Sf3b6 (splicing factor 3B, subunit 6)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Sf3b6 (splicing factor 3B, subunit 6) Rattus norvegicus

Analyze

Symbol:

Sf3b6

Name:

splicing factor 3B, subunit 6

RGD ID:

2318878

Description:

Predicted to enable mRNA binding activity. Predicted to be involved in mRNA splicing, via spliceosome. Predicted to act upstream of or within blastocyst formation. Predicted to be located in nucleoplasm. Predicted to be part of U2 snRNP and spliceosomal complex. Orthologous to human SF3B6 (splicing factor 3b subunit 6); PARTICIPATES IN spliceosome pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; paracetamol; tetrachloromethane.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

LOC100365504; splicing factor 3B subunit 6; splicing factor 3B, 14 kDa subunit-like; uncharacterized protein LOC100365504

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	SF3B6 (splicing factor 3b subunit 6)	HGNC	HomoloGene, NCBI
Mus musculus (house mouse):	Sf3b6 (splicing factor 3B, subunit 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Sf3b6 (splicing factor 3b subunit 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	SF3B6 (splicing factor 3b subunit 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	SF3B6 (splicing factor 3b subunit 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Sf3b6 (splicing factor 3b subunit 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	SF3B6 (splicing factor 3b subunit 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	SF3B6 (splicing factor 3b subunit 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Sf3b6 (splicing factor 3b subunit 6)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	SF3B6 (splicing factor 3b subunit 6)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Sf3b6 (splicing factor 3B, subunit 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	sf3b6 (splicing factor 3b, subunit 6)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	C50D2.5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Sf3b6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	6	27,826,044 - 27,835,086 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	27,826,029 - 27,835,156 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	28,118,290 - 28,127,332 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	6	28,434,194 - 28,443,236 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	6	27,908,751 - 27,917,793 (+)	NCBI	Rnor_WKY
Rnor_6.0	6	29,991,232 - 29,999,668 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	29,991,307 - 29,999,410 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	39,886,845 - 39,895,262 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	6	27,295,792 - 27,304,777 (+)	NCBI		Celera
Cytogenetic Map	6	q14	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(S)-nicotine (ISO)

1,2-dimethylhydrazine (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2-hydroxypropanoic acid (ISO)

all-trans-retinoic acid (ISO)

arsenite(3-) (ISO)

benzo[a]pyrene (ISO)

bisphenol A (ISO)

CGP 52608 (ISO)

chloropicrin (ISO)

dicrotophos (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

enzyme inhibitor (ISO)

ethyl methanesulfonate (ISO)

folic acid (ISO)

formaldehyde (ISO)

hydralazine (ISO)

ivermectin (ISO)

methyl methanesulfonate (ISO)

nicotine (ISO)

paracetamol (EXP)

perfluorooctane-1-sulfonic acid (ISO)

rac-lactic acid (ISO)

resveratrol (ISO)

SB 431542 (ISO)

sunitinib (ISO)

tetrachloromethane (EXP,ISO)

thapsigargin (ISO)

tolcapone (EXP)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

blastocyst formation (ISO)

mRNA splicing, via spliceosome (IBA,ISO)

Cellular Component

catalytic step 2 spliceosome (IBA)

cellular_component (ND)

nucleoplasm (IEA,ISO)

nucleus (ISO)

precatalytic spliceosome (IBA)

U12-type spliceosomal complex (IBA,ISO)

U2 snRNP (IBA)

U2-type spliceosomal complex (IBA,ISO)

Molecular Function

molecular_function (ND)

mRNA binding (ISO)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

spliceosome pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Proteomic analysis of in vivo-assembled pre-mRNA splicing complexes expands the catalog of participating factors.	Chen YI, etal., Nucleic Acids Res. 2007;35(12):3928-44. Epub 2007 May 30.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:15146077	PMID:16432215	PMID:22658674	PMID:22681889	PMID:23211737	PMID:27720643	PMID:27869233	PMID:28541300

Genomics

Comparative Map Data

Sf3b6
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	6	27,826,044 - 27,835,086 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	27,826,029 - 27,835,156 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	6	28,118,290 - 28,127,332 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	6	28,434,194 - 28,443,236 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	6	27,908,751 - 27,917,793 (+)	NCBI	Rnor_WKY
Rnor_6.0	6	29,991,232 - 29,999,668 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	29,991,307 - 29,999,410 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	39,886,845 - 39,895,262 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	6	27,295,792 - 27,304,777 (+)	NCBI		Celera
Cytogenetic Map	6	q14	NCBI

SF3B6
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	2	24,067,586 - 24,076,326 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	2	24,067,586 - 24,076,373 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	2	24,290,456 - 24,299,196 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	24,143,958 - 24,152,818 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	2	24,130,785 - 24,139,642 (-)	NCBI		Celera
Cytogenetic Map	2	p23.3	NCBI
HuRef	2	24,029,317 - 24,038,126 (-)	NCBI		HuRef
CHM1_1	2	24,219,844 - 24,228,700 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	2	24,102,271 - 24,111,005 (-)	NCBI		T2T-CHM13v2.0

Sf3b6
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	4,867,608 - 4,877,659 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	4,867,544 - 4,877,659 (+)	Ensembl		GRCm39 Ensembl
GRCm38	12	4,817,608 - 4,827,659 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	4,817,544 - 4,827,659 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	4,824,414 - 4,834,465 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	4,832,269 - 4,849,746 (+)	NCBI		MGSCv36	mm8
Celera	12	4,749,151 - 4,759,202 (+)	NCBI		Celera
Cytogenetic Map	12	A1.1	NCBI

Sf3b6
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955469	6,275,900 - 6,286,908 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955469	6,275,894 - 6,286,908 (-)	NCBI	ChiLan1.0	ChiLan1.0

SF3B6
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	2A	24,162,976 - 24,172,111 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	24,162,976 - 24,172,040 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	2A	24,065,640 - 24,074,512 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

SF3B6
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	17	18,548,633 - 18,559,694 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	17	18,548,622 - 18,704,161 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	17	18,447,236 - 18,457,834 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	17	18,822,915 - 18,833,664 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	17	18,716,677 - 18,833,595 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
ROS_Cfam_1.0 Ensembl	17	18,719,198 - 18,730,393 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UNSW_CanFamBas_1.0	17	18,568,742 - 18,579,681 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	17	18,609,656 - 18,620,388 (-)	NCBI		UU_Cfam_GSD_1.0

Sf3b6
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	62,926,788 - 62,932,864 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936493	7,906,701 - 7,912,438 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936493	7,906,701 - 7,912,777 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

SF3B6
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	3	114,605,971 - 114,620,563 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	3	114,605,863 - 114,618,123 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	3	121,870,648 - 121,882,905 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

SF3B6
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	83,593,429 - 83,602,309 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	14	83,593,025 - 83,604,002 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666045	28,563,396 - 28,573,269 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Sf3b6
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624738	6,395,616 - 6,404,855 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624738	6,395,610 - 6,404,794 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Sf3b6
51 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	15
Count of miRNA genes:	11
Interacting mature miRNAs:	15
Transcripts:	ENSRNOT00000075790
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1331743	Uae28	Urinary albumin excretion QTL 28	4.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	6	1	34235784	Rat
1578758	Tcas9	Tongue tumor susceptibility QTL 9	3.29		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	6	1	37618905	Rat
1598843	Cm63	Cardiac mass QTL 63	2.6		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	6	1	39036266	Rat
7411603	Foco13	Food consumption QTL 13	5.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1	41223769	Rat
8552962	Pigfal16	Plasma insulin-like growth factor 1 level QTL 16	9.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	6	1	41223769	Rat
7411542	Bw127	Body weight QTL 127	5.5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	6	1	41223769	Rat
9589129	Insul24	Insulin level QTL 24	19.06	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	6	1	41223769	Rat
9589048	Scfw3	Subcutaneous fat weight QTL 3	4.57	0.001	subcutaneous adipose mass (VT:1000472)	abdominal subcutaneous fat pad weight (CMO:0002069)	6	1	41223769	Rat
2293709	Bss23	Bone structure and strength QTL 23	5.18	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	6	1	42487980	Rat
2293650	Bss31	Bone structure and strength QTL 31	5.05	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	6	1	42487980	Rat
2293656	Bss28	Bone structure and strength QTL 28	6.79	0.0001	femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	6	1	42487980	Rat
7411584	Foco4	Food consumption QTL 4	4.3	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	6	1	42838846	Rat
738024	Sach5	Saccharine consumption QTL 5	3.9	0.00039	consumption behavior trait (VT:0002069)	saccharin intake volume to total fluid intake volume ratio (CMO:0001601)	6	1	43394190	Rat
2301972	Bp325	Blood pressure QTL 325	4.8		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	6	1	72227641	Rat
1300128	Rf16	Renal function QTL 16	3.89		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	5074497	34434305	Rat
1300164	Rf15	Renal function QTL 15	3.12		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	6	5074497	54641141	Rat
4145119	Mcs25	Mammary carcinoma susceptibility QTL 25		0.0001	mammary gland integrity trait (VT:0010552)	ratio of deaths to total study population during a period of time (CMO:0001023)	6	10894415	110548006	Rat
1578665	Bss16	Bone structure and strength QTL 16	4.4		femur morphology trait (VT:0000559)	bone trabecular cross-sectional area (CMO:0002311)	6	11735669	72593685	Rat
1578668	Bmd14	Bone mineral density QTL 14	3.8		femur mineral mass (VT:0010011)	total volumetric bone mineral density (CMO:0001728)	6	11735669	72593685	Rat
10401812	Kidm54	Kidney mass QTL 54			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	14368788	59368788	Rat
10401800	Kidm49	Kidney mass QTL 49			kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	6	14368788	59368788	Rat
1576309	Emca7	Estrogen-induced mammary cancer QTL 7	4		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	6	15107216	107351382	Rat
2292589	Emca10	Estrogen-induced mammary cancer QTL 10		0.048	mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	6	16536140	61536140	Rat
1354664	Slep2	Serum leptin concentration QTL 2	4.49		blood leptin amount (VT:0005667)	serum leptin level (CMO:0000780)	6	16536140	71636405	Rat
1641898	Colcr4	Colorectal carcinoma resistance QTL4	3.71	0.0007	intestine integrity trait (VT:0010554)	well differentiated malignant colorectal tumor surface area measurement (CMO:0002077)	6	20338777	62613667	Rat
2293839	Kiddil2	Kidney dilation QTL 2	4.8		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	20866422	81133036	Rat
2293841	Kiddil4	Kidney dilation QTL 4	4.4		kidney pelvis morphology trait (VT:0004194)	hydronephrosis severity score (CMO:0001208)	6	20866422	81133036	Rat

Markers in Region

AV001342

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Celera	6	27,304,422 - 27,304,650	UniSTS

AA848523

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Celera	6	27,304,374 - 27,304,738	UniSTS
RH 3.4 Map	6	118.6	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001271222	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473947	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM089942	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM108041	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FM109760	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221139	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229189	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ230364	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000164	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000075790 ⟹ ENSRNOP00000065625

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	27,828,246 - 27,835,011 (+)	Ensembl
Rnor_6.0 Ensembl	6	29,991,307 - 29,999,410 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000110429 ⟹ ENSRNOP00000091764

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	27,826,029 - 27,835,156 (+)	Ensembl

RefSeq Acc Id:

NM_001271222 ⟹ NP_001258151

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	6	27,826,044 - 27,835,086 (+)	NCBI
Rnor_6.0	6	29,991,232 - 29,999,668 (-)	NCBI
Rnor_5.0	6	39,886,845 - 39,895,262 (+)	NCBI
Celera	6	27,295,792 - 27,304,777 (+)	NCBI

Sequence:

show sequence

GTATCCGGAAGCGTCTTAGAGCTCGCTTTTTCGCCTTCCGGACTGACAACGCGTTCTCTCTAAT
TTGACTTGGAGCATCTTTTCTAGGAAGTAAACACGTCCTAGTTTGAGACGCGGACCTTCCGGCA
GTGCCGTAACAGCTTCCGGCTTTACCTGGCTGTAAATATCCTGTATGTGGCGCCGTGTCGCCCA
CGAAGGCGACTGAGTTTTTAGAAATACCCAGAAGGATCTTACGGTAACCTACATCGGCCCGCCA
AGATGGCGATGCAAGCGGCTAAGAGGGCGAATATCCGCCTCCCACCTGAAGTAAATCGGATTTT
GTATATAAGGAATTTGCCATACAAAATCACAGCAGAAGAAATGTATGATATATTTGGGAAATAT
GGACCTATTCGTCAAATCAGAGTAGGAAATACACCTGAAACCAGAGGAACAGCCTATGTGGTCT
ATGAAGACATCTTTGATGCTAAGAATGCCTGTGACCACCTATCAGGATTCAACGTTTGTAACAG
ATACCTTGTGGTTTTATATTACAATGCTAACCGGGCATTCCAGAAGATGGACACCAAGAAGAAG
GAGGAGCAGCTGAAGCTTCTCAAGGAAAAGTATGGCATCAACACAGATCCCCCCAAATGAGTAA
CAGCCATGTGTGGTCTTGGTTACCCTTCTCTTTTTTATTAATACTGAATGAATATTGCAATTTC
TTATTTG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001258151	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM03048	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_001258151 ⟸ NM_001271222
- UniProtKB:	A0A8I6AFT8 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTAYVVY EDIFDAKNACDHLSGFNVCNRYLVVLYYNANRAFQKMDTKKKEEQLKLLKEKYGINTDPPK hide sequence

RefSeq Acc Id:

ENSRNOP00000065625 ⟸ ENSRNOT00000075790

RefSeq Acc Id:

ENSRNOP00000091764 ⟸ ENSRNOT00000110429

Protein Domains

RRM

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-M0R835-F1-model_v2	AlphaFold	M0R835	1-123	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2318878	AgrOrtholog
BioCyc Gene	G2FUF-38264	BioCyc
Ensembl Genes	ENSRNOG00000046172	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000065625.3	UniProtKB/TrEMBL
	ENSRNOP00000091764	ENTREZGENE
	ENSRNOP00000091764.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000075790.3	UniProtKB/TrEMBL
	ENSRNOT00000110429	ENTREZGENE
	ENSRNOT00000110429.1	UniProtKB/TrEMBL
Gene3D-CATH	3.30.70.330	UniProtKB/TrEMBL
InterPro	Nucleotide-bd_a/b_plait_sf	UniProtKB/TrEMBL
	RBD_domain_sf	UniProtKB/TrEMBL
	RRM_dom	UniProtKB/TrEMBL
	SF3B6_RRM	UniProtKB/TrEMBL
NCBI Gene	100365504	ENTREZGENE
Pfam	RRM_1	UniProtKB/TrEMBL
PhenoGen	Sf3b6	PhenoGen
PROSITE	RRM	UniProtKB/TrEMBL
SMART	RRM	UniProtKB/TrEMBL
Superfamily-SCOP	SSF54928	UniProtKB/TrEMBL
UniProt	A0A8I6AFT8	ENTREZGENE, UniProtKB/TrEMBL
	M0R835_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-07-24	Sf3b6	splicing factor 3B, subunit 6	LOC100365504	splicing factor 3B, 14 kDa subunit-like	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2010-05-05	LOC100365504	splicing factor 3B, 14 kDa subunit-like			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

RGD Manual Annotations