Agrp (agouti related neuropeptide)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Agrp (agouti related neuropeptide) Rattus norvegicus

Analyze

Symbol:

Agrp

Name:

agouti related neuropeptide

RGD ID:

2068

Description:

Predicted to enable neuropeptide hormone activity and type 1 melanocortin receptor binding activity. Involved in several processes, including adult feeding behavior; neuropeptide signaling pathway; and positive regulation of feeding behavior. Located in extracellular space and neuronal cell body. Biomarker of obesity and type 2 diabetes mellitus. Human ortholog(s) of this gene implicated in obesity and type 2 diabetes mellitus. Orthologous to human AGRP (agouti related neuropeptide); PARTICIPATES IN altered melanocortin system pathway; melanocortin system pathway; obesity pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2-deoxy-D-glucose; AM-251.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

Agouti (mouse) related protein; agouti related protein; agouti related protein homolog (mouse); Agouti-related protein

RGD Orthologs

Human

Mouse

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	AGRP (agouti related neuropeptide)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Agrp (agouti related neuropeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Agrp (agouti related neuropeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	AGRP (agouti related neuropeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	AGRP (agouti related neuropeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Agrp (agouti related neuropeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	AGRP (agouti related neuropeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	AGRP (agouti related neuropeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Agrp (agouti related neuropeptide)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Mus musculus (house mouse):	Agrp (agouti related neuropeptide)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	AGRP (agouti related neuropeptide)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	agrp (agouti related neuropeptide)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Candidate Gene For:

Bw130

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	19	33,447,992 - 33,523,068 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	33,447,992 - 33,449,584 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	40,263,577 - 40,265,169 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	19	40,916,914 - 40,918,506 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	19	43,214,688 - 43,216,280 (-)	NCBI	Rnor_WKY
Rnor_6.0	19	37,525,941 - 37,584,875 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	37,526,419 - 37,528,011 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	48,391,845 - 48,406,659 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	35,386,682 - 35,388,274 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	35,391,672 - 35,392,244 (-)	NCBI
Celera	19	32,876,306 - 32,877,927 (-)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autosomal dominant dyskeratosis congenita 6 (ISO)

genetic disease (ISO)

Hyperphagia (IEP)

obesity (IEP,ISO)

Thinness (ISO)

type 2 diabetes mellitus (IEP,ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-deoxy-D-glucose (EXP)

4,4'-sulfonyldiphenol (ISO)

acadesine (ISO)

actinomycin D (ISO)

AM-251 (EXP)

ammonium chloride (EXP)

arachidonyl-2'-chloroethylamide (EXP)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (EXP,ISO)

bisphenol A (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

camptothecin (ISO)

carbon nanotube (ISO)

cerulenin (ISO)

chloroprene (ISO)

copper atom (EXP)

copper(0) (EXP)

copper(II) sulfate (ISO)

diclofenac (EXP)

dimethyl sulfoxide (ISO)

diprotium oxide (EXP)

graphite (EXP)

metformin (ISO)

methylmercury chloride (ISO)

monosodium L-glutamate (EXP)

morphine (ISO)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

olanzapine (EXP,ISO)

ozone (ISO)

potassium dichromate (ISO)

ruthenium red (ISO)

sodium arsenite (ISO)

streptozocin (EXP)

tetraphene (ISO)

triphenyl phosphate (ISO)

water (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adult feeding behavior (IBA,IEP,ISO)

circadian rhythm (IEP)

eating behavior (IMP)

feeding behavior (TAS)

hormone-mediated signaling pathway (IEA)

long-day photoperiodism (IEP)

maternal process involved in female pregnancy (IEP)

neuropeptide signaling pathway (IBA,IEP,ISO)

positive regulation of feeding behavior (IBA,IDA,IMP)

regulation of feeding behavior (ISO)

response to insulin (IEP)

signal transduction (ISO)

Cellular Component

extracellular space (IBA,IDA,ISO,TAS)

Golgi lumen (ISO)

neuronal cell body (IDA)

Molecular Function

hormone activity (TAS)

neuropeptide hormone activity (IBA,ISO)

type 1 melanocortin receptor binding (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

altered melanocortin system pathway (ISO)

melanocortin system pathway (ISO,TAS)

obesity pathway (ISO)

syndecan signaling pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	A polymorphism in the human agouti-related protein is associated with late-onset obesity.	Argyropoulos G, etal., J Clin Endocrinol Metab. 2002 Sep;87(9):4198-202.
2.	The genetic association database.	Becker KG, etal., Nat Genet. 2004 May;36(5):431-2.
3.	P2X2 purinoreceptor protein in hypothalamic neurons associated with the regulation of food intake.	Collden G, etal., Neuroscience. 2010 Nov 24;171(1):62-78. Epub 2010 Aug 22.
4.	Agouti-related protein is posttranslationally cleaved by proprotein convertase 1 to generate agouti-related protein (AGRP)83-132: interaction between AGRP83-132 and melanocortin receptors cannot be influenced by syndecan-3.	Creemers JW, etal., Endocrinology. 2006 Apr;147(4):1621-31. Epub 2005 Dec 29.
5.	Agouti-related protein has an inhibitory paracrine role in the rat adrenal gland.	Dhillo WS, etal., Biochem Biophys Res Commun 2003 Jan 31;301(1):102-7.
6.	Immunolesion of norepinephrine and epinephrine afferents to medial hypothalamus alters basal and 2-deoxy-D-glucose-induced neuropeptide Y and agouti gene-related protein messenger ribonucleic acid expression in the arcuate nucleus.	Fraley GS and Ritter S, Endocrinology 2003 Jan;144(1):75-83.
7.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
8.	Treadmill training enhances rat agouti-related protein in plasma and reduces ghrelin levels in plasma and soleus muscle.	Ghanbari-Niaki A, etal., Metabolism. 2009 Dec;58(12):1747-52. Epub 2009 Jul 25.
9.	Rat ISS GO annotations from GOA human gene data--August 2006	GOA data from the GO Consortium
10.	Reduced expression of the KATP channel subunit, Kir6.2, is associated with decreased expression of neuropeptide Y and agouti-related protein in the hypothalami of Zucker diabetic fatty rats.	Gyte A, etal., J Neuroendocrinol. 2007 Dec;19(12):941-51.
11.	Plasma levels of agouti-related protein are increased in obese men.	Katsuki A, etal., J Clin Endocrinol Metab 2001 May;86(5):1921-4.
12.	Forkhead protein FoxO1 mediates Agrp-dependent effects of leptin on food intake.	Kitamura T, etal., Nat Med. 2006 May;12(5):534-40. Epub 2006 Apr 9.
13.	Effects of leptin receptor mutation on Agrp gene expression in fed and fasted lean and obese (LA/N-faf) rats.	Korner J, etal., Endocrinology 2000 Jul;141(7):2465-71.
14.	Function of neuropeptide Y and agouti-related protein at weaning: relation to corticosterone, dietary carbohydrate and body weight.	Leibowitz SF, etal., Brain Res. 2005 Mar 2;1036(1-2):180-91.
15.	A role for the Agouti-Related Protein promoter in obesity and type 2 diabetes.	Mayfield DK, etal., Biochem Biophys Res Commun. 2001 Sep 21;287(2):568-73.
16.	Rat ISS GO annotations from MGI mouse gene data--August 2006	MGD data from the GO Consortium
17.	Melanocortin receptor 4 deficiency affects body weight regulation, grooming behavior, and substrate preference in the rat.	Mul JD, etal., Obesity (Silver Spring). 2012 Mar;20(3):612-21. doi: 10.1038/oby.2011.81. Epub 2011 Apr 28.
18.	Electronic Transfer of LocusLink and RefSeq Data	NCBI rat LocusLink and RefSeq merged data July 26, 2002
19.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
20.	Perinatal nutrient restriction induces long-lasting alterations in the circadian expression pattern of genes regulating food intake and energy metabolism.	Orozco-Solis R, etal., Int J Obes (Lond). 2011 Jul;35(7):990-1000. doi: 10.1038/ijo.2010.223. Epub 2010 Nov 9.
21.	PID Annotation Import Pipeline	Pipeline to import Pathway Interaction Database annotations from NCI into RGD
22.	Agouti-related protein is a mediator of diabetic hyperphagia.	Qu SY, etal., Regul Pept. 2001 Apr 2;98(1-2):69-75.
23.	GOA pipeline	RGD automated data pipeline
24.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
25.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
26.	Divergent regulation of hypothalamic neuropeptide Y and agouti-related protein by photoperiod in F344 rats with differential food intake and growth.	Ross AW, etal., J Neuroendocrinol. 2009 Jul;21(7):610-9. Epub 2009 Apr 13.
27.	The critical role of the melanocortin system in the control of energy balance.	Seeley RJ, etal., Annu Rev Nutr 2004;24:133-49.
28.	Neuroendocrine regulatory peptide-2 regulates feeding behavior via the orexin system in the hypothalamus.	Toshinai K, etal., Am J Physiol Endocrinol Metab. 2010 Sep;299(3):E394-401. Epub 2010 Jun 15.
29.	Hyperphagia and central mechanisms for leptin resistance during pregnancy.	Trujillo ML, etal., Endocrinology. 2011 Apr;152(4):1355-65. Epub 2011 Feb 8.
30.	Glucocorticoids are required for meal-induced changes in the expression of hypothalamic neuropeptides.	Uchoa ET, etal., Neuropeptides. 2012 Mar 15.

Additional References at PubMed

PMID:9311920	PMID:12126733	PMID:12213628	PMID:12832105	PMID:12851299	PMID:14636173	PMID:15582725	PMID:15589525	PMID:15616803	PMID:15890775	PMID:15927146	PMID:16046456
PMID:16087729	PMID:16226323	PMID:16484442	PMID:17289093	PMID:17374702	PMID:17873059	PMID:18384674	PMID:18467436	PMID:18535107	PMID:18583425	PMID:18955035	PMID:19017729
PMID:19151514	PMID:19255506	PMID:19403567	PMID:19817504	PMID:20335227	PMID:21334429	PMID:21589937	PMID:22450045	PMID:22715380	PMID:23376485	PMID:25509169	PMID:26907996

Genomics

Comparative Map Data

Agrp
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	19	33,447,992 - 33,523,068 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	19	33,447,992 - 33,449,584 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	19	40,263,577 - 40,265,169 (-)	NCBI	Rnor_SHR
UTH_Rnor_SHRSP_BbbUtx_1.0	19	40,916,914 - 40,918,506 (-)	NCBI	Rnor_SHRSP
UTH_Rnor_WKY_Bbb_1.0	19	43,214,688 - 43,216,280 (-)	NCBI	Rnor_WKY
Rnor_6.0	19	37,525,941 - 37,584,875 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	19	37,526,419 - 37,528,011 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	19	48,391,845 - 48,406,659 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	19	35,386,682 - 35,388,274 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	19	35,391,672 - 35,392,244 (-)	NCBI
Celera	19	32,876,306 - 32,877,927 (-)	NCBI		Celera
Cytogenetic Map	19	q12	NCBI

AGRP
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	16	67,482,571 - 67,483,547 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p13 Ensembl	16	67,482,571 - 67,483,547 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	16	67,516,474 - 67,517,450 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	16	66,073,975 - 66,075,217 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	16	66,073,974 - 66,074,805	NCBI
Celera	16	52,024,676 - 52,025,918 (-)	NCBI		Celera
Cytogenetic Map	16	q22.1	NCBI
HuRef	16	53,389,602 - 53,390,844 (-)	NCBI		HuRef
CHM1_1	16	68,923,856 - 68,925,098 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	16	73,277,343 - 73,278,319 (-)	NCBI		T2T-CHM13v2.0

Agrp
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	8	106,293,327 - 106,306,477 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	8	106,293,330 - 106,364,025 (-)	Ensembl		GRCm39 Ensembl
GRCm38	8	105,566,695 - 105,579,845 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	8	105,566,698 - 105,637,393 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	8	108,090,598 - 108,092,198 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	8	108,455,827 - 108,457,427 (-)	NCBI		MGSCv36	mm8
Celera	8	109,789,930 - 109,791,530 (-)	NCBI		Celera
Cytogenetic Map	8	D3	NCBI

Agrp
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955484	9,165,120 - 9,166,789 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955484	9,165,120 - 9,166,789 (+)	NCBI	ChiLan1.0	ChiLan1.0

AGRP
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	16	67,216,008 - 67,217,258 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	16	67,216,008 - 67,217,258 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	16	47,827,532 - 47,872,727 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

AGRP
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	5	81,924,249 - 81,926,510 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	5	81,925,055 - 81,925,845 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	5	81,914,032 - 81,915,572 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	5	82,359,662 - 82,361,202 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	5	82,360,349 - 82,361,139 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	5	82,185,812 - 82,187,352 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	5	81,866,912 - 81,868,452 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	5	82,510,362 - 82,511,902 (+)	NCBI		UU_Cfam_GSD_1.0

Agrp
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024409349	41,652,027 - 41,660,973 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936475	17,927,985 - 17,937,147 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936475	17,927,991 - 17,929,377 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

AGRP
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	6	28,132,615 - 28,134,900 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	6	28,132,614 - 28,135,594 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	6	25,399,704 - 25,401,437 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

AGRP
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	5	59,972,728 - 59,974,728 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	5	59,973,922 - 59,974,660 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666047	22,722,627 - 22,723,740 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Agrp
(Heterocephalus glaber - naked mole-rat)

Naked Mole-rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624746	18,826,545 - 18,827,299 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624746	18,826,206 - 18,827,453 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Agrp
155 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	62
Count of miRNA genes:	61
Interacting mature miRNAs:	62
Transcripts:	ENSRNOT00000059628
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
9590298	Uminl5	Urine mineral level QTL 5	3.59	0.001	urine mineral amount (VT:0015086)	urine electrolyte level (CMO:0000593)	19	1	36824771	Rat
8552935	Pigfal10	Plasma insulin-like growth factor 1 level QTL 10	5.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	19	1	36824771	Rat
9590250	Scort11	Serum corticosterone level QTL 11	23.45	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	19	1	36824771	Rat
9590090	Insglur8	Insulin/glucose ratio QTL 8	10.81	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	19	1	36824771	Rat
9589102	Slep13	Serum leptin concentration QTL 13	4.63	0.001	blood leptin amount (VT:0005667)	plasma leptin level (CMO:0000781)	19	569374	45569374	Rat
8694186	Bw152	Body weight QTL 152	3.34	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	569374	45569374	Rat
7247442	Uae39	Urinary albumin excretion QTL 39			urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	2187927	46708701	Rat
724566	Uae12	Urinary albumin excretion QTL 12	5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	2187927	56457239	Rat
61447	Tcas1	Tongue tumor susceptibility QTL 1	6.08		tongue integrity trait (VT:0010553)	squamous cell carcinoma of the tongue maximum tumor diameter (CMO:0001875)	19	2316121	47316121	Rat
2317848	Alcrsp21	Alcohol response QTL 21	1.899999976158142	0.05	response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	19	3204777	48204777	Rat
1331737	Uae29	Urinary albumin excretion QTL 29	5.5		urine albumin amount (VT:0002871)	urine albumin level (CMO:0000130)	19	4096155	55283277	Rat
724518	Uae19	Urinary albumin excretion QTL 19	5.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	19	7457249	42983518	Rat
724565	Tcas5	Tongue tumor susceptibility QTL 5	10.04		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	19	9977753	39654489	Rat
61423	Cia14	Collagen induced arthritis QTL 14	3		joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	19	10827970	43544039	Rat
1558656	Prcs1	Prostate cancer susceptibility QTL 1	5		prostate integrity trait (VT:0010571)	percentage of study population developing ventral prostate tumorous lesions during a period of time (CMO:0000943)	19	15114598	34521833	Rat
7411549	Bw130	Body weight QTL 130	5	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	19	15455860	57337602	Rat
1331788	Rf45	Renal function QTL 45	2.818		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	19	15605023	46559041	Rat
1578764	Stresp19	Stress response QTL 19	3.6	0.001	blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	19	15630201	57337602	Rat
2298478	Eau8	Experimental allergic uveoretinitis QTL 8		0.0163	uvea integrity trait (VT:0010551)	experimental autoimmune uveitis score (CMO:0001504)	19	17154433	57337602	Rat
61350	Bp32	Blood pressure QTL 32		0.012	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	19	20483575	57337602	Rat
1549835	Tcas7	Tongue tumor susceptibility QTL 7		0.001	tongue integrity trait (VT:0010553)	squamous cell carcinoma of the head and neck tumor number (CMO:0001876)	19	24817978	39654489	Rat
1354600	Salc2	Saline consumption QTL 2	9.91	0.001	drinking behavior trait (VT:0001422)	saline drink intake rate (CMO:0001627)	19	27530207	37947399	Rat
1354607	Gmadr1	Adrenal mass QTL 1	5.83		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	19	27530207	37947399	Rat
1354633	Bw28	Body weight QTL 28	6.04		body mass (VT:0001259)	body weight (CMO:0000012)	19	27530207	37947399	Rat
724546	Kidm3	Kidney mass QTL 3	3.1		kidney mass (VT:0002707)	calculated kidney weight (CMO:0000160)	19	29322490	57337602	Rat

Markers in Region

RH94762

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	19	33,448,678 - 33,448,781 (+)	MAPPER	mRatBN7.2
Rnor_6.0	19	37,527,106 - 37,527,208	NCBI	Rnor6.0
Rnor_5.0	19	48,393,005 - 48,393,107	UniSTS	Rnor5.0
RGSC_v3.4	19	35,387,369 - 35,387,471	UniSTS	RGSC3.4
Celera	19	32,877,022 - 32,877,124	UniSTS
Cytogenetic Map	19	q11	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium
Low	2	20	36	25	19	25			74	30	37	7
Below cutoff	1	21	12	7		7	5	8		5	4	4	5

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_033650	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_008772474	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097498	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097499	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039097500	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XR_005496618	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC116220	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF206017	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473972	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000313	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000059628 ⟹ ENSRNOP00000056384

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	19	33,447,992 - 33,449,584 (-)	Ensembl
Rnor_6.0 Ensembl	19	37,526,419 - 37,528,011 (-)	Ensembl

RefSeq Acc Id:

NM_033650 ⟹ NP_387499

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	33,447,992 - 33,449,584 (-)	NCBI
Rnor_6.0	19	37,526,419 - 37,528,011 (-)	NCBI
Rnor_5.0	19	48,391,845 - 48,406,659 (-)	NCBI
RGSC_v3.4	19	35,386,682 - 35,388,274 (-)	RGD
Celera	19	32,876,306 - 32,877,927 (-)	RGD

Sequence:

show sequence

CAGCCTGAAAGCTTTTTACTCTGAAGCTGAATGCCCACCCTGGGAACAGTGTGTTCTGCTCTCA
TGGTTTCCAGGAACCCAAGGGAGGCCCCTCATGCCCTAGCTACAGGAAGTAGTCACGTGTGGGC
CCTTTATTAGACCCTGCCATATAAGCTCAGGGCACAAGTGGCCAGGAACTCCTTAGGCAAGGAT
CAACAAGCAAAGGCCATGCTGACTGCAATGTTGCTGAGCTGTGTCCTGCTGCTGGCACTGCCTC
CCACATTGGGGGTCCATATGGGCGTGGCACCACTGAAGGGCATCAGAAGGTCTGACCAGGCCCT
GTTCCCAGAGTTCTCAGGTCTAAGTCTGAAGAAGACAGCAGCAGACCGAGCAGAAGATGTTCTG
CTGCAGAAGGCAGAAGCTTTGGCAGAGGTGCTAGATCCACAGAACCGCGAGTCTCGTTCTCCGC
GTCGCTGTGTAAGGCTGCACGAGTCCTGCTTGGGACAACAGGTACCTTGCTGCGACCTGTGCGC
CACGTGCTACTGCCGCTTCTTCAATACCTTTTGCTACTGCCGCAAGCTAGGTACTGGCACCACG
AACCTCTGCAGCCGCCCCTAGCCAACGGATGTTGGGCAAAGGCAGGGGACGCGAATAAACGATG
GGACTAAC

hide sequence

RefSeq Acc Id:

XM_039097498 ⟹ XP_038953426

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	33,447,992 - 33,481,602 (-)	NCBI

RefSeq Acc Id:

XM_039097499 ⟹ XP_038953427

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	33,448,897 - 33,523,068 (-)	NCBI

RefSeq Acc Id:

XM_039097500 ⟹ XP_038953428

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	33,447,992 - 33,523,068 (-)	NCBI

RefSeq Acc Id:

XR_005496618

RefSeq Status:

Type:

NON-CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	19	33,507,454 - 33,523,068 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_387499	(Get FASTA)	NCBI Sequence Viewer
	XP_038953426	(Get FASTA)	NCBI Sequence Viewer
	XP_038953427	(Get FASTA)	NCBI Sequence Viewer
	XP_038953428	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAF20203	(Get FASTA)	NCBI Sequence Viewer
	EDL92383	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_387499 ⟸ NM_033650
- Peptide Label:	precursor
- UniProtKB:	F1MAG1 (UniProtKB/TrEMBL)
- Sequence:	show sequence MLTAMLLSCVLLLALPPTLGVHMGVAPLKGIRRSDQALFPEFSGLSLKKTAADRAEDVLLQKAE ALAEVLDPQNRESRSPRRCVRLHESCLGQQVPCCDLCATCYCRFFNTFCYCRKLGTGTTNLCSR P hide sequence

RefSeq Acc Id:

ENSRNOP00000056384 ⟸ ENSRNOT00000059628

RefSeq Acc Id:	XP_038953428 ⟸ XM_039097500
- Peptide Label:	isoform X3

RefSeq Acc Id:	XP_038953426 ⟸ XM_039097498
- Peptide Label:	isoform X1

RefSeq Acc Id:	XP_038953427 ⟸ XM_039097499
- Peptide Label:	isoform X2

Protein Domains

Agouti

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-F1MAG1-F1-model_v2	AlphaFold	F1MAG1	1-129	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:2068	AgrOrtholog
BioCyc Gene	G2FUF-5824	BioCyc
Ensembl Genes	ENSRNOG00000039001	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000056384	ENTREZGENE
	ENSRNOP00000056384.3	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000059628	ENTREZGENE
	ENSRNOT00000059628.4	UniProtKB/TrEMBL
Gene3D-CATH	4.10.760.10	UniProtKB/TrEMBL
InterPro	Agouti	UniProtKB/TrEMBL
	Agouti_dom	UniProtKB/TrEMBL
	Agouti_dom_sf	UniProtKB/TrEMBL
KEGG Report	rno:25582	UniProtKB/TrEMBL
NCBI Gene	25582	ENTREZGENE
PANTHER	Agouti	UniProtKB/TrEMBL
	AGOUTI-RELATED PROTEIN	UniProtKB/TrEMBL
Pfam	Agouti	UniProtKB/TrEMBL
PhenoGen	Agrp	PhenoGen
PROSITE	AGOUTI_2	UniProtKB/TrEMBL
SMART	Agouti	UniProtKB/TrEMBL
Superfamily-SCOP	Agouti	UniProtKB/TrEMBL
UniProt	F1MAG1	ENTREZGENE, UniProtKB/TrEMBL
	Q9QXJ3_RAT	UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2014-07-23	Agrp	agouti related neuropeptide	Agrp	agouti related protein homolog (mouse)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-09-26	Agrp	agouti related protein homolog (mouse)	Agrp	agouti related protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-02-15	Agrp	agouti related protein	Agrp	agouti related protein homolog (mouse)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2002-11-06	Agrp	agouti related protein homolog (mouse)	Agrp	Agouti (mouse) related protein	Name updated	625702	APPROVED

RGD Curation Notes

Note Type	Note	Reference
gene_expression	mRNA expression detected in hypothalamus	632165
gene_function	may interact with melanocortin receptors	632165
gene_process	may play a role in appetite stimulation	632165
gene_regulation	expression may be inhibited by leptin	632165
gene_regulation	expression increases in response to food deprivation	632165

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - GAD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - PID (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - GAD

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - PID (archival)