Hbegf (heparin-binding EGF-like growth factor)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Hbegf (heparin-binding EGF-like growth factor) Rattus norvegicus

Analyze

Symbol:

Hbegf

Name:

heparin-binding EGF-like growth factor

RGD ID:

2526

Description:

Enables epidermal growth factor receptor binding activity and growth factor activity. Involved in epidermal growth factor receptor signaling pathway; negative regulation of elastin biosynthetic process; and positive regulation of cell growth. Predicted to be located in cell surface. Predicted to be active in extracellular space and plasma membrane. Biomarker of acute kidney failure. Human ortholog(s) of this gene implicated in glomerulosclerosis and perinatal necrotizing enterocolitis. Orthologous to human HBEGF (heparin binding EGF like growth factor); PARTICIPATES IN epidermal growth factor/neuregulin signaling pathway; gonadotropin-releasing hormone signaling pathway; INTERACTS WITH (+)-schisandrin B; 1,2,4-trimethylbenzene; 2,2',4,4'-Tetrabromodiphenyl ether.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

diphtheria toxin receptor; Diphtheria toxin receptor (heparin binding epidermal growth factor - like growth factor); Dtr; GFHB; Hb-egf; Hegfl; heparin binding epidermal growth factor-like growth factor; heparin-binding epidermal -growth - like growth factor; heparin-binding epidermal -growth factor; proheparin-binding EGF-like growth factor

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	18	28,106,284 - 28,116,167 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	28,105,760 - 28,116,441 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	28,233,442 - 28,243,328 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	18	28,995,528 - 29,005,411 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	18	28,330,776 - 28,340,662 (-)	NCBI	Rnor_WKY
Rnor_6.0	18	29,330,302 - 29,340,185 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	29,329,764 - 29,340,403 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	29,036,863 - 29,046,746 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	29,143,567 - 29,153,944 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	29,170,212 - 29,180,590 (-)	NCBI
Celera	18	27,834,537 - 27,844,179 (-)	NCBI		Celera
Cytogenetic Map	18	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

acute kidney failure (IEP,ISO)

Animal Disease Models (ISO)

autosomal dominant intellectual developmental disorder 31 (ISO)

autosomal dominant nonsyndromic deafness 1 (ISO)

Cardiotoxicity (ISO)

end stage renal disease (ISO)

endometriosis (ISO)

epilepsy with generalized tonic-clonic seizures (ISO)

familial adenomatous polyposis 1 (ISO)

glomerulosclerosis (ISO)

Hereditary Neoplastic Syndromes (ISO)

juvenile rheumatoid arthritis (ISO)

Left Ventricular Hypertrophy (ISO)

Neurodevelopmental Disorders (ISO)

perinatal necrotizing enterocolitis (ISO)

Reperfusion Injury (ISO)

Seizures, Cortical Blindness, and Microcephaly Syndrome (ISO)

Stomach Neoplasms (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(-)-epigallocatechin 3-gallate (ISO)

1,10-phenanthroline (ISO)

1,2,4-trimethylbenzene (EXP)

1,2-dimethylhydrazine (ISO)

1-nitropyrene (ISO)

17beta-estradiol (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (EXP)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

2-amino-2-deoxy-D-galactopyranose (ISO)

2-butoxyethanol (ISO)

2-hydroxypropanoic acid (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP,ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

3,7-dihydropurine-6-thione (EXP)

4,4'-sulfonyldiphenol (ISO)

4-hydroxynon-2-enal (ISO)

4-hydroxyphenyl retinamide (ISO)

4-nonylphenol (ISO)

6-propyl-2-thiouracil (EXP)

7,12-dimethyltetraphene (ISO)

9-cis-retinoic acid (ISO)

acetamide (EXP)

acetylsalicylic acid (EXP)

acrolein (ISO)

acrylamide (EXP,ISO)

actinomycin D (ISO)

aflatoxin B1 (EXP,ISO)

aldehydo-D-glucose (ISO)

all-trans-4-oxoretinoic acid (ISO)

all-trans-retinal (ISO)

all-trans-retinoic acid (ISO)

all-trans-retinol (ISO)

alpha-pinene (ISO)

alprenolol (ISO)

ammonium chloride (EXP)

amphetamine (EXP)

anthra[1,9-cd]pyrazol-6(2H)-one (ISO)

apigenin (ISO)

aripiprazole (EXP)

aristolochic acid A (ISO)

Aroclor 1254 (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

atorvastatin calcium (ISO)

benzalkonium chloride (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

beraprost (ISO)

bis(2-chloroethyl) sulfide (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

bleomycin A2 (ISO)

bromobenzene (EXP)

butan-1-ol (ISO)

butanal (ISO)

butane-2,3-dione (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

cannabidiol (ISO)

capsaicin (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

carvedilol (ISO)

CGP 52608 (ISO)

chloropicrin (ISO)

cholesterol (ISO)

choline (ISO)

chondroitin sulfate (ISO)

chromium(6+) (ISO)

clobetasol (ISO)

clofibrate (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

crizotinib (ISO)

crocidolite asbestos (ISO)

cyanidin cation (ISO)

cycloheximide (ISO)

cyclophosphamide (EXP)

cyclosporin A (ISO)

cypermethrin (EXP)

D-glucose (ISO)

dermatan sulfate (ISO)

dexamethasone (EXP,ISO)

diarsenic trioxide (ISO)

diclofenac (ISO)

dimethylarsinous acid (ISO)

dioxygen (EXP,ISO)

diprotium oxide (ISO)

disulfiram (ISO)

divanadium pentaoxide (ISO)

dobutamine (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

erlotinib hydrochloride (ISO)

ethanol (ISO)

etoposide (ISO)

fenamidone (ISO)

fenvalerate (EXP)

ferric oxide (ISO)

fluoranthene (ISO)

folic acid (ISO)

formaldehyde (ISO)

furan (EXP)

gefitinib (EXP,ISO)

gentamycin (EXP)

glucose (ISO)

graphite (EXP)

Heptachlor epoxide (ISO)

hydrogen cyanide (ISO)

hydrogen peroxide (ISO)

hydroquinone (ISO)

irinotecan (ISO)

isotretinoin (ISO)

L-methionine (ISO)

lead(0) (ISO)

lead(2+) (ISO)

leflunomide (ISO)

Licochalcone B (ISO)

lidocaine (EXP)

lipopolysaccharide (EXP,ISO)

luteolin (ISO)

medroxyprogesterone acetate (ISO)

mercaptopurine (EXP)

mercury dichloride (EXP)

methoxychlor (EXP)

methylisothiazolinone (ISO)

methylmercury chloride (ISO)

mifepristone (EXP)

Muraglitazar (EXP)

myricetin (ISO)

N-acetyl-L-cysteine (ISO)

N-Nitrosopyrrolidine (ISO)

naphthalenes (EXP)

nickel atom (ISO)

nitrofen (EXP)

ozone (EXP,ISO)

paracetamol (EXP,ISO)

paraquat (EXP)

PCB138 (EXP)

pentanal (ISO)

pentane-2,3-dione (EXP)

perfluoroundecanoic acid (ISO)

phenobarbital (ISO)

phenylephrine (EXP)

phenylmercury acetate (ISO)

phorbol 13-acetate 12-myristate (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

potassium cyanide (ISO)

propanal (ISO)

purine-6-thiol (EXP)

quercetin (ISO)

rac-lactic acid (ISO)

raloxifene (ISO)

reactive oxygen species (EXP,ISO)

Rebamipide (EXP)

rifampicin (ISO)

SB 203580 (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium arsenite (EXP,ISO)

sodium chloride (ISO)

sodium dichromate (ISO)

Soman (EXP)

sotorasib (ISO)

succimer (ISO)

sucrose (ISO)

sunitinib (ISO)

tamoxifen (ISO)

tebuconazole (ISO)

tert-butyl hydroperoxide (ISO)

testosterone (ISO)

tetrachloromethane (EXP)

Tetramethylthiourea (EXP)

thapsigargin (ISO)

thimerosal (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

trametinib (ISO)

trichloroethene (EXP)

trichostatin A (ISO)

triptonide (ISO)

troglitazone (EXP)

trovafloxacin (ISO)

tyrphostin AG 1478 (EXP,ISO)

undecane (EXP)

urethane (ISO)

valproic acid (ISO)

valsartan (ISO)

vanadyl sulfate (ISO)

versicolorin A (ISO)

water (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cell chemotaxis (ISO)

cell migration (ISO)

epidermal growth factor receptor signaling pathway (IBA,IMP,ISO,TAS)

ERBB2-EGFR signaling pathway (ISO)

ERBB2-ERBB4 signaling pathway (ISO)

negative regulation of elastin biosynthetic process (IDA)

nervous system development (TAS)

positive regulation of cell growth (IDA)

positive regulation of cell migration (ISO)

positive regulation of cell population proliferation (IBA,ISO)

positive regulation of epidermal growth factor-activated receptor activity (IBA)

positive regulation of keratinocyte migration (ISO)

positive regulation of peptidyl-tyrosine phosphorylation (ISO)

positive regulation of protein kinase B signaling (ISO)

positive regulation of smooth muscle cell proliferation (ISO)

positive regulation of wound healing (ISO)

regulation of heart contraction (ISO)

wound healing, spreading of epidermal cells (ISO)

Cellular Component

cell surface (ISO)

extracellular space (IBA,ISO)

plasma membrane (IBA,ISO)

Molecular Function

enzyme regulator activity (ISO)

epidermal growth factor receptor binding (IBA,IMP,ISO)

growth factor activity (IBA,IMP,ISO)

heparin binding (IBA,ISO)

protein binding (ISO)

receptor ligand activity (ISO)

transmembrane receptor protein tyrosine kinase activator activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

epidermal growth factor/neuregulin signaling pathway (IEA,IMP,ISO)

gonadotropin-releasing hormone signaling pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Heparin-binding EGF-like growth factor: characterization of rat and mouse cDNA clones, protein domain conservation across species, and transcript expression in tissues.	Abraham JA, etal., Biochem Biophys Res Commun 1993 Jan 15;190(1):125-33.
2.	Comparison of epidermal growth factor and heparin-binding epidermal growth factor-like growth factor for prevention of experimental necrotizing enterocolitis.	Dvorak B, etal., J Pediatr Gastroenterol Nutr. 2008 Jul;47(1):11-8. doi: 10.1097/MPG.0b013e3181788618.
3.	Heparin-binding epidermal-growth-factor-like growth factor gene expression is induced by scrape-wounding epithelial cell monolayers: involvement of mitogen-activated protein kinase cascades.	Ellis PD, etal., Biochem J 2001 Feb 15;354(Pt 1):99-106.
4.	Heparin-binding epidermal growth factor-like growth factor (HB-EGF) regulates survival of midbrain dopaminergic neurons.	Farkas LM and Krieglstein K, J Neural Transm 2002 Mar;109(3):267-77.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Control of the epidermal growth factor receptor and its ligands during renal injury.	Hise MK, etal., Nephron. 2001 May;88(1):71-9.
7.	Heparin-binding EGF-like growth factor regulates elastin and FGF-2 expression in pulmonary fibroblasts.	Liu J, etal., Am J Physiol Lung Cell Mol Physiol. 2003 Nov;285(5):L1106-15. Epub 2003 Jul 25.
8.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
9.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
10.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
11.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
12.	GOA pipeline	RGD automated data pipeline
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Autocrine, paracrine and juxtacrine signaling by EGFR ligands.	Singh AB and Harris RC, Cell Signal. 2005 Oct;17(10):1183-93.
15.	A role of heparin-binding epidermal growth factor-like growth factor in cardiac remodeling after myocardial infarction.	Tanaka N, etal., Biochem Biophys Res Commun 2002 Sep 20;297(2):375-81.
16.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
17.	Heparin-binding EGF-like growth factor gene transcription regulated by Cdx2 in the intestinal epithelium.	Uesaka T, etal., Am J Physiol Gastrointest Liver Physiol 2002 Oct;283(4):G840-7.
18.	Podocyte depletion causes glomerulosclerosis: diphtheria toxin-induced podocyte depletion in rats expressing human diphtheria toxin receptor transgene.	Wharram BL, etal., J Am Soc Nephrol 2005 Oct;16(10):2941-52. Epub 2005 Aug 17.
19.	Transactivation of epidermal growth factor receptor mediates catecholamine-induced growth of vascular smooth muscle.	Zhang H, etal., Circ Res. 2004 Nov 12;95(10):989-97. Epub 2004 Oct 14.

Additional References at PubMed

PMID:1840698	PMID:8300582	PMID:8702723	PMID:9857183	PMID:11882602	PMID:12070119	PMID:12621152	PMID:12743035	PMID:12746188	PMID:15490481	PMID:15923649	PMID:16364500
PMID:16737974	PMID:16753836	PMID:16806064	PMID:17655843	PMID:17855771	PMID:18299347	PMID:18929421	PMID:19193634	PMID:19225541	PMID:19237431	PMID:19389413	PMID:20696782
PMID:21244855	PMID:23534509	PMID:24008408	PMID:24303948	PMID:24703506	PMID:25759388	PMID:31882563	PMID:35281434

Genomics

Comparative Map Data

Hbegf
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	18	28,106,284 - 28,116,167 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	18	28,105,760 - 28,116,441 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	18	28,233,442 - 28,243,328 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	18	28,995,528 - 29,005,411 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	18	28,330,776 - 28,340,662 (-)	NCBI	Rnor_WKY
Rnor_6.0	18	29,330,302 - 29,340,185 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	18	29,329,764 - 29,340,403 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	18	29,036,863 - 29,046,746 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	18	29,143,567 - 29,153,944 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	18	29,170,212 - 29,180,590 (-)	NCBI
Celera	18	27,834,537 - 27,844,179 (-)	NCBI		Celera
Cytogenetic Map	18	p11	NCBI

HBEGF
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	5	140,332,843 - 140,346,603 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	5	140,332,843 - 140,346,603 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	5	139,712,428 - 139,726,188 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	5	139,692,612 - 139,706,358 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	5	135,789,059 - 135,802,819 (-)	NCBI		Celera
Cytogenetic Map	5	q31.3	NCBI
HuRef	5	134,857,589 - 134,871,349 (-)	NCBI		HuRef
CHM1_1	5	139,145,572 - 139,159,324 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	5	140,858,275 - 140,872,035 (-)	NCBI		T2T-CHM13v2.0

Hbegf
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	18	36,637,980 - 36,648,858 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	18	36,637,980 - 36,648,858 (-)	Ensembl		GRCm39 Ensembl
GRCm38	18	36,504,927 - 36,515,805 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	18	36,504,927 - 36,515,805 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	18	36,664,581 - 36,675,459 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	18	36,630,906 - 36,641,748 (-)	NCBI		MGSCv36	mm8
Celera	18	36,954,561 - 36,965,476 (-)	NCBI		Celera
Cytogenetic Map	18	B2	NCBI
cM Map	18	19.46	NCBI

Hbegf
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955418	309,096 - 321,387 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955418	259,860 - 321,340 (+)	NCBI	ChiLan1.0	ChiLan1.0

HBEGF
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	5	141,816,402 - 141,830,531 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	5	141,816,402 - 141,830,531 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	5	135,699,553 - 135,713,366 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

HBEGF
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	35,551,248 - 35,563,310 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	35,551,250 - 35,563,043 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	32,590,448 - 32,601,580 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	36,006,883 - 36,018,938 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	36,006,888 - 36,018,924 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	33,058,605 - 33,070,652 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	33,926,053 - 33,938,108 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	34,678,980 - 34,691,039 (-)	NCBI		UU_Cfam_GSD_1.0

Hbegf
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024407213	152,266,443 - 152,278,566 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936531	9,332,898 - 9,345,067 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936531	9,332,939 - 9,345,039 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

HBEGF
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	142,102,458 - 142,115,174 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	2	142,102,455 - 142,115,192 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	2	148,047,629 - 148,058,091 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

HBEGF
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	23	42,981,640 - 42,995,116 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	23	42,981,640 - 42,994,995 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666034	34,887,898 - 34,902,819 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Hbegf
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624743	33,112,036 - 33,124,169 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624743	33,112,105 - 33,124,145 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Hbegf
25 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	721
Count of miRNA genes:	298
Interacting mature miRNAs:	373
Transcripts:	ENSRNOT00000025157
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
2312598	Bp340	Blood pressure QTL 340		0.05	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	1	30558703	Rat
2300180	Bmd67	Bone mineral density QTL 67	4.8	0.0001	femur mineral mass (VT:0010011)	bone mineral density (CMO:0001226)	18	1	34291613	Rat
2293661	Bss50	Bone structure and strength QTL 50	4.64	0.0003	lumbar vertebra size trait (VT:0010518)	lumbar vertebra trabecular cross-sectional area (CMO:0001692)	18	1	34291613	Rat
61388	Bp2	Blood pressure QTL 2	3.23		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	1	35374722	Rat
9589153	Insul31	Insulin level QTL 31	7.15	0.05	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	18	1	42547119	Rat
2299160	Iddm35	Insulin dependent diabetes mellitus QTL 35	2.79		blood glucose amount (VT:0000188)	age at onset/diagnosis of type 1 diabetes mellitus (CMO:0001140)	18	4207941	60377792	Rat
2312568	Glom21	Glomerulus QTL 21	2	0.005	kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	18	5185858	40503530	Rat
2293708	Bss46	Bone structure and strength QTL 46	8.8	0.0001	lumbar vertebra morphology trait (VT:0010494)	lumbar vertebra cortical cross-sectional area (CMO:0001690)	18	11791518	63636873	Rat
1578661	Bss20	Bone structure and strength QTL 20	3.7		femur morphology trait (VT:0000559)	femoral neck cross-sectional area (CMO:0001697)	18	11791518	83218561	Rat
1578667	Bss21	Bone structure and strength QTL 21	3.5		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	18	11791518	83218561	Rat
61382	Bp46	Blood pressure QTL 46	18.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11941791	31393320	Rat
631264	Scl22	Serum cholesterol level QTL 22	6.2		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	18	11941791	31393320	Rat
1331766	Bp236	Blood pressure QTL 236	3.022		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	11944299	31359530	Rat
61375	Bp41	Blood pressure QTL 41	2.4		blood pressure trait (VT:0000183)	systolic blood pressure (CMO:0000004)	18	11944299	41122201	Rat
1331753	Bp231	Blood pressure QTL 231	3.643		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944299	52293055	Rat
1358358	Sradr6	Stress Responsive Adrenal Weight QTL 6	2.49		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	18	11944299	59330563	Rat
6903359	Bp355	Blood pressure QTL 355	3.6		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	18	11944544	59796478	Rat
2313082	Bss85	Bone structure and strength QTL 85	0.8	0.0001	long bone metaphysis morphology trait (VT:0000133)	tibia midshaft total cross-sectional area (CMO:0001715)	18	14951337	59951337	Rat
1358193	Emca2	Estrogen-induced mammary cancer QTL 2	1.6		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	18	18007599	63571040	Rat
1331735	Rf44	Renal function QTL 44	2.981		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	18	18234564	31359530	Rat
1331775	Bp235	Blood pressure QTL 235	3.201		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	18234564	31359530	Rat
1600373	Mamtr6	Mammary tumor resistance QTL 6			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	18	19278901	83218561	Rat
1331741	Bp232	Blood pressure QTL 232	3.59112		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	18	21372893	83213037	Rat
1641923	Colcr8	Colorectal carcinoma resistance QTL 8	3.1	0.0014	intestine integrity trait (VT:0010554)	poorly differentiated malignant colorectal tumor number (CMO:0002076)	18	22066242	52293055	Rat
1331733	Bp233	Blood pressure QTL 233	3.97196		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	24796977	79788953	Rat
2325839	Bp348	Blood pressure QTL 348		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	25570985	70570985	Rat
12904673	Cm127	Cardiac mass QTL 127		0.005	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	18	26548082	46969551	Rat
12904675	Am19	Aortic mass QTL 19		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	18	26548082	46969551	Rat
12904677	Kidm72	Kidney mass QTL 72		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	18	26548082	46969551	Rat
12904668	Bw188	Body weight QTL 188		0.03	body mass (VT:0001259)	body weight (CMO:0000012)	18	26548082	46969551	Rat
12904669	Cm125	Cardiac mass QTL 125		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	18	26548082	46969551	Rat
12904670	Cm126	Cardiac mass QTL 126		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	18	26548082	46969551	Rat
2301413	Bp318	Blood pressure QTL 318		0.002	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	18	26548082	46969551	Rat

Markers in Region

RH127462

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	18	28,105,863 - 28,106,082 (+)	MAPPER	mRatBN7.2
Rnor_6.0	18	29,329,882 - 29,330,100	NCBI	Rnor6.0
Rnor_5.0	18	29,036,443 - 29,036,661	UniSTS	Rnor5.0
RGSC_v3.4	18	29,143,147 - 29,143,365	UniSTS	RGSC3.4
Celera	18	27,834,117 - 27,834,335	UniSTS
RH 3.4 Map	18	416.8	UniSTS
Cytogenetic Map	18	p11	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	1	2					1	3	31	2	2	3	1
Low	2	41	36	20	19	20	7	8	43	33	37	8	7
Below cutoff			21	21		21					2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012945	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC097756	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473974	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000299	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	L05489	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000025157 ⟹ ENSRNOP00000025157

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	18	28,105,760 - 28,116,441 (-)	Ensembl
Rnor_6.0 Ensembl	18	29,329,764 - 29,340,403 (-)	Ensembl

RefSeq Acc Id:

NM_012945 ⟹ NP_037077

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	18	28,106,284 - 28,116,167 (-)	NCBI
Rnor_6.0	18	29,330,302 - 29,340,185 (-)	NCBI
Rnor_5.0	18	29,036,863 - 29,046,746 (-)	NCBI
RGSC_v3.4	18	29,143,567 - 29,153,944 (-)	RGD
Celera	18	27,834,537 - 27,844,179 (-)	RGD

Sequence:

show sequence

GGGCCCCCCCGTCTCCGCCAGGCTCGGGACCATGAAGCTGCTGCCGTCGGTGGTGCTGAAGCTC
TTTCTGGCCGCAGTGTTGTCCGCGTTGGTGACCGGTGAGAGTCTGGAGCGGCTTCGGAGAGGTC
TGGCGGCAGCAACCAGCAACCCTGACCCTCCCACTGGAACCACAAACCAGCTGCTACCCACGGG
AGCTGATCGCGCTCAGGAGGTCCAGGACTTGGAAGGGACCGATCTGGACCTTTTCAAAGTTGCT
TTCTCCTCCAAGCCACAAGCCCTGGCCACCCCAGGAAAAGAAAAGAACGGGAAAAAGAAGAGGA
AAGGCAAGGGGTTAGGAAAGAAGAGAGATCCATGCCTTAAGAAATACAAGGACTACTGCATCCA
CGGAGAGTGCAGATACCTGAAGGAGCTCCGTATTCCCTCGTGCCACTGCCTCCCTGGTTACCAT
GGACAGAGGTGTCATGGGCTGACCCTACCGGTAGAGAACCCCCTGTACACATATGACCACACTA
CCGTCTTGGCTGTGGTGGCTGTAGTACTGTCATCTGTCTGTCTTCTTGTCATCGTGGGACTTCT
CATGTTCAGGTACCATAGGCGAGGAGGTTATGACTTGGAAAGTGAGGAGAAAGTGAAGTTGGGC
ATGGCTAGCTCCCACTGAGGAGGATCTGAGCTCAAGGAGCCTTCAGAGGATGGCTACTTCTGAG
ATGGCGGTTCCTTACAAGTTCTACAGAGGGAAAATACTTCACCAGCAGCCATGAAGACTTCTTC
ATTCATTCCCAGTTGCTACCCTGACTGGGCCTCCTGTAATTGCTCTGCAAAAATATCAGAGCCT
CTAAGTGCCAAACAGACTATGCCCCGCTGGGATCTGGATCAGAAGAAAGCAGGAGCAAGTGAGC
CCTTCAGGCCTTCCTGATCCTCCACCACTGAACCCACTGGTTTGTTTAAACACTTAGCTTCTGG
ATTAAAGTGTCAGCTAGTTTCCATATGCTCCAGGATTTTTGGCTGAAAAAAAAAAAAGAAGAGA
GGACGGATGAGTGGTTTATGGACTGGAAGAGATCAACAGAGTTGAGAAGCTAAGTGTTCAAGTA
GCCACAGGGGATCTGCTGTTTGGACCCTCCAGCACGCTGGATTTGATGAGCTAACTGTGAAATA
TCTCAAGCCCGAGAACTCTTGAGTTTTGGGACTTCTACCCAGAGGGAAAAATAACAAGTATTTT
GTTGTTGTTGTTGTTTGTTTGTTTTTAAAATGCCTCTTAAATTATATATTTATTTTATTCTATG
TATGTTAATATATTTAGTTTTTAACAATCTAACAATAATATTTCAAGTGCCTAGACTGTTACTT
TGCCAATGTCCTGGCCCGCCTCTCTTGCAGCTCTTCCACCTGGCTCAATGCCACACTCCCATCT
GCTCTGTAACCCATCTGTAGTAATTTATTGTCTGTCTACATTTCAGAAGATGCCCCTGTAGCAG
AGTATCCCAGGGTGGGTTGTGTATGGTCGGAGTGCAAGGATGGATTTGGGCAGAGCCACTCTGT
GAGTTGGACTGCAG

hide sequence

Protein Sequences


Protein RefSeqs	NP_037077	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA81780	(Get FASTA)	NCBI Sequence Viewer
	EDL76294	(Get FASTA)	NCBI Sequence Viewer
	Q06175	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_037077 ⟸ NM_012945
- Peptide Label:	precursor
- UniProtKB:	Q06175 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MKLLPSVVLKLFLAAVLSALVTGESLERLRRGLAAATSNPDPPTGTTNQLLPTGADRAQEVQDL EGTDLDLFKVAFSSKPQALATPGKEKNGKKKRKGKGLGKKRDPCLKKYKDYCIHGECRYLKELR IPSCHCLPGYHGQRCHGLTLPVENPLYTYDHTTVLAVVAVVLSSVCLLVIVGLLMFRYHRRGGY DLESEEKVKLGMASSH hide sequence

RefSeq Acc Id:

ENSRNOP00000025157 ⟸ ENSRNOT00000025157

Protein Domains

EGF-like

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q06175-F1-model_v2	AlphaFold	Q06175	1-208	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700720

Promoter ID:

EPDNEW_R11243

Type:

multiple initiation site

Name:

Hbegf_1

Description:

heparin-binding EGF-like growth factor

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	18	29,340,413 - 29,340,473	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2526	AgrOrtholog
BioCyc Gene	G2FUF-7875	BioCyc
Ensembl Genes	ENSRNOG00000018646	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000025157	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000025157	ENTREZGENE, UniProtKB/Swiss-Prot
InterPro	EGF-like_dom	UniProtKB/Swiss-Prot
	EGF_rcpt_ligand	UniProtKB/Swiss-Prot
KEGG Report	rno:25433	UniProtKB/Swiss-Prot
NCBI Gene	25433	ENTREZGENE
PANTHER	PTHR10740	UniProtKB/Swiss-Prot
PhenoGen	Hbegf	PhenoGen
PROSITE	EGF_1	UniProtKB/Swiss-Prot
	EGF_2	UniProtKB/Swiss-Prot
	EGF_3	UniProtKB/Swiss-Prot
TIGR	TC230854
UniProt	HBEGF_RAT	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2006-03-30	Hbegf	heparin-binding EGF-like growth factor	Dtr	diphtheria toxin receptor	Symbol and Name updated	1299863	APPROVED
2004-02-26	Dtr	diphtheria toxin receptor			Symbol and Name status set to approved	625702	APPROVED
2003-05-08	Dtr	diphtheria toxin receptor	Hb-egf	heparin-binding epidermal -growth factor	Data Merged	628472	PROVISIONAL
2003-04-09	Dtr	diphtheria toxin receptor	Hegfl	heparin binding epidermal growth factor-like growth factor	Symbol and Name updated	629477	APPROVED
2002-11-06	Hegfl	heparin binding epidermal growth factor-like growth factor	Dtr	Diphtheria toxin receptor (heparin binding epidermal growth factor - like growth factor)	Symbol and Name updated	625702	APPROVED
2002-06-10	Dtr	Diphtheria toxin receptor (heparin binding epidermal growth factor - like growth factor)			Symbol and Name status set to approved	70586	APPROVED
2002-06-10	Hb-egf	heparin-binding epidermal -growth factor			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_disease	may play a role in cardiac fibroblast proliferation and remodeling after myocardial infarction	728765

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Imported Annotations - KEGG (archival)

Imported Annotations - PID (archival)