Lrrc75b (leucine rich repeat containing 75B)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Lrrc75b (leucine rich repeat containing 75B) Rattus norvegicus

Analyze

Symbol:

Lrrc75b

Name:

leucine rich repeat containing 75B

RGD ID:

2318441

Description:

Orthologous to human LRRC75B (leucine rich repeat containing 75B); INTERACTS WITH 1-naphthyl isothiocyanate; 2,3,7,8-Tetrachlorodibenzofuran; 4,4'-sulfonyldiphenol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Fam211b; family with sequence similarity 211, member B; hypothetical protein LOC100365744; hypothetical protein LOC687708; leucine-rich repeat-containing protein 75B; leucine-rich repeat-containing protein FAM211B; LOC100365744; uncharacterized protein LOC687708

RGD Orthologs

Alliance Genes

More Info

more info ...

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	20	13,100,302 - 13,106,503 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	13,100,302 - 13,106,503 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	13,806,878 - 13,813,075 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	13,167,822 - 13,174,021 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	13,640,327 - 13,646,526 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	14,050,465 - 14,056,670 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	14,050,465 - 14,060,264 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	16,235,987 - 16,242,192 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	20	14,586,049 - 14,592,254 (+)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

epilepsy (ISO)

genetic disease (ISO)

schizophrenia (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1-naphthyl isothiocyanate (EXP)

17beta-estradiol (ISO)

2,3,7,8-Tetrachlorodibenzofuran (EXP)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-sulfonyldiphenol (EXP)

acetamide (EXP)

acrylamide (ISO)

all-trans-retinoic acid (ISO)

aristolochic acid A (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

cadmium atom (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

chlordecone (ISO)

chrysene (ISO)

cisplatin (ISO)

cyclosporin A (ISO)

dibenz[a,h]anthracene (ISO)

endosulfan (EXP)

ethanol (ISO)

gentamycin (EXP)

glyphosate (EXP)

N-methyl-4-phenylpyridinium (ISO)

niclosamide (ISO)

paracetamol (EXP)

resveratrol (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

testosterone (ISO)

tetraphene (ISO)

thimerosal (ISO)

titanium dioxide (ISO)

valproic acid (ISO)

vorinostat (ISO)

zoledronic acid (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932

Genomics

Comparative Map Data

Lrrc75b
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	20	13,100,302 - 13,106,503 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	13,100,302 - 13,106,503 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	13,806,878 - 13,813,075 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	13,167,822 - 13,174,021 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	13,640,327 - 13,646,526 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	14,050,465 - 14,056,670 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	14,050,465 - 14,060,264 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	16,235,987 - 16,242,192 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	20	14,586,049 - 14,592,254 (+)	NCBI		Celera
Cytogenetic Map	20	p12	NCBI

LRRC75B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	22	24,585,635 - 24,593,073 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	22	24,585,620 - 24,593,208 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	22	24,981,603 - 24,989,040 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	22	23,311,591 - 23,319,035 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	22	8,781,332 - 8,788,778 (-)	NCBI		Celera
Cytogenetic Map	22	q11.23	NCBI
HuRef	22	7,931,277 - 7,938,722 (-)	NCBI		HuRef
CHM1_1	22	24,940,400 - 24,947,843 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	22	25,047,236 - 25,054,674 (-)	NCBI		T2T-CHM13v2.0

Lrrc75b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	75,385,953 - 75,396,532 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	75,385,957 - 75,396,164 (-)	Ensembl		GRCm39 Ensembl
GRCm38	10	75,550,119 - 75,560,680 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	75,550,123 - 75,560,330 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	75,012,870 - 75,023,075 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	74,993,845 - 75,004,046 (-)	NCBI		MGSCv36	mm8
Celera	10	76,594,823 - 76,605,027 (-)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	38.55	NCBI

Lrrc75b
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955455	8,068,535 - 8,074,399 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955455	8,068,573 - 8,074,399 (-)	NCBI	ChiLan1.0	ChiLan1.0

LRRC75B
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	22	37,105,682 - 37,113,236 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	22	5,426,205 - 5,433,751 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	22	22,258,243 - 22,277,007 (-)	NCBI	panpan1.1	PanPan1.1	panPan2

LRRC75B
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	26	28,283,050 - 28,287,750 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	26	28,283,260 - 28,285,715 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	26	27,358,002 - 27,364,509 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	26	29,687,421 - 29,693,890 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	26	29,682,407 - 29,694,011 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	26	27,771,345 - 27,777,860 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	26	27,388,125 - 27,394,644 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	26	28,378,214 - 28,384,729 (-)	NCBI		UU_Cfam_GSD_1.0

Lrrc75b
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	141,987,855 - 141,993,692 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936619	757,178 - 766,477 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936619	760,370 - 766,207 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LRRC75B
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	14	49,609,347 - 49,615,348 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	14	49,609,111 - 49,615,312 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	14	53,051,015 - 53,057,275 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

LRRC75B
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	19	7,387,320 - 7,547,322 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666085	4,755,873 - 4,761,452 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Lrrc75b
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624747	10,014,482 - 10,021,754 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624747	10,015,742 - 10,021,754 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Lrrc75b
25 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	44
Count of miRNA genes:	41
Interacting mature miRNAs:	44
Transcripts:	ENSRNOT00000074783
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354642	Despr15	Despair related QTL 15		0.0027	locomotor behavior trait (VT:0001392)	amount of experiment time spent in a discrete space in an experimental apparatus (CMO:0000958)	20	1	24159021	Rat
1600382	Edcs3	Endometrial carcinoma susceptibility QTL3	3.5	0.003	uterus morphology trait (VT:0001120)	percentage of study population developing endometrioid carcinoma during a period of time (CMO:0001759)	20	1	25159026	Rat
2317851	Alcrsp22	Alcohol response QTL 22	3.2	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
1641893	Alcrsp7	Alcohol response QTL 7			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	1	27339237	Rat
8694189	Bw153	Body weight QTL 153	3.13	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	20	1	29191651	Rat
9590275	Scort15	Serum corticosterone level QTL 15	3.48	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	29191651	Rat
7411650	Foco23	Food consumption QTL 23	20.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	29191651	Rat
9590109	Sffal8	Serum free fatty acids level QTL 8	5.32	0.01	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	20	1	29191651	Rat
9589155	Insul32	Insulin level QTL 32	6.38	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	1	29191651	Rat
6893685	Bw111	Body weight QTL 111	2.7	0.004	body mass (VT:0001259)	body weight (CMO:0000012)	20	1	32578807	Rat
7411668	Foco32	Food consumption QTL 32	8	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	1	36600972	Rat
9590252	Scort12	Serum corticosterone level QTL 12	20.46	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	20	1	36600972	Rat
2305926	Iddm37	Insulin dependent diabetes mellitus QTL 37	6		blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	20	1527842	46527842	Rat
1641915	Colcr9	Colorectal carcinoma resistance QTL 9	2.97	0.0024	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	20	1530655	46530655	Rat
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	2606836	47606836	Rat
2317057	Aia27	Adjuvant induced arthritis QTL 27	2.83		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	20	2892597	26381954	Rat
61432	Cia1	Collagen induced arthritis QTL 1			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	20	3621656	14101050	Rat
4889857	Pur27	Proteinuria QTL 27	12.2	0.001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	4606607	17617956	Rat
1558640	Prcs2	Prostate cancer susceptibility QTL 2	3.3		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	20	4606607	17617956	Rat
70154	Insul2	Insulin level QTL 2	3.75		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	20	6691706	17489458	Rat
1581577	Pur15	Proteinuria QTL 15	4.38	0.0002	urine total protein amount (VT:0000032)	urine protein excretion rate (CMO:0000759)	20	8042410	17617956	Rat
4889870	Pur30	Proteinuria QTL 30	19	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	20	8042410	29322208	Rat
631265	Iresp1	Immunoglobin response QTL1	8.3		blood anti-double stranded DNA antibody amount (VT:0004762)	serum anti-DNA antibody level (CMO:0001533)	20	9039719	13461775	Rat
7411652	Foco24	Food consumption QTL 24		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	11757515	54435887	Rat
9590092	Insglur9	Insulin/glucose ratio QTL 9	18.38	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	20	11757515	54435887	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium		10	4	4		4			62	34	24
Low	3	33	53	37	19	37	6	8	12	1	14	11	6
Below cutoff							2	3			3		2

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001101016	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	JACYVU010000324	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000074783 ⟹ ENSRNOP00000066347

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	13,100,302 - 13,104,443 (+)	Ensembl
Rnor_6.0 Ensembl	20	14,050,537 - 14,054,695 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000089319 ⟹ ENSRNOP00000069288

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	20	14,050,465 - 14,060,264 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000093214

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	20	14,054,539 - 14,055,142 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000112215 ⟹ ENSRNOP00000077945

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	13,100,302 - 13,106,503 (+)	Ensembl

RefSeq Acc Id:

NM_001101016 ⟹ NP_001094486

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	20	13,100,302 - 13,106,503 (+)	NCBI
Rnor_6.0	20	14,050,465 - 14,056,670 (+)	NCBI
Rnor_5.0	20	16,235,987 - 16,242,192 (+)	NCBI
Celera	20	14,586,049 - 14,592,254 (+)	NCBI

Sequence:

show sequence

CCGCCTCCCTTCCACCCTCCCGGCGCCCGCCCGCGGCGGCCATGGGGGCGCGGCTGGGGCGGCG
GGCAAGAGCAGATGCCCCTGCGGCGCCGAGTGCTGGGCCCGCGCCCTACGAGCGCCGGGTGCGC
TGGCTGCGAGAGATCCAGTCCACACTCCGCGAGCGGCGGCCGGAGCGCGCTCGGCAGCTGCTGC
GCCTCCTGCGCCAGGACCTGGGCCTTGAAGGGAACCTCCTCACTGACATCCTCTACAGGAATGT
AACTTTCCTTAACCTGGTGGACCCCATCTCCCACGACCTGCTGGTGAACCTGGCCCGGGACCTG
CAGTGCCCCAAGAAGGACCATGAGCTCTGGAAGTCCTCGGATAAGATCTGTCGGCAACTCATCT
ACCACCTCACTCCTCACTCCAAGAGAAAACCCCACAGGAAAACCCAGAGCAGCCTCAAGAGCAG
CCTGCAGAAGACTCTGCTGGTAGGGGAGACTGTGGACCTTTCTGGTATCCCGCTCTCGGCCCGG
GATGTGCAGCACATATCTCGCTATTTGGACAGTCGTGGTGTAGAGCTGGTGGTCCTAGACCTGA
GCTTCACCGAGCTGAGCGATGACCTCCTGCATCTGCTGCTGCCCAGCCTCTGGGCTCTGCCCCG
CCTCACCCAGCTGCTGCTTAATGGCAACCGACTGACAAGAGCTGCTGCCCGTGAACTCACCGAG
GCTATCAAGGACGCCACCAAGTTCCCCGTGCTGGCCTGGGTGGACCTGGGTAACAATGTGGATG
TGTCTTCCCTTCCCCAGCCCTTGCTGGTTGGCCTACGAAGGCGACTGAGCCAGCACACCTCGCT
CCCGACCATCTATGAGGGCCTGGACCTCGAGCCTGGGGGTGGCATGGCCGAGACGACTGCTGCT
GTCTCCACCTGGGGCTCTGCAGCCACTGAGGCAGGACCAGAGCCTCAGGGTTGCTGTGCCAGGT
GACTGGCTACTGGTCTGGTTCAGTGCTAATGACTG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001094486	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_001094486 ⟸ NM_001101016

- UniProtKB:

A0A0G2JUZ2 (UniProtKB/TrEMBL), A0A8I5Y6W7 (UniProtKB/TrEMBL), A6JKJ7 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MGARLGRRARADAPAAPSAGPAPYERRVRWLREIQSTLRERRPERARQLLRLLRQDLGLEGNLL
TDILYRNVTFLNLVDPISHDLLVNLARDLQCPKKDHELWKSSDKICRQLIYHLTPHSKRKPHRK
TQSSLKSSLQKTLLVGETVDLSGIPLSARDVQHISRYLDSRGVELVVLDLSFTELSDDLLHLLL
PSLWALPRLTQLLLNGNRLTRAAARELTEAIKDATKFPVLAWVDLGNNVDVSSLPQPLLVGLRR
RLSQHTSLPTIYEGLDLEPGGGMAETTAAVSTWGSAATEAGPEPQGCCAR

hide sequence

RefSeq Acc Id:

ENSRNOP00000069288 ⟸ ENSRNOT00000089319

RefSeq Acc Id:

ENSRNOP00000066347 ⟸ ENSRNOT00000074783

RefSeq Acc Id:

ENSRNOP00000077945 ⟸ ENSRNOT00000112215

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-A0A0G2JUZ2-F1-model_v2	AlphaFold	A0A0G2JUZ2	1-306	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2318441	AgrOrtholog
BioCyc Gene	G2FUF-4142	BioCyc
Ensembl Genes	ENSRNOG00000046428	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000066347.3	UniProtKB/TrEMBL
	ENSRNOP00000077945	ENTREZGENE
	ENSRNOP00000077945.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000074783.4	UniProtKB/TrEMBL
	ENSRNOT00000112215	ENTREZGENE
	ENSRNOT00000112215.1	UniProtKB/TrEMBL
Gene3D-CATH	3.80.10.10	UniProtKB/TrEMBL
InterPro	L_dom-like	UniProtKB/TrEMBL
KEGG Report	rno:100365744	UniProtKB/TrEMBL
NCBI Gene	100365744	ENTREZGENE
PANTHER	LEUCINE-RICH REPEAT-CONTAINING PROTEIN 75B	UniProtKB/TrEMBL
	PTHR39654	UniProtKB/TrEMBL
PhenoGen	Lrrc75b	PhenoGen
Superfamily-SCOP	RNI-like	UniProtKB/TrEMBL
UniProt	A0A0G2JUZ2	ENTREZGENE
	A0A8I5Y6W7	ENTREZGENE, UniProtKB/TrEMBL
	A6JKJ7	ENTREZGENE, UniProtKB/TrEMBL
	M0RA11_RAT	UniProtKB/TrEMBL
	Q3KRG1_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-03-21	Lrrc75b	leucine rich repeat containing 75B	Fam211b	family with sequence similarity 211, member B	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-08-08	Fam211b	family with sequence similarity 211, member B	LOC100365744	hypothetical protein LOC100365744	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2013-05-24	LOC100365744	hypothetical protein LOC100365744	LOC687708	hypothetical protein LOC687708	Data Merged	1643240	APPROVED
2010-05-05	LOC100365744	hypothetical protein LOC100365744			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	LOC687708	hypothetical protein LOC687708			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar