD
InterPro	Calycin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Fatty_acid-bd	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	ILBP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:24360	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:108756	IMAGE-MGC_LOAD
NCBI Gene	24360	ENTREZGENE
PANTHER	FATTY ACID BINDING PROTEIN	UniProtKB/TrEMBL
	FATTY ACID-BINDING PROTEIN, LIVER	UniProtKB/TrEMBL
	PTHR11955	UniProtKB/Swiss-Prot
	PTHR11955:SF96	UniProtKB/Swiss-Prot
Pfam	Lipocalin_7	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Fabp1	PhenoGen
PRINTS	FATTYACIDBP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	FABP	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	Lipocalins	UniProtKB/TrEMBL, UniProtKB/Swiss-Prot
TIGR	TC232636
UniProt	A6IA66	ENTREZGENE, UniProtKB/TrEMBL
	FABPL_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-01-27	Fabp1	fatty acid binding protein 1	Fabp1	fatty acid binding protein 1, liver	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2004-09-10	Fabp1	fatty acid binding protein 1, liver		fatty acid binding protein 1	Name updated	1299863	APPROVED
2002-06-10	Fabp1	Fatty acid binding protein 1, liver			Symbol and Name status set to approved	70586	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Annotations - KEGG (archival)

Mammalian Phenotype