Cd24 (CD24 molecule) - Rat Genome Database

Name: Cd24
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Cd24 (CD24 molecule) Rattus norvegicus

Analyze

Symbol:

Cd24

Name:

CD24 molecule

RGD ID:

2298

Description:

Predicted to enable several functions, including heat shock protein binding activity; protein kinase binding activity; and protein tyrosine kinase activator activity. Involved in immune response. Located in external side of plasma membrane. Human ortholog(s) of this gene implicated in multiple sclerosis. Orthologous to human CD24 (CD24 molecule); INTERACTS WITH 1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane; 1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane; 1-naphthyl isothiocyanate.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

CD24 antigen; Cd24a; heat-stable antigen; HSA; MGC93641; nectadrin heat stable antigen; nectadrin, heat stable antigen; signal transducer CD24

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	CD24 (CD24 molecule)	HGNC	Ensembl, Inparanoid, NCBI, OMA, Panther
Mus musculus (house mouse):	Cd24a (CD24a antigen)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Cd24 (CD24 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100982539 (signal transducer CD24)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	CD24 (CD24 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	LOC101968601 (signal transducer CD24)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	LOC100519934 (uncharacterized LOC100519934)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	CD24 (CD24 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Cd24 (CD24 molecule)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Cd24a (CD24a antigen)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	CD24 (CD24 molecule)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	20	47,074,353 - 47,079,662 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	47,073,512 - 47,079,662 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	48,789,167 - 48,794,459 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	48,439,001 - 48,444,293 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	49,123,655 - 49,128,973 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	48,335,540 - 48,340,847 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	48,335,540 - 48,340,846 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	49,989,320 - 49,994,627 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	47,502,354 - 47,507,663 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	47,531,055 - 47,536,352 (+)	NCBI
Celera	20	52,908,730 - 52,914,027 (-)	NCBI		Celera
RH 3.4 Map	20	495.52	RGD
RH 3.4 Map	20	493.45	RGD
Cytogenetic Map	20	q13	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Experimental Liver Cirrhosis (ISO)

multiple sclerosis (ISO)

pancreatic cancer (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,1,1-trichloro-2,2-bis(4-hydroxyphenyl)ethane (EXP)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (EXP,ISO)

1,2-dimethylhydrazine (ISO)

1-naphthyl isothiocyanate (EXP)

17alpha-ethynylestradiol (EXP,ISO)

17beta-estradiol (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-amino-2-deoxy-D-glucopyranose (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

3-chloropropane-1,2-diol (EXP)

3-Nitrobenzanthrone (ISO)

4-(ethoxymethylene)-2-phenyloxazol-5-one (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (EXP,ISO)

afimoxifene (ISO)

aflatoxin B1 (EXP,ISO)

aldehydo-D-glucosamine (ISO)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

antimycin A (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

arsenous acid (ISO)

azoxystrobin (ISO)

bacitracin (EXP)

belinostat (ISO)

benzo[a]pyrene (ISO)

beta-D-glucosamine (ISO)

beta-naphthoflavone (EXP)

bisphenol A (EXP,ISO)

butanal (ISO)

calcitriol (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

casticin (ISO)

CGP 52608 (ISO)

chloropicrin (ISO)

choline (ISO)

chromium atom (ISO)

cisplatin (EXP,ISO)

clofibrate (ISO)

cobalt dichloride (EXP,ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

coumestrol (ISO)

Cuprizon (EXP)

cyproconazole (ISO)

deguelin (ISO)

dexamethasone (EXP,ISO)

diarsenic trioxide (ISO)

dibenz[a,h]anthracene (ISO)

dibutyl phthalate (ISO)

Didecyldimethylammonium (ISO)

diethylstilbestrol (ISO)

diuron (EXP)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

entinostat (ISO)

eugenol (ISO)

fenpyroximate (ISO)

fenvalerate (EXP)

folic acid (ISO)

fulvestrant (ISO)

furan (EXP)

genistein (ISO)

gentamycin (EXP)

griseofulvin (ISO)

hexachlorobenzene (EXP)

indole-3-methanol (EXP)

inulin (ISO)

isobutanol (ISO)

ketamine (EXP)

L-ascorbic acid (ISO)

L-methionine (ISO)

lapatinib (ISO)

lipopolysaccharide (ISO)

maneb (ISO)

methotrexate (ISO)

methoxychlor (EXP)

methylmercury chloride (ISO)

microcystin-LR (EXP)

mifepristone (EXP)

mono(2-ethylhexyl) phthalate (ISO)

Monobutylphthalate (ISO)

N-methyl-4-phenylpyridinium (EXP)

N-nitrosodiethylamine (EXP)

nickel atom (ISO)

ochratoxin A (ISO)

orphenadrine (EXP)

oxaliplatin (EXP,ISO)

ozone (EXP)

paclitaxel (ISO)

panobinostat (ISO)

paracetamol (EXP,ISO)

paraquat (ISO)

perfluorooctane-1-sulfonic acid (EXP,ISO)

phenobarbital (ISO)

PhIP (EXP)

picoxystrobin (ISO)

pirinixic acid (ISO)

potassium chromate (ISO)

progesterone (ISO)

pyrimidifen (ISO)

quercetin (ISO)

raloxifene (ISO)

resveratrol (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

sarin (ISO)

SB 431542 (ISO)

silver atom (ISO)

silver(0) (ISO)

simvastatin (ISO)

sodium arsenite (EXP,ISO)

Soman (EXP)

streptozocin (ISO)

succimer (ISO)

sulforaphane (ISO)

T-2 toxin (ISO)

tamoxifen (EXP,ISO)

tebufenpyrad (ISO)

temozolomide (ISO)

tert-butyl hydroperoxide (ISO)

testosterone (EXP,ISO)

tetrachloromethane (ISO)

thalidomide (ISO)

thifluzamide (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

toluene 2,4-diisocyanate (ISO)

topotecan (EXP,ISO)

Trapidil (EXP)

trichloroethene (EXP)

trichostatin A (ISO)

triclosan (ISO)

Triptolide (ISO)

trovafloxacin (ISO)

tunicamycin (ISO)

ubiquinone-0 (ISO)

valproic acid (ISO)

vancomycin (EXP,ISO)

zinc atom (EXP)

zinc(0) (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

apoptotic mitochondrial changes (ISO)

apoptotic nuclear changes (ISO)

apoptotic signaling pathway (ISO)

B cell apoptotic process (ISO)

B cell proliferation (ISO)

B cell receptor transport into membrane raft (ISO,ISS)

calcium-mediated signaling (ISO)

CD4-positive, alpha-beta T cell proliferation (ISO)

cell activation (ISO,ISS)

cell adhesion (IEA)

cell migration (ISO,ISS)

cell surface receptor signaling pathway (ISO)

chemokine receptor transport out of membrane raft (ISO,ISS)

cholesterol homeostasis (ISO,ISS)

glomerular parietal epithelial cell differentiation (ISO,ISS)

heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules (ISO)

homotypic cell-cell adhesion (ISO)

immune response (IEP)

integrin activation (ISO)

leukocyte cell-cell adhesion (ISO)

leukocyte migration involved in inflammatory response (ISO)

negative regulation of B cell proliferation (ISO)

negative regulation of erythrocyte aggregation (ISO)

negative regulation of erythrocyte clearance (ISO)

negative regulation of inflammatory response to wounding (ISO)

negative regulation of interleukin-6 production (ISO)

negative regulation of monocyte chemotactic protein-1 production (ISO)

negative regulation of neuroblast proliferation (ISO)

negative regulation of neurogenesis (ISO)

negative regulation of neuron differentiation (ISO)

negative regulation of T cell homeostatic proliferation (ISO)

negative regulation of transforming growth factor beta3 production (ISO,ISS)

negative regulation of tumor necrosis factor production (ISO)

neuroblast proliferation (ISO)

neuromuscular synaptic transmission (ISO)

neuron projection development (ISO)

podocyte differentiation (ISO,ISS)

positive regulation of activated T cell proliferation (ISO,ISS)

positive regulation of alpha-beta T cell proliferation (ISO)

positive regulation of B cell apoptotic process (ISO)

positive regulation of calcium-mediated signaling (ISO)

positive regulation of CD4-positive, alpha-beta T cell proliferation (ISO)

positive regulation of cell adhesion mediated by integrin (ISO)

positive regulation of cell-cell adhesion (ISO)

positive regulation of cell-cell adhesion mediated by integrin (ISO)

positive regulation of cytosolic calcium ion concentration (ISO,ISS)

positive regulation of inflammatory response to antigenic stimulus (ISO)

positive regulation of inflammatory response to wounding (ISO)

positive regulation of integrin activation (ISO)

positive regulation of nephron tubule epithelial cell differentiation (ISO,ISS)

positive regulation of neuron projection development (ISO)

positive regulation of peptidyl-tyrosine phosphorylation (ISO)

positive regulation of T cell homeostatic proliferation (ISO)

positive regulation of T cell mediated immune response to tumor cell (ISO)

pre-B cell differentiation (ISO)

regulation of B cell differentiation (ISO)

regulation of cell-cell adhesion (ISO)

regulation of cell-cell adhesion mediated by integrin (ISO)

regulation of cytokine-mediated signaling pathway (ISO,ISS)

regulation of MAPK cascade (ISO,ISS)

regulation of phosphorylation (ISO,ISS)

respiratory burst (ISO,ISS)

response to estrogen (ISO,ISS)

response to hypoxia (ISO,ISS)

response to molecule of bacterial origin (ISO,ISS)

synaptic vesicle endocytosis (ISO)

T cell costimulation (ISO,ISS)

T cell homeostatic proliferation (ISO)

Cellular Component

cell surface (ISO,ISS)

ciliary membrane (ISO)

external side of plasma membrane (IDA,ISO)

intracellular membrane-bounded organelle (ISO)

membrane (IEA,ISO,ISS)

membrane raft (ISO,ISS)

microvillus membrane (ISO)

motile cilium (ISO)

plasma membrane (ISO)

presynapse (IEA)

Molecular Function

carbohydrate binding (ISO)

Hsp70 protein binding (ISO)

Hsp90 protein binding (ISO)

protein binding (ISO)

protein kinase binding (ISO,ISS)

protein tyrosine kinase activator activity (ISO,ISS)

References

References - curated

#	Reference Title	Reference Citation
1.	Signal transduction in lymphocytic and myeloid cells via CD24, a new member of phosphoinositol-anchored membrane molecules.	Fischer GF, etal., J Immunol. 1990 Jan 15;144(2):638-41.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Lipid rafts clustering and signalling by listeriolysin O.	Gekara NO and Weiss S, Biochem Soc Trans. 2004 Nov;32(Pt 5):712-4.
4.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
5.	Expression of HIS50 Ag: a rat homologue of mouse heat-stable antigen and human CD24 on B lymphoid cells in the rat.	Hermans MH, etal., Immunology. 1997 Jan;90(1):14-22.
6.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
7.	CD24 and myosin light polypeptide 2 are involved in prevention of experimental autoimmune encephalomyelitis by myelin basic protein-pulsed dendritic cells.	Liu X, etal., J Neuroimmunol. 2006 Mar;172(1-2):137-44. Epub 2005 Dec 27.
8.	Activation of human monocytes and granulocytes by monoclonal antibodies to glycosylphosphatidylinositol-anchored antigens.	Lund-Johansen F, etal., Eur J Immunol. 1993 Nov;23(11):2782-91.
9.	CD24 (heat stable antigen, nectadrin), a novel keratinocyte differentiation marker, is preferentially expressed in areas of the hair follicle containing the colony-forming cells.	Magnaldo T and Barrandon Y, J Cell Sci 1996 Dec;109 ( Pt 13):3035-45.
10.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
11.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
12.	GOA pipeline	RGD automated data pipeline
13.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
14.	Antibodies recognizing CD24 LAP epitope on human T cells enhance CD28 and IL-2 T cell proliferation.	Salamone MC, etal., J Leukoc Biol. 2001 Feb;69(2):215-23.
15.	CD24 affects CXCR4 function in pre-B lymphocytes and breast carcinoma cells.	Schabath H, etal., J Cell Sci. 2006 Jan 15;119(Pt 2):314-25. Epub 2006 Jan 3.
16.	Modulation of gene expression by hypoxia in human umbilical cord vein endothelial cells: A transcriptomic and proteomic study.	Scheurer SB, etal., Proteomics. 2004 Jun;4(6):1737-60.
17.	Gene expression of CD24 core peptide molecule in developing brain and developing non-neural tissues.	Shirasawa T, etal., Dev Dyn 1993 Sep;198(1):1-13.
18.	Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.	Strausberg RL, etal., Proc Natl Acad Sci U S A. 2002 Dec 24;99(26):16899-903. Epub 2002 Dec 11.
19.	CD24 induces apoptosis in human B cells via the glycolipid-enriched membrane domains/rafts-mediated signaling system.	Suzuki T, etal., J Immunol. 2001 May 1;166(9):5567-77.
20.	Pre-B cell antigen receptor-mediated signal inhibits CD24-induced apoptosis in human pre-B cells.	Taguchi T, etal., J Immunol. 2003 Jan 1;170(1):252-60.
21.	Tentative Sequence Identification Numbers	Tentative Sequence Data IDs. TIGR Gene Index, Rat Data
22.	Combining SSH and cDNA microarrays for rapid identification of differentially expressed genes.	Yang GP, etal., Nucleic Acids Res. 1999 Mar 15;27(6):1517-23.
23.	Regulation of E-cadherin and TGF-beta3 expression by CD24 in cultured oral epithelial cells.	Ye P, etal., Biochem Biophys Res Commun. 2006 Oct 13;349(1):229-35. Epub 2006 Aug 14.
24.	Association of CD24 with the kinase c-fgr in a small cell lung cancer cell line and with the kinase lyn in an erythroleukemia cell line.	Zarn JA, etal., Biochem Biophys Res Commun. 1996 Aug 14;225(2):384-91.
25.	CD24 is a genetic modifier for risk and progression of multiple sclerosis.	Zhou Q, etal., Proc Natl Acad Sci U S A 2003 Dec 9;100(25):15041-6. Epub 2003 Dec 1.

Additional References at PubMed

PMID:1346270	PMID:1383383	PMID:1385153	PMID:2118158	PMID:7477352	PMID:7534304	PMID:7613634	PMID:7669058	PMID:7774619	PMID:7795661	PMID:7807014	PMID:7908303
PMID:8117278	PMID:8125140	PMID:8145052	PMID:8543797	PMID:8557754	PMID:8562500	PMID:8889548	PMID:8920854	PMID:8943715	PMID:9028339	PMID:9177270	PMID:9324354
PMID:9368605	PMID:10365441	PMID:10601245	PMID:10791997	PMID:10943842	PMID:11283023	PMID:11978835	PMID:12657681	PMID:12882831	PMID:12940824	PMID:14707049	PMID:14990792
PMID:15314074	PMID:15477346	PMID:15489334	PMID:15633604	PMID:15737737	PMID:16288985	PMID:16532032	PMID:16606832	PMID:16769998	PMID:16885410	PMID:17545040	PMID:18776904
PMID:18958875	PMID:19092120	PMID:19103603	PMID:19264983	PMID:19299737	PMID:19458237	PMID:19487454	PMID:20103531	PMID:21323829	PMID:22732588	PMID:26935354

Genomics

Comparative Map Data

Cd24
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	20	47,074,353 - 47,079,662 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	20	47,073,512 - 47,079,662 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	20	48,789,167 - 48,794,459 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	20	48,439,001 - 48,444,293 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	20	49,123,655 - 49,128,973 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	20	48,335,540 - 48,340,847 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	20	48,335,540 - 48,340,846 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	20	49,989,320 - 49,994,627 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	20	47,502,354 - 47,507,663 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	20	47,531,055 - 47,536,352 (+)	NCBI
Celera	20	52,908,730 - 52,914,027 (-)	NCBI		Celera
RH 3.4 Map	20	495.52	RGD
RH 3.4 Map	20	493.45	RGD
Cytogenetic Map	20	q13	NCBI

CD24
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	106,969,831 - 106,976,855 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	106,969,831 - 106,975,627 (-)	Ensembl	GRCh38		hg38	GRCh38
Build 36	6	21,152,527 - 21,154,705	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	Y	19,540,683 - 19,542,776	NCBI
Celera	Y	6,620,552 - 6,622,554 (+)	NCBI		Celera
Cytogenetic Map	6	q21	NCBI
HuRef	6	104,864,115 - 104,868,879 (-)	NCBI		HuRef
T2T-CHM13v2.0	6	108,145,896 - 108,152,920 (-)	NCBI		T2T-CHM13v2.0

Cd24a
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	43,454,433 - 43,460,261 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	43,454,280 - 43,460,261 (+)	Ensembl		GRCm39 Ensembl
GRCm38	10	43,579,169 - 43,584,265 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	43,578,284 - 43,584,265 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	10	43,298,975 - 43,304,071 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	10	43,267,584 - 43,272,680 (+)	NCBI		MGSCv36	mm8
Celera	10	44,451,209 - 44,456,305 (+)	NCBI		Celera
Cytogenetic Map	10	B2	NCBI
cM Map	10	23.01	NCBI

Cd24
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955411	32,270,881 - 32,275,236 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955411	32,270,881 - 32,275,236 (-)	NCBI	ChiLan1.0	ChiLan1.0

LOC100982539
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	6	124,877,952 - 124,882,093 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	104,783,720 - 104,789,509 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	35,991,289 - 35,993,436 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	108,655,624 - 108,657,847 (-)	NCBI	panpan1.1		panPan2

CD24
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	12	64,239,957 - 64,245,114 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	12	64,026,788 - 64,032,059 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	12	65,083,676 - 65,088,953 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	12	64,443,727 - 64,448,980 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	12	64,287,882 - 64,293,144 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	12	64,561,114 - 64,566,403 (-)	NCBI		UU_Cfam_GSD_1.0

LOC101968601
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024406292	11,864,267 - 11,864,552 (-)	NCBI		HiC_Itri_2
SpeTri2.0	NW_004936491	16,706,745 - 16,707,010 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

LOC100519934
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	1	73,119,758 - 73,124,368 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	82,267,687 - 82,273,306 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

CD24
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	13	66,863,164 - 66,868,951 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666040	39,191,025 - 39,196,629 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Cd24
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624780	15,287,433 - 15,292,292 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624780	15,287,426 - 15,292,292 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Cd24
44 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	511
Count of miRNA genes:	266
Interacting mature miRNAs:	332
Transcripts:	ENSRNOT00000000352
Prediction methods:	Microtar, Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1598816	Memor12	Memory QTL 12	2.4		exploratory behavior trait (VT:0010471)	average horizontal distance between subject and target during voluntary locomotion in an experimental apparatus (CMO:0002674)	20	2606836	47606836	Rat
7411652	Foco24	Food consumption QTL 24		0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	20	11757515	54435887	Rat
9590092	Insglur9	Insulin/glucose ratio QTL 9	18.38	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	20	11757515	54435887	Rat
4889610	Pancm3	Pancreatic morphology QTL 3	3.75	0.001	pancreas mass (VT:0010144)	pancreas wet weight (CMO:0000626)	20	17617832	47606836	Rat
2317880	Alcrsp25	Alcohol response QTL 25	2.3		response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	20	17697550	54435887	Rat
2303626	Vencon10	Ventilatory control QTL 10		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	20	19190721	54435887	Rat
2303578	Gluco50	Glucose level QTL 50	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	20	25106722	54435887	Rat
2303587	Bw93	Body weight QTL 93	13		body mass (VT:0001259)	body weight (CMO:0000012)	20	25106722	54435887	Rat
2300188	Bmd68	Bone mineral density QTL 68	6.4	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	20	25106722	54435887	Rat
1331747	Hrtrt16	Heart rate QTL 16	3.163		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	20	25209734	54435887	Rat
1598869	Memor6	Memory QTL 6	3.1		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	20	29244388	54435887	Rat

Markers in Region

RH94631

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	8	21,018,517 - 21,018,694 (+)	MAPPER	mRatBN7.2
mRatBN7.2	20	47,079,150 - 47,079,328 (+)	MAPPER	mRatBN7.2
Rnor_6.0	8	23,497,113 - 23,497,289	NCBI	Rnor6.0
Rnor_6.0	20	48,340,337 - 48,340,513	NCBI	Rnor6.0
Rnor_5.0	20	49,994,117 - 49,994,293	UniSTS	Rnor5.0
Rnor_5.0	8	23,544,800 - 23,544,976	UniSTS	Rnor5.0
RGSC_v3.4	20	47,507,152 - 47,507,329	UniSTS	RGSC3.4
Celera	20	52,909,064 - 52,909,241	UniSTS
Cytogenetic Map	20	q13	UniSTS

RH142320

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	47,079,038 - 47,079,191 (+)	MAPPER	mRatBN7.2
mRatBN7.2	20	47,079,038 - 47,079,191 (-)	MAPPER	mRatBN7.2
mRatBN7.2	8	21,018,653 - 21,018,804 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	48,340,226 - 48,340,377	NCBI	Rnor6.0
Rnor_6.0	8	23,497,249 - 23,497,399	NCBI	Rnor6.0
Rnor_5.0	20	49,994,006 - 49,994,157	UniSTS	Rnor5.0
Rnor_5.0	8	23,544,936 - 23,545,086	UniSTS	Rnor5.0
RGSC_v3.4	20	47,507,040 - 47,507,192	UniSTS	RGSC3.4
Celera	20	52,909,201 - 52,909,353	UniSTS
RH 3.4 Map	20	495.52	UniSTS
Cytogenetic Map	20	q13	UniSTS

BE116382

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	20	47,075,580 - 47,075,760 (+)	MAPPER	mRatBN7.2
Rnor_6.0	20	48,336,768 - 48,336,947	NCBI	Rnor6.0
Rnor_5.0	20	49,990,548 - 49,990,727	UniSTS	Rnor5.0
RGSC_v3.4	20	47,503,582 - 47,503,761	UniSTS	RGSC3.4
Celera	20	52,912,632 - 52,912,811	UniSTS
RH 3.4 Map	20	495.9	UniSTS
Cytogenetic Map	20	q13	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High	1								16
Medium	2	20	24	14	13	14	6	9	58	35	32	11	6
Low		23	33	27	6	27	2	2			9		2
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012752	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	BC064439	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC081851	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CA509517	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474025	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	DY315580	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212648	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ225035	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000330	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U49062	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	Z11663	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000000352 ⟹ ENSRNOP00000000352

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	47,075,216 - 47,079,662 (+)	Ensembl
Rnor_6.0 Ensembl	20	48,335,540 - 48,340,846 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000109979 ⟹ ENSRNOP00000085201

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	20	47,073,512 - 47,079,654 (+)	Ensembl

RefSeq Acc Id:

NM_012752 ⟹ NP_036884

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	20	47,074,353 - 47,079,662 (+)	NCBI
Rnor_6.0	20	48,335,540 - 48,340,847 (+)	NCBI
Rnor_5.0	20	49,989,320 - 49,994,627 (+)	NCBI
RGSC_v3.4	20	47,502,354 - 47,507,663 (+)	RGD
Celera	20	52,908,730 - 52,914,027 (-)	RGD

Sequence:

show sequence

TGCGTCCGCGCCAGCCGAGCACATCTCCACGCACCGAGCATCCAGAGAGTCGCGCCGCGCGCCG
ACGGAGCGGACATGGGCAGAGCGATGGTGGTCAGGCTAGGGCTGGGGTTGCTGCTTCTGGCACT
GCTCCTACCCACGCAGATTTATTGCAACCAAACATCGGTTGCACCATTTTCCGGGAACCAGAGT
ATCTCTGCTGCCCCAAATCCAACTAATGCTACCACCAGATCTGGGTGTAGCTCCCTGCAGTCCA
CAGCCGGTCTCCTGGCCCTCTCTCTCTCTCTCCTACATCTCTACTGTTAGAGACTCAGGCCAAG
AAACGTCTCTACTTCCCCATCTAGACCCACCCCGAATGGCAACCACAAGTCCAATGTGAGTGAC
CAGGAAGAGACAGGTCCACATCAAATCGGCTGTTACCATTACCTCAACAGAAAACACTGAGAAT
CCGAAATTCGACTGGCTTAAAGGACGCGTGAAGGGTTTGAGAGCTGAGAGATGCCAATATGGGA
TCTGCTGGAGTTTTATGTCCGAGATGAAGACAAGCATCCAAAATTGACGTGATTTGCTCGAAAT
GTGGCTTAAGAAATGTGGACACTTAAAACTCTCACTCGAAATCGGGCGTAGGTTTGATGTAGAG
GGAGAAGGATGGGGTGTGGAATGGAGGTCCATTATTTTCATTGGTTCCTTCGACCTATAAGGCC
ATAATGCAGTTAGGTGGTATTCAAAAGCTTCTCTGATGCTATTTCTGTGTATGTTGGAAGGAAC
TACCAGGTGTTATTTTAAATCCCCGATGTGTTGTTTTGTTACTACTAATTTAATAGGCTAAACT
CTAGGTGAAGTCCCACGTCGTTGACCTCTAGTTCTTCTCTCCGGAACAGAACGTTTTACACCCT
CCTTCTGTGGCTTTAGGTCTGACATATTGTATTTGACCTTTGTTAGTAATTGACACGGGCCAGG
CAACGATGGATTGGAACCCACCCCCAAATCCAGCCACCCCTGAGTAAATCTGATTTCAAAAGTC
ACAACGGCAAAGCATTTCCCAGTGTCTTTTCTCACTCACCACGGGTACTAAGTTCACTTAGGTG
AGCTGGTTCTCCAGAGAGCAGAATTCTGTTGATCTCGGCTAATCTCCAAACGCTGCGTTTTATT
TTGGCATATGTCGAGGGCTTTTCATGATTTAAAGCGTGGTCTGTTAGCAAGGCCAAAATTATGA
GTCTTGAAATTCTACAGGCAAATATGCAACCCAGCATTTGGGATGTGAGGACTGGAAGCTCTCA
CAGAATTCACAAAGTCTTTTATACAATTTCTGTAAATACTTTTTTTTTTTTAAAGAGAAAAACA
AAACCATGGATCGGAATAACCACGTTTGGAATACTTTGGTTATCAGTTCATATTTTTAGATAGT
TTGACATTGGTCCTGTGCCTGAGAGGGGGTTTGGTTCTACAGTAAGTTTTTTTTTTTCCCCCAA
TTTCCTTGATACACACATACCTTCTAAAACACAGACATTTCCTCAAAAAAAAAAAAAAATTCCT
TTTGTTCGCATGGTCACACACTGATGCTTGCCCATTCTGGGATCTAATACGGTCACAGTAGTCT
TGATAACCAGAATCATTTTTTTCTCCGTCTTTAGAAACCTACCCGGGAACAAGGAGACCTCACA
GACCCGAAGCTACTGTGTGTGTGAATGAACACTCCCCTTGCCTCATACCCGAATGCTGTACATC
TATTTGATTGTATATTGTGTTTGTGTATTTATGCTTTGATTCATAGTAACTTCTCATGTTATGG
AATTGATTTGCATTGAACACAAACTGTAAATAAAAGAAAGAAATGGCTGAAAGAGCAAAAAAAA
AAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_036884	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA91470	(Get FASTA)	NCBI Sequence Viewer
	AAH64439	(Get FASTA)	NCBI Sequence Viewer
	AAH81851	(Get FASTA)	NCBI Sequence Viewer
	CAA77731	(Get FASTA)	NCBI Sequence Viewer
	EDL99685	(Get FASTA)	NCBI Sequence Viewer
	Q07490	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_036884 ⟸ NM_012752
- Peptide Label:	precursor
- UniProtKB:	Q0P5T1 (UniProtKB/Swiss-Prot), Q07490 (UniProtKB/Swiss-Prot), A6K6W7 (UniProtKB/TrEMBL)
- Sequence:	show sequence MGRAMVVRLGLGLLLLALLLPTQIYCNQTSVAPFSGNQSISAAPNPTNATTRSGCSSLQSTAGL LALSLSLLHLYC hide sequence

RefSeq Acc Id:

ENSRNOP00000000352 ⟸ ENSRNOT00000000352

RefSeq Acc Id:

ENSRNOP00000085201 ⟸ ENSRNOT00000109979

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q07490-F1-model_v2	AlphaFold	Q07490	1-76	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2298	AgrOrtholog
BioCyc Gene	G2FUF-3339	BioCyc
Ensembl Genes	ENSRNOG00000000321	Ensembl, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000000352.4	UniProtKB/TrEMBL
	ENSRNOP00000085201.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000000352.6	UniProtKB/TrEMBL
	ENSRNOT00000109979.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:5623514	IMAGE-MGC_LOAD
	IMAGE:7110912	IMAGE-MGC_LOAD
InterPro	CD24	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:25145	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:72544	IMAGE-MGC_LOAD
	MGC:93641	IMAGE-MGC_LOAD
NCBI Gene	25145	ENTREZGENE
PANTHER	PTHR16676	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SIGNAL TRANSDUCER CD24	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	CD24	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Cd24	PhenoGen
TIGR	TC216491
	TC216492
UniProt	A0A8I6A2R9_RAT	UniProtKB/TrEMBL
	A0A8L2PZU1_RAT	UniProtKB/TrEMBL
	A6K6W7	ENTREZGENE, UniProtKB/TrEMBL
	CD24_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
	Q0P5T1	ENTREZGENE
UniProt Secondary	Q0P5T1	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-06-27	Cd24	CD24 molecule	Cd24	CD24 antigen	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-06-10	Cd24	CD24 antigen			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	transmembrane glycoprotein anchored in membrane via GPI anchor	634713
gene_expression	expressed in keratinocytes	634712
gene_expression	expressed in postmitotic cells of spinal cord, hindbrain, midbrain, and forebrain in embryos; expression is strongly downregulated in adult brain	634713
gene_process	involved in cell-cell adhesion and signaling	634712
gene_process	may be involved in migration of neurons on astroglial processes during development	634713

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD