Reg2 (regenerating islet-derived 2)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer ACP Haplotyper Genome Scanner Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Reg2 (regenerating islet-derived 2) Mus musculus

Analyze

Symbol:

Reg2

Name:

regenerating islet-derived 2

RGD ID:

1623283

MGI Page

MGI

Description:

Is expressed in several structures, including gut; male reproductive gland or organ; and mesenteric adipose tissue. Human ortholog(s) of this gene implicated in type 1 diabetes mellitus. Orthologous to several human genes including REG1A (regenerating family member 1 alpha); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; 2,4,6-trinitrobenzenesulfonic acid; carbon nanotube.

Type:

protein-coding

RefSeq Status:

VALIDATED

Also known as:

islet of Langerhans regenerating protein 2; lithostathine-2; MGC107500; pancreatic stone protein 2; pancreatic thread protein 2; PSP; PTP; REG-2; regenerating islet-derived, mouse homolog 2; RegII

RGD Orthologs

Human

Bonobo

Green Monkey

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	REG1B (regenerating family member 1 beta)	HGNC	Ensembl, HGNC, HomoloGene, Inparanoid, OrthoDB, Panther, PhylomeDB
Pan paniscus (bonobo/pygmy chimpanzee):	LOC100993115 (lithostathine-1-beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (African green monkey):	LOC103219989 (lithostathine-1-beta)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	REG1A (regenerating family member 1 alpha)	HGNC	Ensembl, HGNC, OrthoDB, OrthoMCL, PhylomeDB
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Reg1a (regenerating family member 1 alpha)	Alliance	DIOPT (OMA\|OrthoFinder\|PANTHER)
Homo sapiens (human):	REG1A (regenerating family member 1 alpha)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|Roundup)
Homo sapiens (human):	REG1B (regenerating family member 1 beta)	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Danio rerio (zebrafish):	si:dkey-241l7.3	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder)
Danio rerio (zebrafish):	lectin	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder)
Danio rerio (zebrafish):	si:ch211-125e6.5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder)
Danio rerio (zebrafish):	si:ch211-125e6.12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder)
Danio rerio (zebrafish):	si:dkey-241l7.5	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder)
Danio rerio (zebrafish):	si:dkey-241l7.2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder)
Danio rerio (zebrafish):	si:dkey-241l7.6	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder)
Danio rerio (zebrafish):	si:dkeyp-75b4.10	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder)
Danio rerio (zebrafish):	si:ch211-125e6.11	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder)
Danio rerio (zebrafish):	si:dkey-9i23.4	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder)
Danio rerio (zebrafish):	zgc:172053	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder)
Caenorhabditis elegans (roundworm):	clec-178	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER)
Caenorhabditis elegans (roundworm):	Y38H6C.8	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA)
Drosophila melanogaster (fruit fly):	rgn	Alliance	DIOPT (PhylomeDB\|Roundup)
Caenorhabditis elegans (roundworm):	clec-86	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA)

Latest Assembly:

GRCm38 - Mouse Genome Assembly GRCm38

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	78,382,138 - 78,385,082 (+)	NCBI	GRCm39		mm39
GRCm39 Ensembl	6	78,372,606 - 78,385,089 (+)	Ensembl
GRCm38	6	78,405,155 - 78,408,099 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	78,395,623 - 78,408,106 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	78,355,149 - 78,358,091 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	6	78,334,664 - 78,337,606 (+)	NCBI			mm8
Celera	6	80,428,136 - 80,431,078 (+)	NCBI		Celera
Cytogenetic Map	6	C3	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4,6-trinitrobenzenesulfonic acid (EXP)

5-aza-2'-deoxycytidine (ISO)

5-iodotubercidin (ISO)

aflatoxin B1 (ISO)

arsenous acid (ISO)

benzo[a]pyrene (ISO)

carbon nanotube (EXP)

ciguatoxin CTX1B (EXP)

clofibrate (EXP)

diarsenic trioxide (ISO)

disodium selenite (ISO)

dorsomorphin (ISO)

lead diacetate (EXP)

paracetamol (EXP)

phenobarbital (EXP)

SB 431542 (ISO)

sodium dichromate (EXP)

sodium fluoride (EXP)

titanium dioxide (EXP)

valproic acid (EXP)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

antimicrobial humoral immune response mediated by antimicrobial peptide (IBA)

cell wall disruption in other organism (IBA)

myelination (IMP)

positive regulation of cell population proliferation (IBA)

response to peptide hormone (IBA)

suckling behavior (IMP)

Cellular Component

collagen-containing extracellular matrix (HDA)

extracellular region (IEA)

extracellular space (IBA)

Molecular Function

carbohydrate binding (IEA)

oligosaccharide binding (IBA)

peptidoglycan binding (IBA)

signaling receptor activity (IBA)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal auditory brainstem response (IEA)

abnormal hypoglossal nerve morphology (IAGP)

abnormal response/metabolism to endogenous compounds (IAGP)

abnormal suckling behavior (IAGP)

decreased hepatocyte proliferation (IAGP)

decreased liver regeneration (IAGP)

improved glucose tolerance (IEA)

increased cellular sensitivity to oxidative stress (IAGP)

increased prepulse inhibition (IEA)

increased sensitivity to induced morbidity/mortality (IAGP)

increased susceptibility to injury (IAGP)

References

References - curated


1.	RGD automated import pipeline
2.	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
3.	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:8340418	PMID:8522062	PMID:8808978	PMID:8863190	PMID:9055810	PMID:10349636	PMID:10767532	PMID:11042159	PMID:11076861	PMID:11217851	PMID:12466851	PMID:12477932
PMID:16141072	PMID:16141073	PMID:17133485	PMID:17192462	PMID:17898082	PMID:18297134	PMID:18678917	PMID:20489047	PMID:20876350	PMID:20919961	PMID:21410322	PMID:21873635
PMID:22252863	PMID:23147030	PMID:23867474	PMID:24194600	PMID:24801175	PMID:25370781	PMID:27524624	PMID:27626380	PMID:28009527	PMID:28071719	PMID:31597102

Genomics

Comparative Map Data

Reg2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	78,382,138 - 78,385,082 (+)	NCBI	GRCm39		mm39
GRCm39 Ensembl	6	78,372,606 - 78,385,089 (+)	Ensembl
GRCm38	6	78,405,155 - 78,408,099 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	78,395,623 - 78,408,106 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	78,355,149 - 78,358,091 (+)	NCBI	GRCm37		mm9	NCBIm37
MGSCv36	6	78,334,664 - 78,337,606 (+)	NCBI			mm8
Celera	6	80,428,136 - 80,431,078 (+)	NCBI		Celera
Cytogenetic Map	6	C3	NCBI

REG1B
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38.p13 Ensembl	2	79,085,023 - 79,088,019 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh38	2	79,085,023 - 79,087,993 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh37	2	79,312,149 - 79,315,119 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	2	79,165,659 - 79,168,627 (-)	NCBI	NCBI36		hg18	NCBI36
Build 34	2	79,223,805 - 79,226,774	NCBI
Celera	2	79,140,874 - 79,143,875 (-)	NCBI
Cytogenetic Map	2	p12	NCBI
HuRef	2	79,047,465 - 79,050,466 (-)	NCBI		HuRef
CHM1_1	2	79,241,459 - 79,244,460 (-)	NCBI		CHM1_1

LOC100993115
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	2A	80,736,161 - 80,739,154 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	2A	80,736,161 - 80,739,154 (-)	Ensembl	panpan1.1		panPan2
Mhudiblu_PPA_v0	2A	79,171,602 - 79,174,591 (-)	NCBI	Mhudiblu_PPA_v0		panPan3

LOC103219989
(Chlorocebus sabaeus - African green monkey)

Vervet Assembly	Chr	Position (strand)	Source	Genome Browsers
Vervet Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	14	28,159,979 - 28,163,475 (+)	NCBI
ChlSab1.1 Ensembl	14	28,160,506 - 28,163,996 (+)	Ensembl

Position Markers

Reg1

Mouse Assembly	Chr	Position (strand)	Source
Cytogenetic Map	6	C3	UniSTS
Cytogenetic Map	6	C-D	UniSTS
cM Map	6	33.5	UniSTS
cM Map	6		UniSTS

QTLs in Region (GRCm38)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
25440480	Moaq2_m	modifier of alien QTL 2 (mouse)					6	1	117500000	Mouse
26884414	Bzwq12_m	bi-zygomatic width QTL 12, 16 week (mouse)					6	3400000	139100000	Mouse
1300556	Cia6_m	collagen induced arthritis QTL 6 (mouse)			Not determined		6	4464884	87426034	Mouse
4142126	W3q3_m	weight 3 weeks QTL 3 (mouse)			Not determined			4503823	96656149	Mouse
4142361	W10q11_m	weight 10 weeks QTL 11 (mouse)			Not determined			4503823	96656149	Mouse
4142271	Egq8_m	early growth QTL 8 (mouse)			Not determined			4503823	96656149	Mouse
4142232	W6q4_m	weight 6 weeks QTL 4 (mouse)			Not determined			4503823	96656149	Mouse
26884441	Sklq3_m	skull length QTL 3, 5 week (mouse)					6	7600000	80600000	Mouse
13208564	Bmiq7_m	body mass index QTL 7 (mouse)					6	25000000	80000000	Mouse
1558984	Cplaq9_m	circadian period of locomotor activity 9 (mouse)			Not determined		6	38669625	92607450	Mouse
1300618	Pgia19_m	proteoglycan induced arthritis 19 (mouse)			Not determined		6	45314059	87426034	Mouse
10412157	Fl1n_m	fatty liver 1 in NSY (mouse)			Not determined		6	45314059	128835032	Mouse
4142259	Tabw2_m	tally ho associated body weight 2 (mouse)			Not determined			46935985	136423692	Mouse
25314319	Histh6_m	histamine hypersensitivity 6 (mouse)					6	48720000	125360000	Mouse
25314320	Histh5_m	histamine hypersensitivity 5 (mouse)					6	48720000	148450000	Mouse
1301962	Eila2_m	ethanol induced locomotor activity 2 (mouse)			Not determined		6	48726556	125356785	Mouse
1301254	Skts11_m	skin tumor susceptibility 11 (mouse)			Not determined		6	51179150	85179300	Mouse
1357683	Igf1sl1_m	IGF-1 serum levels 1 (mouse)			Not determined		6	52161713	116155267	Mouse
4141028	Mclr_m	methylcholanthrene lymphoma resistance (mouse)			Not determined			54373427	88379171	Mouse
15039373	Adip28_m	adiposity 28 (mouse)					6	56308211	90308211	Mouse
15039375	Bw41_m	body weight QTL 41 (mouse)					6	56308211	90308211	Mouse
1558977	Skmw10_m	skeletal muscle weight 10 (mouse)			Not determined		6	58447583	92447710	Mouse
10043972	Obq28_m	obesity QTL 28 (mouse)			Not determined		6	58540433	92540433	Mouse
1301740	Bwq2_m	body weight QTL 2 (mouse)			Not determined		6	60057680	94057799	Mouse
1301369	Im4_m	immunoregulatory 4 (mouse)			Not determined		6	63484738	97484905	Mouse
1300650	Bw18_m	body weight QTL 18 (mouse)			Not determined		6	66713869	100714031	Mouse
1301876	Bits2_m	bitterness sensitivity 2 (mouse)			Not determined		6	70425898	104426034	Mouse
1301813	Skl3_m	skeletal size (tail length) 3 (mouse)			Not determined		6	70425898	104426034	Mouse
1301034	Egrm2_m	early growth rate (mouse)			Not determined		6	70425898	104426034	Mouse
4141990	Etax6_m	ethanol induced ataxia 6 (mouse)			Not determined			71322621	86275719	Mouse
1302020	Bbaa20_m	B.burgdorferi-associated arthritis 20 (mouse)			Not determined		6	71322621	93464093	Mouse
1300869	Stheal5_m	soft tissue heal 5 (mouse)			Not determined		6	71575060	105575178	Mouse
1300954	Fcsa1_m	femoral cross-sectional area 1 (mouse)			Not determined		6	71981024	105981170	Mouse
1301521	Pas1c_m	pulmonary adenoma susceptibility 1c (mouse)			Not determined		6	71981024	105981170	Mouse
13506930	Recrq9_m	recombination rate in male meiosis QTL 9 (mouse)					6	73500000	134700000	Mouse
1301320	Ots1_m	ovarian teratoma susceptibility 1 (mouse)			Not determined		6	75447583	104503555	Mouse
1301571	Arrd1_m	age-related retinal degeneration 1 (mouse)			Not determined		6	75544356	92607450	Mouse
1300674	Nidd3n_m	non-insulin-dependent diabetes mellitus 3 in NSY (mouse)			Not determined		6	75544356	94225955	Mouse
10412195	Efw_m	epididymal fat weight (mouse)			Not determined		6	75544356	94225955	Mouse
10043901	Pfat5_m	predicted fat percentage 5 (mouse)			Not determined		6	75607306	109607450	Mouse
10412208	Cypr4_m	cytokine production 4 (mouse)			Not determined		6	75716503	109716697	Mouse
1357875	Pfat2_m	predicted fat percentage 2 (mouse)			Not determined		6	76463949	110464093	Mouse
14697704	Stsl4_m	Salmonella typhimurium susceptibility locus 4 (mouse)					6	77100000	90000000	Mouse
13824985	Alh1_m	amplitude of lateral head displacement 1 (mouse)					6	78000000	97000000	Mouse

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	83
Count of miRNA genes:	77
Interacting mature miRNAs:	77
Transcripts:	ENSMUST00000023906
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_009043	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AB035214	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AB035218	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC113058	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK008196	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC098503	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466523	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	D14011	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSMUST00000023906 ⟹ ENSMUSP00000023906

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38.p6 Ensembl	6	78,405,158 - 78,408,106 (+)	Ensembl

RefSeq Acc Id:

ENSMUST00000203657 ⟹ ENSMUSP00000145184

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38.p6 Ensembl	6	78,395,623 - 78,407,681 (+)	Ensembl

RefSeq Acc Id:

NM_009043 ⟹ NP_033069

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	6	78,382,138 - 78,385,082 (+)	NCBI
GRCm38	6	78,405,155 - 78,408,099 (+)	NCBI
MGSCv37	6	78,355,149 - 78,358,091 (+)	RGD
Celera	6	80,428,136 - 80,431,078 (+)	RGD
cM Map	6		ENTREZGENE

Sequence:

show sequence

AGTATTCATTATTCCTAGCTGACAGAAATTATTGATTTAGAATTTAAATCGAAGACTGTCTGCT
GATCAGCATGGCTCAGAACAATGTATACCTTATCCTGTTCTTATGCCTGATGTTCCTGTCATAC
AGCCAAGGCCAGGTAGCTGAAGAAGACTTCCCCTTGGCTGAAAAAGACCTTCCTTCTGCCAAAA
TCAACTGCCCAGAGGGTGCCAACGCCTATGGTTCCTACTGTTATTATCTAATTGAAGACCGTTT
GACCTGGGGGGAGGCTGATCTCTTTTGCCAGAACATGAATGCAGGTCACCTGGTGTCAATACTC
AGCCAGGCTGAGAGCAACTTTGTGGCCTCGCTGGTTAAGGAGAGTGGTACTACAGCTTCCAATG
TCTGGACTGGACTTCATGACCCTAAAAGTAACCGTCGTTGGCACTGGAGCAGTGGCTCCCTATT
TCTCTTCAAGTCATGGGCCACTGGAGCTCCAAGCACTGCCAACCGTGGTTATTGTGTATCGCTG
ACTTCAAACACAGCATACAAAAAATGGAAGGACGAAAACTGTGAGGCACAGTACTCCTTTGTCT
GCAAGTTCAGAGCCTAAAGTCACCTGAAGAACAGATGTGCAGAACTCTGTTACTATATATTATA
AATGAAAGAAGACCATCTATCTGCAAAATAAATACTCTTTCCTGTAATAACTTAAAAAAAAAAA
AAAAAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_033069	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH98503	(Get FASTA)	NCBI Sequence Viewer
	BAA03112	(Get FASTA)	NCBI Sequence Viewer
	BAB25526	(Get FASTA)	NCBI Sequence Viewer
	EDK99018	(Get FASTA)	NCBI Sequence Viewer
	Q08731	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_033069 ⟸ NM_009043
- Peptide Label:	precursor
- UniProtKB:	Q08731 (UniProtKB/Swiss-Prot), Q545J0 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAQNNVYLILFLCLMFLSYSQGQVAEEDFPLAEKDLPSAKINCPEGANAYGSYCYYLIEDRLTW GEADLFCQNMNAGHLVSILSQAESNFVASLVKESGTTASNVWTGLHDPKSNRRWHWSSGSLFLF KSWATGAPSTANRGYCVSLTSNTAYKKWKDENCEAQYSFVCKFRA hide sequence

RefSeq Acc Id:

ENSMUSP00000145184 ⟸ ENSMUST00000203657

RefSeq Acc Id:

ENSMUSP00000023906 ⟸ ENSMUST00000023906

Protein Domains

C-type lectin

Promoters

RGD ID:

6890070

Promoter ID:

EPDNEW_M8485

Type:

single initiation site

Name:

Reg2_1

Description:

Mus musculus regenerating islet-derived 2 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	6	78,405,155 - 78,405,215	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:97896	AgrOrtholog
Ensembl Genes	ENSMUSG00000023140	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Protein	ENSMUSP00000023906	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSMUSP00000145184	UniProtKB/TrEMBL
Ensembl Transcript	ENSMUST00000023906	ENTREZGENE, UniProtKB/Swiss-Prot
	ENSMUST00000203657	UniProtKB/TrEMBL
Gene3D-CATH	3.10.100.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
InterPro	C-type_lectin-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	C-type_lectin-like/link_sf	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	C-type_lectin_CS	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	CTDL_fold	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	mmu:19693	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGD	MGI:97896	ENTREZGENE
NCBI Gene	19693	ENTREZGENE
Pfam	Lectin_C	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Reg2	PhenoGen
PROSITE	C_TYPE_LECTIN_1	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	C_TYPE_LECTIN_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	CLECT	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF56436	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A0N4SVN9_MOUSE	UniProtKB/TrEMBL
	LIT2_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE
	Q545J0	ENTREZGENE, UniProtKB/TrEMBL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)