Atp5if1 (ATP synthase inhibitory factor subunit 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Atp5if1 (ATP synthase inhibitory factor subunit 1) Rattus norvegicus

Analyze

Symbol:

Atp5if1

Name:

ATP synthase inhibitory factor subunit 1

RGD ID:

2181

Description:

Enables ATPase inhibitor activity. Predicted to be involved in several processes, including mitochondrial depolarization; negative regulation of endothelial cell proliferation; and regulation of protein targeting to mitochondrion. Predicted to act upstream of or within positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway and reactive oxygen species metabolic process. Located in mitochondrion. Orthologous to human ATP5IF1 (ATP synthase inhibitory factor subunit 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrotoluene; 2,4-dinitrotoluene.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

ATP synthase F1 subunit epsilon; ATPase inhibitor; ATPase inhibitor (rat mitochondrial IF1 protein); ATPase inhibitor, mitochondrial; ATPase inhibitory factor 1; Atpi; Atpif1; IF(1); IF1; IF1PA; inhibitor of F(1)F(o)-ATPase; LOC362620

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ATP5IF1 (ATP synthase inhibitory factor subunit 1)	HGNC	Ensembl, HomoloGene, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Atpif1 (ATPase inhibitory factor 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Atp5if1 (ATP synthase inhibitory factor subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ATP5IF1 (ATP synthase inhibitory factor subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ATP5IF1 (ATP synthase inhibitory factor subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Atp5if1 (ATP synthase inhibitory factor subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ATP5IF1 (ATP synthase inhibitory factor subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ATP5IF1 (ATP synthase inhibitory factor subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Atp5if1 (ATP synthase inhibitory factor subunit 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	ATP5IF1 (ATP synthase inhibitory factor subunit 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Atpif1 (ATPase inhibitory factor 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	atp5if1a	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG13551	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	CG34423	Alliance	DIOPT (InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mai-1	Alliance	DIOPT (InParanoid\|OMA\|OrthoFinder\|SonicParanoid)
Caenorhabditis elegans (roundworm):	mai-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	atp5if1b	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoInspector\|PANTHER\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	144,738,950 - 144,742,668 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	144,738,950 - 144,742,668 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	147,438,531 - 147,442,246 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	149,208,092 - 149,211,807 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	149,196,912 - 149,200,629 (-)	NCBI	Rnor_WKY
Rnor_6.0	5	150,719,570 - 150,723,287 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	150,719,569 - 150,723,321 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	154,387,824 - 154,391,541 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	152,618,307 - 152,622,024 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	152,628,417 - 152,632,067 (+)	NCBI
Celera	5	143,165,585 - 143,169,339 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Animal Mammary Neoplasms (ISO)

carcinoma (ISO)

Experimental Mammary Neoplasms (ISO)

fatty liver disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dimethylhydrazine (ISO)

17beta-estradiol (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrotoluene (EXP)

2,4-dinitrotoluene (EXP)

2,6-dinitrotoluene (EXP)

2-butoxyethanol (ISO)

2-hydroxypropanoic acid (ISO)

3,3',4,4',5-pentachlorobiphenyl (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

7,12-dimethyltetraphene (EXP)

acetamide (EXP)

acrylamide (EXP)

aflatoxin B1 (EXP)

all-trans-retinoic acid (ISO)

ammonium chloride (EXP)

arsenite(3-) (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bleomycin A2 (EXP)

carbon nanotube (ISO)

choline (ISO)

cisplatin (ISO)

copper(II) sulfate (ISO)

coumarin (EXP)

cyclosporin A (ISO)

diarsenic trioxide (ISO)

diazinon (ISO)

dibutyl phthalate (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

ethanol (ISO)

finasteride (EXP)

fipronil (EXP)

flutamide (EXP)

folic acid (ISO)

fulvestrant (ISO)

furan (EXP)

gamma-hexachlorocyclohexane (EXP)

hydrazine (EXP)

indole-3-methanol (EXP)

ivermectin (ISO)

L-methionine (ISO)

lipopolysaccharide (ISO)

menadione (ISO)

methylmercury(1+) (EXP)

N-nitrosodiethylamine (EXP)

nefazodone (EXP)

nimesulide (EXP)

ozone (ISO)

p-toluidine (EXP)

paracetamol (EXP,ISO)

perfluorononanoic acid (ISO)

phenobarbital (EXP)

phenylmercury acetate (ISO)

PhIP (EXP)

pirinixic acid (EXP,ISO)

pregnenolone 16alpha-carbonitrile (EXP)

rac-lactic acid (ISO)

resveratrol (ISO)

SB 431542 (ISO)

senecionine (ISO)

testosterone (ISO)

tetrachloromethane (EXP,ISO)

thimerosal (ISO)

thioacetamide (EXP)

trichloroethene (EXP)

troglitazone (ISO)

tungsten (ISO)

urethane (ISO)

valproic acid (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

erythrocyte differentiation (ISO,ISS)

heme biosynthetic process (IBA,ISO,ISS)

mitochondrial depolarization (ISO)

negative regulation of ATP-dependent activity (IBA,ISO)

negative regulation of endothelial cell proliferation (ISO,ISS)

negative regulation of hydrolase activity (ISO,ISS)

positive regulation of autophagy of mitochondrion in response to mitochondrial depolarization (ISO)

positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway (ISO)

positive regulation of proteolysis involved in protein catabolic process (ISO)

reactive oxygen species metabolic process (ISO)

regulation of ATP metabolic process (ISO)

regulation of protein targeting to mitochondrion (ISO)

Cellular Component

cell surface (ISO,ISS)

mitochondrion (IBA)

mitochondrion (IDA)

mitochondrion (ISO,ISS)

protein-containing complex (ISS)

Molecular Function

angiostatin binding (ISO,ISS)

ATPase binding (IBA,ISO,ISS)

ATPase inhibitor activity (IBA,IDA,ISO,ISS)

calmodulin binding (ISS)

enzyme binding (ISO)

identical protein binding (ISS)

mitochondrial proton-transporting ATP synthase complex binding (ISO)

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Interaction cloning of protein kinase C substrates.	Chapline C, etal., J Biol Chem 1993 Apr 5;268(10):6858-61.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
4.	Molecular cloning and sequence of cDNAs for the import precursors of oligomycin sensitivity conferring protein, ATPase inhibitor protein, and subunit c of H(+)-ATP synthase in rat mitochondria.	Higuti T, etal., Biochim Biophys Acta 1993 Mar 20;1172(3):311-4.
5.	Regulation of the mitochondrial ATP synthase/ATPase complex: cDNA cloning, sequence, overexpression, and secondary structural characterization of a functional protein inhibitor.	Lebowitz MS and Pedersen PL, Arch Biochem Biophys 1993 Feb 15;301(1):64-70.
6.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
7.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
8.	GOA pipeline	RGD automated data pipeline
9.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
10.	Isolation of the rat F1-ATPase inhibitor gene and its pseudogenes.	Samuel DS, etal., Biochim Biophys Acta 1995 Jun 1;1230(1-2):81-5.

Additional References at PubMed

PMID:12110673	PMID:12477932	PMID:14651853	PMID:15528193	PMID:17042487	PMID:17490602	PMID:18590689	PMID:18614015	PMID:18725417	PMID:19096392	PMID:20180002	PMID:20538613
PMID:20833797	PMID:21106936	PMID:21412184	PMID:23135403	PMID:24005319	PMID:24380588	PMID:26484591	PMID:29380352	PMID:32005857	PMID:33922643	PMID:36657294

Genomics

Comparative Map Data

Atp5if1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	144,738,950 - 144,742,668 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	144,738,950 - 144,742,668 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	147,438,531 - 147,442,246 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	5	149,208,092 - 149,211,807 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	5	149,196,912 - 149,200,629 (-)	NCBI	Rnor_WKY
Rnor_6.0	5	150,719,570 - 150,723,287 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	150,719,569 - 150,723,321 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	154,387,824 - 154,391,541 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	152,618,307 - 152,622,024 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	5	152,628,417 - 152,632,067 (+)	NCBI
Celera	5	143,165,585 - 143,169,339 (-)	NCBI		Celera
Cytogenetic Map	5	q36	NCBI

ATP5IF1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	28,236,124 - 28,238,100 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	1	28,236,109 - 28,246,906 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	28,562,635 - 28,564,611 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	28,435,198 - 28,437,198 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	28,246,752 - 28,248,751	NCBI
Celera	1	26,958,253 - 26,960,253 (+)	NCBI		Celera
Cytogenetic Map	1	p35.3	NCBI
HuRef	1	26,819,368 - 26,821,382 (+)	NCBI		HuRef
CHM1_1	1	28,678,108 - 28,680,122 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	1	28,077,959 - 28,079,935 (+)	NCBI		T2T-CHM13v2.0

Atpif1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	132,257,866 - 132,262,784 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	132,257,866 - 132,260,970 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	132,530,555 - 132,535,450 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	132,530,555 - 132,533,659 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	132,086,470 - 132,089,574 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	131,802,635 - 131,805,721 (-)	NCBI		MGSCv36	mm8
Celera	4	130,690,732 - 130,693,836 (-)	NCBI		Celera
Cytogenetic Map	4	D2.3	NCBI

Atp5if1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955452	7,373,001 - 7,375,856 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955452	7,372,917 - 7,375,072 (+)	NCBI	ChiLan1.0	ChiLan1.0

ATP5IF1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	1	28,532,091 - 28,534,109 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	28,532,091 - 28,542,607 (+)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	1	27,495,250 - 27,497,255 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

ATP5IF1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	2	72,188,562 - 72,191,344 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	2	72,188,266 - 72,191,326 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	2	68,766,422 - 68,769,200 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	2	72,748,757 - 72,751,535 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	2	72,748,456 - 72,751,516 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	2	69,576,066 - 69,578,844 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	2	70,586,244 - 70,589,023 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	2	71,582,936 - 71,585,714 (-)	NCBI		UU_Cfam_GSD_1.0

Atp5if1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	46,571,625 - 46,574,978 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936474	12,396,023 - 12,401,023 (+)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936474	12,396,416 - 12,399,760 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ATP5IF1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	85,307,189 - 85,309,215 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	85,307,242 - 85,309,211 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	79,045,827 - 79,047,796 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

ATP5IF1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	104,567,306 - 104,569,346 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666033	11,910,192 - 11,912,229 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Atp5if1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624764	12,068,638 - 12,072,190 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624764	12,068,518 - 12,070,542 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Atp5if1
8 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	46
Count of miRNA genes:	43
Interacting mature miRNAs:	46
Transcripts:	ENSRNOT00000018038
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1331796	Thshl2	Thyroid stimulating hormone level QTL 2	2.3		blood thyroid-stimulating hormone amount (VT:0005119)	serum thyroid stimulating hormone level (CMO:0001248)	5	97059760	147465714	Rat
1358187	Emca1	Estrogen-induced mammary cancer QTL 1	4.4		mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	5	99216724	148607142	Rat
1578673	Bmd13	Bone mineral density QTL 13	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	5	103689353	148689353	Rat
2317056	Wbc3	White blood cell count QTL 3	2.51	0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	5	105999803	150999803	Rat
7207488	Bss110	Bone structure and strength QTL 1	8.4		femur strength trait (VT:0010010)	femur stiffness (CMO:0001674)	5	106906205	151906205	Rat
7207491	Bss112	Bone structure and strength QTL 112	7		femur morphology trait (VT:0000559)	femur midshaft cortical cross-sectional area (CMO:0001663)	5	106906205	151906205	Rat
7207481	Bss106	Bone structure and strength QTL 106	7.9		femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	106906205	151906205	Rat
7207486	Bss109	Bone structure and strength QTL 109			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	5	106906205	151906205	Rat
1549838	Bss4	Bone structure and strength QTL 4	9.2		femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	5	106906205	151906205	Rat
1298089	Scl14	Serum cholesterol level QTL 14	5.8	0.0004	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	108845856	153845856	Rat
1598847	Cm62	Cardiac mass QTL 62	3.4		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	108845856	153845856	Rat
8657050	Bw146	Body weight QTL 146	19.84	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	108938288	153938288	Rat
8694441	Bw169	Body weight QTL 169	17.61	0.001	retroperitoneal fat pad mass (VT:0010430)	retroperitoneal fat pad weight to body weight ratio (CMO:0000635)	5	111416838	156416838	Rat
8694198	Abfw3	Abdominal fat weight QTL 3	16.13	0.001	visceral adipose mass (VT:0010063)	abdominal fat pad weight to body weight ratio (CMO:0000095)	5	111416838	156416838	Rat
8694389	Bw160	Body weight QTL 160	6.17	0.001	body lean mass (VT:0010483)	lean tissue morphological measurement (CMO:0002184)	5	111416838	156416838	Rat
8552960	Pigfal15	Plasma insulin-like growth factor 1 level QTL 15			blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	111416838	156416838	Rat
2293642	Bss37	Bone structure and strength QTL 37	4.64	0.0001	femur strength trait (VT:0010010)	femur ultimate force (CMO:0001675)	5	120740824	151018848	Rat
1641920	Colcs1	Colorectal carcinoma susceptibility QTL 1	2.99	0.0055	intestine integrity trait (VT:0010554)	benign colorectal tumor surface area measurement (CMO:0001799)	5	121846814	166846814	Rat
10053720	Scort26	Serum corticosterone level QTL 26	2.06	0.0147	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	5	124965598	166875058	Rat
724525	Bp147	Blood pressure QTL 147	4.3	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	126424772	166875058	Rat
1598819	Bp292	Blood pressure QTL 292	4.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	127798274	166875058	Rat
1598861	Cm64	Cardiac mass QTL 64	2.9		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	127798274	166875058	Rat
8552908	Pigfal4	Plasma insulin-like growth factor 1 level QTL 4	6.6		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	5	128506074	166875058	Rat
8694169	Bw148	Body weight QTL 148	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	128506074	166875058	Rat
634349	Bp139	Blood pressure QTL 139		0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	128924607	166875058	Rat
70156	Niddm30	Non-insulin dependent diabetes mellitus QTL 30	3.98		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	5	129132447	151006154	Rat
738018	Anxrr4	Anxiety related response QTL 4	5.1		exploratory behavior trait (VT:0010471)	percentage of entries into a discrete space in an experimental apparatus (CMO:0000961)	5	130130159	166875058	Rat
7794791	Mcs33	Mammary carcinoma susceptibility QTL 33	1.93		mammary gland integrity trait (VT:0010552)	mammary tumor incidence/prevalence measurement (CMO:0000946)	5	131345754	166875058	Rat
631505	Bp103	Blood pressure QTL 103	3.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	132717196	165560427	Rat
631562	Apr2	Acute phase response QTL 2	3.7		blood murinoglobulin 1 amount (VT:0010597)	plasma murinoglobulin 1 level (CMO:0001931)	5	135927956	166875058	Rat
61444	Strs2	Sensitivity to stroke QTL 2	4.7		cerebrum integrity trait (VT:0010549)	post-insult time to onset of cerebrovascular lesion (CMO:0002343)	5	135929696	166875058	Rat
1331721	Bp210	Blood pressure QTL 210	3.413		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	143069996	166846814	Rat
2302369	Scl60	Serum cholesterol level QTL 60	3.13		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	143608201	161165651	Rat
631263	Cm24	Cardiac mass QTL 24	3.5		heart mass (VT:0007028)	heart left ventricle weight to body weight ratio (CMO:0000530)	5	143799107	158428037	Rat
1300119	Bp180	Blood pressure QTL 180	3.82		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	5	144358090	157869054	Rat
2313096	Bmd78	Bone mineral density QTL 78	3.1	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	5	144377876	161317411	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	74	35	41	11	8
Low
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_012915	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC123895	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC126065	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473968	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D13122	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ221416	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ229412	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	U12250	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000018038 ⟹ ENSRNOP00000018038

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	144,738,950 - 144,742,668 (-)	Ensembl
Rnor_6.0 Ensembl	5	150,719,569 - 150,723,321 (-)	Ensembl

RefSeq Acc Id:

NM_012915 ⟹ NP_037047

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	144,738,950 - 144,742,668 (-)	NCBI
Rnor_6.0	5	150,719,570 - 150,723,287 (-)	NCBI
Rnor_5.0	5	154,387,824 - 154,391,541 (-)	NCBI
RGSC_v3.4	5	152,618,307 - 152,622,024 (+)	RGD
Celera	5	143,165,585 - 143,169,339 (-)	RGD

Sequence:

show sequence

CAACCACGCCCGCAACGGAGCTGAGCAACGCCGAAGATAATGGCAGGCTCGGCGTTGGCGGTTC
GGGCTCGGCTCGGTGTCTGGGGTATGAGGGTCCTGCAAACCCGAGGCTTCGGCTCGGACTCGTC
GGAGAGCATGGATTCGGGCGCTGGCTCCATCCGAGAAGCTGGTGGGGCCTTCGGGAAACGAGAG
AAGGCTGAAGAGGATCGGTACTTCCGAGAGAAGACTAGAGAGCAGCTGGCTGCCTTGAAGAAGC
ACCATGAAGATGAGATTGACCACCATTCGAAGGAGATAGAGCGTCTGCAAAAACAGATCGAACG
GCATAAGAAGAAGATTAAATACCTAAAGAATAGTGAGCATTGAGTGCACACAGTCAGTCTCTCA
CAGAGTGGCCAGTATCATTCCCCACTTCTATAGAGATTGTTTTGAATGATTGATGTTTGACCTG
TGTGCTACTAACAGATAATAAATTATCACCAGG

hide sequence

Protein Sequences


Protein RefSeqs	NP_037047	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAA85094	(Get FASTA)	NCBI Sequence Viewer
	AAI26066	(Get FASTA)	NCBI Sequence Viewer
	BAA02424	(Get FASTA)	NCBI Sequence Viewer
	EDL80639	(Get FASTA)	NCBI Sequence Viewer
	Q03344	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_037047 ⟸ NM_012915
- Peptide Label:	precursor
- UniProtKB:	A0JMZ8 (UniProtKB/Swiss-Prot), Q03344 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MAGSALAVRARLGVWGMRVLQTRGFGSDSSESMDSGAGSIREAGGAFGKREKAEEDRYFREKTR EQLAALKKHHEDEIDHHSKEIERLQKQIERHKKKIKYLKNSEH hide sequence

RefSeq Acc Id:

ENSRNOP00000018038 ⟸ ENSRNOT00000018038

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q03344-F1-model_v2	AlphaFold	Q03344	1-107	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694098

Promoter ID:

EPDNEW_R4622

Type:

initiation region

Name:

Atp5if1_1

Description:

ATP synthase inhibitory factor subunit 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	5	150,723,264 - 150,723,324	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2181	AgrOrtholog
BioCyc Gene	G2FUF-39684	BioCyc
Ensembl Genes	ENSRNOG00000013300	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSRNOP00000018038	ENTREZGENE
	ENSRNOP00000018038.3	UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000018038	ENTREZGENE
	ENSRNOT00000018038.6	UniProtKB/Swiss-Prot
Gene3D-CATH	Single helix bin	UniProtKB/Swiss-Prot
IMAGE_CLONE	IMAGE:7442425	IMAGE-MGC_LOAD
InterPro	ATPase_inhibitor_mt	UniProtKB/Swiss-Prot
KEGG Report	rno:25392	UniProtKB/Swiss-Prot
MGC_CLONE	MGC:156492	IMAGE-MGC_LOAD
NCBI Gene	25392	ENTREZGENE
Pfam	IATP	UniProtKB/Swiss-Prot
PhenoGen	Atp5if1	PhenoGen
Superfamily-SCOP	F1 ATPase inhibitor, IF1, C-terminal domain	UniProtKB/Swiss-Prot
UniProt	A0JMZ8	ENTREZGENE
	ATIF1_RAT	UniProtKB/Swiss-Prot, ENTREZGENE
UniProt Secondary	A0JMZ8	UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2017-12-13	Atp5if1	ATP synthase inhibitory factor subunit 1	Atpif1	ATPase inhibitory factor 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2005-12-05	Atpif1	ATPase inhibitory factor 1	Atpif1_predicted	ATPase inhibitory factor 1 (predicted)	Data Merged	737654	APPROVED
2005-12-02	Atpif1	ATPase inhibitory factor 1	Atpi	ATPase inhibitor	Symbol and Name updated to reflect Human and Mouse nomenclature	1299863	APPROVED
2005-01-12	Atpif1_predicted	ATPase inhibitory factor 1 (predicted)			Symbol and Name status set to approved	70820	APPROVED
2002-11-06	Atpi	ATPase inhibitor		ATPase inhibitor (rat mitochondrial IF1 protein)	Name updated	625702	APPROVED
2002-06-10	Atpi	ATPase inhibitor (rat mitochondrial IF1 protein)			Symbol and Name status set to approved	70586	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_cellular_localization	localized to the mitochondria	631733
gene_domains	has 25 N-terminal amino acids which encode a putative mitochondrial targeting sequence	631733
gene_expression	expressed in liver	631733
gene_process	a component of the mitochondrial ATP synthase/ATPase complex; inhibits ATP hydrolysis	631733
gene_protein	107 amino acids	631733
gene_transcript	contains three exons and two introns	631785

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - CTD