Cbr1l1 (carbonyl reductase 1 like 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Cbr1l1 (carbonyl reductase 1 like 1) Rattus norvegicus

Analyze

No known orthologs.

Symbol:

Cbr1l1 (Ensembl: Cbr1)

Name:

carbonyl reductase 1 like 1 (Ensembl:carbonyl reductase)

RGD ID:

2286

Description:

Enables carbonyl reductase (NADPH) activity. Involved in several processes, including ovulation from ovarian follicle; phylloquinone catabolic process; and prostaglandin catabolic process. Located in microvillus; nucleus; and plasma membrane. Biomarker of chronic kidney disease. Orthologous to human CBR1 (carbonyl reductase 1); PARTICIPATES IN acetylsalicylic acid pharmacodynamics pathway; antipyrine drug pathway; arachidonic acid metabolic pathway; .

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

15-hydroxyprostaglandin dehydrogenase; 20-beta-hydroxysteroid dehydrogenase; alcohol dehydrogenase [NAD(P)+] CBR1; carbonyl reductase; carbonyl reductase 1; carbonyl reductase [NADPH] 1; Cbr; Cbr 1; Cbr1; MGC124927; NADPH-dependent carbonyl reductase 1; PG-9-KR; prostaglandin 9-ketoreductase; prostaglandin-E(2) 9-reductase

RGD Orthologs

Alliance Genes

More Info

homologs ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Other homologs ²				less info ...
Homo sapiens (human):	CBR1 (carbonyl reductase 1)	HGNC	HomoloGene, Panther
Alliance orthologs ³
Homo sapiens (human):	CBR1 (carbonyl reductase 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Mus musculus (house mouse):	Cbr1 (carbonyl reductase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Gm5678 (predicted gene 5678)	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|PANTHER)
Danio rerio (zebrafish):	cbr1 (carbonyl reductase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	cbr1l (carbonyl reductase 1-like)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	11	32,860,618 - 32,862,981 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	11	32,908,950 - 32,911,393 (+)	Ensembl		mRatBN7.2 Ensembl
mRatBN7.2 Ensembl	11	32,857,991 - 32,895,275 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	11	41,554,857 - 41,557,234 (+)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	11	34,226,398 - 34,228,775 (+)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	11	33,387,189 - 33,389,552 (+)	NCBI	Rnor_WKY
Rnor_6.0	11	33,813,041 - 33,815,418 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	11	33,845,463 - 33,847,793 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	11	37,436,992 - 37,439,368 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	11	33,787,957 - 33,790,320 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	11	33,844,199 - 33,846,562 (+)	NCBI
Celera	11	32,503,106 - 32,505,469 (+)	NCBI		Celera
RH 3.4 Map	11	248.5	RGD
Cytogenetic Map	11	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

chronic kidney disease (IEP)

Experimental Diabetes Mellitus (IEP)

Fever (IEP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

epithelial cell differentiation (ISO)

glucocorticoid metabolic process (ISO)

ovulation from ovarian follicle (IEP)

phylloquinone catabolic process (IDA)

positive regulation of reactive oxygen species metabolic process (ISO)

prostaglandin catabolic process (IDA)

response to estradiol (IDA)

response to gonadotropin (IEP)

response to lipopolysaccharide (IEP)

response to progesterone (IDA)

response to testosterone (IEP)

steroid catabolic process (IDA)

vitamin K metabolic process (ISO,ISS)

xenobiotic metabolic process (ISO,ISS)

Cellular Component

cytoplasm (IEA)

intracellular membrane-bounded organelle (IDA)

microvillus (IDA)

nucleus (IDA)

plasma membrane (IDA)

subapical complex (ISO)

Molecular Function

15-hydroxyprostaglandin dehydrogenase (NADP+) activity (ISS)

15-hydroxyprostaglandin-D dehydrogenase (NADP+) activity (IEA)

alcohol dehydrogenase (NADP+) activity (IEA)

carbonyl reductase (NADPH) activity (IBA,IDA,IEA,ISO,ISS)

oxidoreductase activity (IBA)

oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor (ISO)

oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor (ISO)

prostaglandin-E2 9-reductase activity (ISS)

protein binding (IPI)

Molecular Pathway Annotations Click to see Annotation Detail View

acetylsalicylic acid pharmacodynamics pathway (ISO)

antipyrine drug pathway (ISO)

arachidonic acid metabolic pathway (IEA,ISO)

celecoxib pharmacodynamics pathway (ISO)

diclofenac pharmacodynamics pathway (ISO)

diflunisal pharmacodynamics pathway (ISO)

dopa responsive dystonia pathway (ISO)

doxorubicin pharmacokinetics pathway (ISO)

etodolac pharmacodynamics pathway (ISO)

fenoprofen pharmacodynamics pathway (ISO)

flurbiprofen pharmacodynamics pathway (ISO)

ibuprofen pharmacodynamics pathway (ISO)

indometacin pharmacodynamics pathway (ISO)

ketoprofen pharmacodynamics pathway (ISO)

ketorolac pharmacodynamics pathway (ISO)

leukotriene C4 synthase deficiency pathway (ISO)

lornoxicam pharmacodynamics pathway (ISO)

magnesium salicylate pharmacodynamics pathway (ISO)

mefenamic acid pharmacodynamics pathway (ISO)

meloxicam pharmacodynamics pathway (ISO)

nabumetone pharmacodynamics pathway (ISO)

naproxen pharmacodynamics pathway (ISO)

paracetamol drug pathway (ISO)

piroxicam pharmacodynamics pathway (ISO)

prostaglandin biosynthetic pathway (ISO)

salicylic acid pharmacodynamics pathway (ISO)

Segawa syndrome pathway (ISO)

sodium salicylate pharmacodynamics pathway (ISO)

sulindac pharmacodynamics pathway (ISO)

tenoxicam pharmacodynamics pathway (ISO)

tiaprofenic acid pharmacodynamics pathway (ISO)

tolmetin pharmacodynamics pathway (ISO)

valdecoxib pharmacodynamics pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Effect of experimental kidney disease on the functional expression of hepatic reductases.	Alshogran OY, etal., Drug Metab Dispos. 2015 Jan;43(1):100-6. doi: 10.1124/dmd.114.061150. Epub 2014 Oct 20.
2.	Identification of two closely related genes, inducible and noninducible carbonyl reductases in the rat ovary.	Aoki H, etal., Biochem Biophys Res Commun 1997 Jan 23;230(3):518-23.
3.	Effects of gonadectomy and steroid treatment on renal prostaglandin 9-ketoreductase activity in the rat.	Cagen LM and Baer PG, Life Sci. 1987 Jan 5;40(1):95-100.
4.	Temporal and spatial patterns of ovarian gene transcription following an ovulatory dose of gonadotropin in the rat.	Espey LL and Richards JS, Biol Reprod. 2002 Dec;67(6):1662-70.
5.	Characterization of ovarian carbonyl reductase gene expression during ovulation in the gonadotropin-primed immature Rat.	Espey LL, etal., Biol Reprod 2000 Feb;62(2):390-7.
6.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
7.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
8.	Differential hormonal regulation of carbonyl reductase activities in liver and kidney microsomes of rat.	Imamura Y, etal., Xenobiotica 2002 Sep;32(9):729-37.
9.	Expression of genes controlling transport and catabolism of prostaglandin E2 in lipopolysaccharide fever.	Ivanov AI, etal., Am J Physiol Regul Integr Comp Physiol. 2003 Mar;284(3):R698-706. Epub 2002 Oct 24.
10.	KEGG: Kyoto Encyclopedia of Genes and Genomes	KEGG
11.	Proteomic and transcriptomic analysis for streptozotocin-induced diabetic rat pancreas in response to fungal polysaccharide treatments.	Kim SW, etal., Proteomics. 2008 Jun;8(11):2344-61.
12.	High-density rat radiation hybrid maps containing over 24,000 SSLPs, genes, and ESTs provide a direct link to the rat genome sequence.	Kwitek AE, etal., Genome Res. 2004 Apr;14(4):750-7
13.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
14.	Synaptotagmin 11 interacts with components of the RNA-induced silencing complex RISC in clonal pancreatic beta-cells.	Milochau A, etal., FEBS Lett. 2014 Jun 27;588(14):2217-22. doi: 10.1016/j.febslet.2014.05.031. Epub 2014 May 29.
15.	New developments in anthracycline-induced cardiotoxicity.	Mordente A, etal., Curr Med Chem. 2009;16(13):1656-72.
16.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
17.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
18.	GOA pipeline	RGD automated data pipeline
19.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
20.	Mutation of threonine-241 to proline eliminates autocatalytic modification of human carbonyl reductase.	Sciotti MA, etal., Biochem J. 2000 Aug 15;350 Pt 1:89-92.
21.	Differences in catalytic activity between rat testicular and ovarian carbonyl reductases are due to two amino acids.	Sciotti MA, etal., FEBS Lett. 2006 Jan 9;580(1):67-71. Epub 2005 Dec 6.
22.	Doxorubicin pathways: pharmacodynamics and adverse effects.	Thorn CF, etal., Pharmacogenet Genomics. 2011 Jul;21(7):440-6. doi: 10.1097/FPC.0b013e32833ffb56.
23.	Prostaglandin F synthase.	Watanabe K, Prostaglandins Other Lipid Mediat. 2002 Aug;68-69:401-7.
24.	Cloning and expression of carbonyl reductase from rat testis.	Wermuth B, etal., Eur J Biochem 1995 Mar 1;228(2):473-9.
25.	Proteomic profiling of regionalized proteins in rat epididymis indicates consistency between specialized distribution and protein functions.	Yuan H, etal., J Proteome Res. 2006 Feb;5(2):299-307.

Additional References at PubMed

PMID:1597188	PMID:8198567	PMID:12477932	PMID:15489334	PMID:16855179	PMID:18449627	PMID:19056867	PMID:19199708	PMID:19442656	PMID:21492153	PMID:23376485	PMID:23533145
PMID:24769233	PMID:25931508

Genomics

Variants

Variants in Cbr1l1
53 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	72
Count of miRNA genes:	54
Interacting mature miRNAs:	54
Transcripts:	ENSRNOT00000041838, ENSRNOT00000072384
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1598842	Glom10	Glomerulus QTL 10	3.4		kidney glomerulus morphology trait (VT:0005325)	index of glomerular damage (CMO:0001135)	11	1	35331169	Rat
1300147	Bp187	Blood pressure QTL 187	3.67		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	11	1	69446234	Rat
1558659	Tescar1	Testicular tumor resistance QTL 1	3.9		testis integrity trait (VT:0010572)	percentage of study population developing testis tumors during a period of time (CMO:0001261)	11	1041931	66113562	Rat
1641927	Alcrsp10	Alcohol response QTL 10			alcohol metabolism trait (VT:0015089)	blood ethanol level (CMO:0000535)	11	8436674	53436674	Rat
724517	Uae18	Urinary albumin excretion QTL 18	3.7		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	11	16472047	44285911	Rat
724554	Iddm17	Insulin dependent diabetes mellitus QTL 17		0.001	blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	11	18976208	86241447	Rat
10058952	Gmadr6	Adrenal mass QTL 6	2.29	0.0072	adrenal gland mass (VT:0010420)	both adrenal glands wet weight to body weight ratio (CMO:0002411)	11	22959403	67959403	Rat
8694376	Bw156	Body weight QTL 156	2.25	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	23280456	68280456	Rat
9590313	Scort20	Serum corticosterone level QTL 20	6.51	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	11	23280456	68280456	Rat
9589032	Epfw10	Epididymal fat weight QTL 10	9.29	0.001	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	11	23280456	68280456	Rat
8694424	Bw162	Body weight QTL 162	3.8	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	11	23280456	68280456	Rat
724563	Uae10	Urinary albumin excretion QTL 10	6		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	11	27672410	82846715	Rat
1300130	Rf20	Renal function QTL 20	4.44		kidney glomerulus integrity trait (VT:0010546)	kidney glomerulus diameter (CMO:0001166)	11	29528418	60324829	Rat
1300110	Stl7	Serum triglyceride level QTL 7	4.64		blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	11	29528418	82566702	Rat
2298551	Neuinf10	Neuroinflammation QTL 10	3.7		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	11	31239134	78851519	Rat

Markers in Region

RH129182

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	11	37,407,584 - 37,407,747	NCBI	Rnor5.0
Rnor_5.0	11	37,457,286 - 37,457,456	NCBI	Rnor5.0
Rnor_5.0	11	37,439,156 - 37,439,319	NCBI	Rnor5.0
RGSC_v3.4	11	33,790,109 - 33,790,271	UniSTS	RGSC3.4
RGSC_v3.4	11	33,807,779 - 33,807,941	UniSTS	RGSC3.4
Celera	11	32,505,258 - 32,505,420	UniSTS
Cytogenetic Map	11	q11	UniSTS

RH142185

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	11	37,438,302 - 37,438,475	NCBI	Rnor5.0
Rnor_5.0	11	37,406,730 - 37,406,903	NCBI	Rnor5.0
Rnor_5.0	11	37,456,432 - 37,456,605	NCBI	Rnor5.0
RGSC_v3.4	11	33,806,925 - 33,807,097	UniSTS	RGSC3.4
RGSC_v3.4	11	33,789,255 - 33,789,427	UniSTS	RGSC3.4
Celera	11	32,504,404 - 32,504,576	UniSTS
RH 3.4 Map	11	248.5	UniSTS
Cytogenetic Map	11	q11	UniSTS

BE099783

Rat Assembly	Chr	Position (strand)	Source	JBrowse
Rnor_5.0	11	37,437,874 - 37,438,929	NCBI	Rnor5.0
Rnor_5.0	11	37,406,301 - 37,407,357	NCBI	Rnor5.0
Rnor_5.0	11	37,456,003 - 37,457,059	NCBI	Rnor5.0
RGSC_v3.4	11	33,806,497 - 33,807,551	UniSTS	RGSC3.4
RGSC_v3.4	11	33,788,826 - 33,789,881	UniSTS	RGSC3.4
Celera	11	32,503,975 - 32,505,030	UniSTS
RH 3.4 Map	3	208.9	UniSTS
Cytogenetic Map	11	q11	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	2	1						44		20
Low		41	33	18	19	18	2	4	30	30	21	11	2
Below cutoff	1		22	22	1	22	6	7	1	5			6

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_019170	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF181956	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC088843	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC105893	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473989	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D89070	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000222	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X84349	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	X95986	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000041838 ⟹ ENSRNOP00000051107

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	32,985,707 - 32,992,000 (+)	Ensembl
Rnor_6.0 Ensembl	11	33,845,463 - 33,847,793 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000042283 ⟹ ENSRNOP00000043385

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	11	33,812,989 - 33,815,418 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000075985 ⟹ ENSRNOP00000067964

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	11	33,813,043 - 33,815,418 (+)	Ensembl

RefSeq Acc Id:

ENSRNOT00000112111

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	11	32,908,950 - 32,911,393 (+)	Ensembl

RefSeq Acc Id:

NM_019170 ⟹ NP_062043

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	11	32,860,618 - 32,862,981 (+)	NCBI
Rnor_6.0	11	33,813,041 - 33,815,418 (+)	NCBI
Rnor_5.0	11	37,436,992 - 37,439,368 (+)	NCBI
RGSC_v3.4	11	33,787,957 - 33,790,320 (+)	RGD
Celera	11	32,503,106 - 32,505,469 (+)	RGD

Sequence:

show sequence

CCCCAGGTTCTTTGGTCTCCGACGGCCTTTCTACGCACACGCAGCCATGTCTTCCGACAGACCC
GTGGCACTGGTGACTGGTGCTAACAAAGGAATCGGATTCGCGATCGTACGTGATCTCTGTCGTA
AATTCTTGGGGGACGTGGTCCTCACGGCGCGGGACGAGTCACGGGGCCACGAGGCGGTGAAGCA
GCTGCAGACCGAGGGCCTGAGCCCACGCTTCCACCAGCTGGACATCGACAACCCGCAGAGCATC
CGCGCGCTGCGTGACTTTCTGCTTCAGGAGTACGGAGGACTGAACGTGCTGGTCAACAATGCGG
GCATCGCCTTCAAAGTTGTTGACCCCACCCCCTTCCACATTCAAGCAGAGGTGACAATGAAAAC
CAACTTTTTTGGTACCCAAGATGTCTGCAAGGAGCTACTCCCTATAATAAAACCCCAAGGCAGA
GTGGTGAATGTATCAAGCAGCGTGAGTCTCAGGGCCCTGAAAAGCTGCAGCCCGGAGCTGCAGC
AGAAGTTTCGAAGTGAGACCATCACTGAGGAAGAGCTGGTGGGGCTCATGAACAAGTTTATAGA
GGATGCAAAGAAAGGAGTCCATGCGAAAGAAGGCTGGCCCAATAGTGCATATGGGGTCACCAAG
ATAGGGGTGACAGTCCTGTCCAGAATCTATGCCAGGAAACTCAATGAGGAGAGGAGAGAGGACA
AGATCCTCCTGAATGCCTGCTGCCCTGGGTGGGTCAGAACCGACATGGCAGGACCAAAAGCCAC
CAAAAGCCCAGAAGAAGGAGCAGAGACCCCCGTGTACTTGGCCCTTTTGCCTCCAGGTGCAGAG
GGGCCTCACGGGCAGTTTGTTCAAGATAAAAAAGTTGAACCATGGTGAATCCAACTCTCACCCC
CACCCCTTCTATCCTGACTTGGTGAAAGCCAAGGGACATTTATAATATACCATCACTTCTGGAA
AAATAAACATAACTAAGTCTTTAAGCACAAAAAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_062043	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF03395	(Get FASTA)	NCBI Sequence Viewer
	AAI05894	(Get FASTA)	NCBI Sequence Viewer
	BAA19008	(Get FASTA)	NCBI Sequence Viewer
	CAA59088	(Get FASTA)	NCBI Sequence Viewer
	CAA65230	(Get FASTA)	NCBI Sequence Viewer
	EDM10787	(Get FASTA)	NCBI Sequence Viewer
	P47727	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:

NP_062043 ⟸ NM_019170

- UniProtKB:

Q3KR58 (UniProtKB/Swiss-Prot), P47727 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MSSDRPVALVTGANKGIGFAIVRDLCRKFLGDVVLTARDESRGHEAVKQLQTEGLSPRFHQLDI
DNPQSIRALRDFLLQEYGGLNVLVNNAGIAFKVVDPTPFHIQAEVTMKTNFFGTQDVCKELLPI
IKPQGRVVNVSSSVSLRALKSCSPELQQKFRSETITEEELVGLMNKFIEDAKKGVHAKEGWPNS
AYGVTKIGVTVLSRIYARKLNEERREDKILLNACCPGWVRTDMAGPKATKSPEEGAETPVYLAL
LPPGAEGPHGQFVQDKKVEPW

hide sequence

RefSeq Acc Id:

ENSRNOP00000051107 ⟸ ENSRNOT00000041838

RefSeq Acc Id:

ENSRNOP00000043385 ⟸ ENSRNOT00000042283

RefSeq Acc Id:

ENSRNOP00000067964 ⟸ ENSRNOT00000075985

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P47727-F1-model_v2	AlphaFold	P47727	1-277	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2286	AgrOrtholog
BioCyc Gene	G2FUF-21812	BioCyc
Ensembl Genes	ENSRNOG00000047848	Ensembl
	ENSRNOG00000049693	Ensembl, UniProtKB/TrEMBL
	ENSRNOG00000049911	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000051107.5	UniProtKB/TrEMBL
	ENSRNOP00000064050.2	UniProtKB/TrEMBL
	ENSRNOP00000067964.2	UniProtKB/TrEMBL
	ENSRNOP00000077145	ENTREZGENE
	ENSRNOP00000077145.1	UniProtKB/TrEMBL
	ENSRNOP00000081570.1	UniProtKB/TrEMBL
	ENSRNOP00000082202.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000041838.6	UniProtKB/TrEMBL
	ENSRNOT00000072384.3	UniProtKB/TrEMBL
	ENSRNOT00000075105.3	UniProtKB/TrEMBL
	ENSRNOT00000075985.2	UniProtKB/TrEMBL
	ENSRNOT00000096883	ENTREZGENE
	ENSRNOT00000096883.1	UniProtKB/TrEMBL
	ENSRNOT00000114595.1	UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:7366019	IMAGE-MGC_LOAD
InterPro	CBR1-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	NAD(P)-bd_dom_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Sc_DH/Rdtase_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SDR_fam	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:29224	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:124927	IMAGE-MGC_LOAD
NCBI Gene	29224	ENTREZGENE
Pfam	adh_short	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	CBR1	RGD
PhenoGen	Cbr1l1	PhenoGen
PRINTS	GDHRDH	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	SDRFAMILY	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	ADH_SHORT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF51735	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A096MJ24_RAT	UniProtKB/TrEMBL
	A0A0G2JSW9_RAT	UniProtKB/TrEMBL
	A0A8I5XVU2_RAT	UniProtKB/TrEMBL
	A0A8I5ZT21_RAT	UniProtKB/TrEMBL
	A0A8I5ZUP5_RAT	UniProtKB/TrEMBL
	CBR1_RAT	UniProtKB/Swiss-Prot
	M0R3X6_RAT	UniProtKB/TrEMBL
	P47727	ENTREZGENE
	Q3KR58	ENTREZGENE
UniProt Secondary	O08558	UniProtKB/Swiss-Prot
	Q3KR58	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-10-18	Cbr1l1	carbonyl reductase 1 like 1	Cbr1	carbonyl reductase 1	Name and Symbol changed	629549	APPROVED
2002-06-10	Cbr1	carbonyl reductase 1			Symbol and Name status set to approved	70586	APPROVED
2001-12-06	Cbr 1	carbonyl reductase 1			Symbol and Name updated to reflect Human and Mouse nomenclature	69665	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	expressed in testis and ovaries	634702
gene_expression	expressed in liver and kidneys	634703
gene_function	NADPH-dependent oxidoreductase	69801
gene_function	recombinant enzyme catalyzes its own modification by 2-oxoglutarate	69801
gene_process	may be involved in ovarian follicular development	634702
gene_process	may be involved in ovarian follicular development	1299856

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)

Send us a Message

RGD Manual Annotations

Imported Annotations - SMPDB

Imported Annotations - KEGG (archival)