Advanced Search (OLGA)

Gene: Bcl2a1b (B cell leukemia/lymphoma 2 related protein A1b) Mus musculus

Analyze

Symbol:

Bcl2a1b

Name:

B cell leukemia/lymphoma 2 related protein A1b

RGD ID:

1621639

MGI Page

MGI

Description:

Predicted to enable BH domain binding activity and channel activity. Predicted to be involved in apoptotic signaling pathway; mitochondrial fusion; and positive regulation of apoptotic process. Predicted to be located in cytoplasm. Predicted to be active in mitochondrial outer membrane. Is expressed in craniocervical region bone; hemolymphoid system; musculature; and respiratory system. Orthologous to human BCL2A1 (BCL2 related protein A1).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

A1-; A1-b; anti-apoptotic protein A1-b; B-cell leukemia/lymphoma 2 related protein A1b

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	BCL2A1 (BCL2 related protein A1)	RGD	RGD
Rattus norvegicus (Norway rat):	Bcl2a1 (BCL2-related protein A1)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Bcl2a1 (BCL2 related protein A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	BCL2A1 (BCL2 related protein A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	BCL2A1 (BCL2 related protein A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Bcl2a1 (BCL2 related protein A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	BCL2A1 (BCL2 related protein A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	BCL2A1 (BCL2 related protein A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Bcl2a1 (BCL2 related protein A1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Bcl2a1 (BCL2-related protein A1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	BCL2A1 (BCL2 related protein A1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	89,081,326 - 89,089,891 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	89,081,262 - 89,089,880 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	89,199,273 - 89,207,838 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	89,199,209 - 89,207,827 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	89,094,111 - 89,102,676 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	88,997,122 - 89,005,719 (+)	NCBI		MGSCv36	mm8
Celera	9	87,568,132 - 87,573,632 (-)	NCBI		Celera
Cytogenetic Map	9	E3.1	NCBI
cM Map	9	47.24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

allergic disease (IMP)

Bloom syndrome (ISO)

Breast Neoplasms (ISO)

colorectal cancer (ISO)

COVID-19 (ISO)

Esophageal Neoplasms (ISO)

rheumatoid arthritis (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-pilocarpine (ISO)

(-)-demecolcine (ISO)

(S)-naringenin (ISO)

(S)-nicotine (ISO)

1'-acetoxychavicol acetate (ISO)

1,1,1-Trichloro-2-(o-chlorophenyl)-2-(p-chlorophenyl)ethane (ISO)

1,2-dimethylhydrazine (EXP)

1-nitropyrene (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,6-trinitrobenzenesulfonic acid (EXP)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (EXP)

2-hydroxypropanoic acid (ISO)

2-naphthylamine (ISO)

3,3',5-triiodo-L-thyronine (ISO)

4-hydroxynon-2-enal (EXP)

4-hydroxyphenyl retinamide (EXP,ISO)

4-nitroquinoline N-oxide (EXP)

6alpha-methylprednisolone (ISO)

acetamide (ISO)

actinomycin D (ISO)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

antirheumatic drug (ISO)

aristolochic acid A (ISO)

arsenite(3-) (EXP)

arsenous acid (ISO)

azathioprine (ISO)

bathocuproine disulfonic acid (ISO)

benzene (ISO)

benzo[a]pyrene (EXP,ISO)

bisphenol A (EXP,ISO)

bisphenol F (EXP)

bortezomib (ISO)

butanal (ISO)

cadmium dichloride (ISO)

calcitriol (ISO)

cannabidiol (ISO)

carbon monoxide (ISO)

carbon nanotube (ISO)

CGP 52608 (ISO)

cholesterol (ISO)

choline (EXP)

chromium(6+) (EXP)

ciguatoxin CTX1B (EXP)

cisplatin (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

cordycepin (ISO)

crocidolite asbestos (ISO)

CU-O LINKAGE (ISO)

curcumin (ISO)

dexamethasone (EXP)

diarsenic trioxide (ISO)

Dibutyl phosphate (ISO)

dichloromethane (ISO)

diclofenac (ISO)

diethyl maleate (ISO)

diosgenin (ISO)

dioxygen (EXP)

doxorubicin (ISO)

endosulfan (ISO)

eriodictyol (ISO)

ethyl methanesulfonate (ISO)

ethylbenzene (ISO)

Evodiamine (ISO)

fenofibrate (ISO)

flavonoids (ISO)

folic acid (EXP)

furan (ISO)

Fusarenone X (EXP)

gentamycin (ISO)

glycochenodeoxycholic acid (ISO)

glyphosate (ISO)

guggulsterone (ISO)

imidazopyrazole (ISO)

indole-3-methanol (ISO)

indometacin (ISO)

ionomycin (ISO)

iron(2+) sulfate (anhydrous) (ISO)

isoflurane (ISO)

kaempferol (ISO)

kojic acid (ISO)

L-methionine (EXP)

lipopolysaccharide (EXP,ISO)

lonafarnib (ISO)

LY294002 (EXP)

maneb (ISO)

melphalan (ISO)

methotrexate (ISO)

methyl methanesulfonate (ISO)

methylisothiazolinone (ISO)

methylseleninic acid (ISO)

Mitotane (ISO)

Muraglitazar (ISO)

N-(6-acetamidohexyl)acetamide (ISO)

naphthalenes (ISO)

nickel atom (ISO)

nickel dichloride (ISO)

nickel sulfate (ISO)

nicotine (ISO)

o-xylene (ISO)

ochratoxin A (ISO)

oxycodone (ISO)

ozone (EXP,ISO)

paracetamol (EXP)

paraquat (ISO)

pentanal (ISO)

peptidoglycan (ISO)

PF-3758309 (ISO)

phorbol 13-acetate 12-myristate (ISO)

pirinixic acid (EXP)

piroxicam (ISO)

poly(I:C) (ISO)

prednisolone (ISO)

pregnenolone 16alpha-carbonitrile (EXP)

propanal (ISO)

protein kinase inhibitor (ISO)

pyridaben (EXP)

pyrrolidine dithiocarbamate (ISO)

quercetin (ISO)

rac-lactic acid (ISO)

reactive oxygen species (ISO)

resveratrol (ISO)

romidepsin (ISO)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (ISO)

simazine (EXP)

sodium arsenite (ISO)

sodium aurothiomalate (ISO)

sodium dichromate (ISO)

streptozocin (ISO)

sulforaphane (ISO)

tamibarotene (ISO)

tetrachloromethane (EXP)

thioacetamide (ISO)

thiram (ISO)

titanium dioxide (EXP)

toluene (ISO)

topotecan (ISO)

Tributyltin oxide (ISO)

trichloroethene (ISO)

trichostatin A (ISO)

triphenyl phosphate (ISO)

troglitazone (ISO)

undecane (ISO)

usnic acid (ISO)

vincristine (ISO)

vorinostat (ISO)

withaferin A (ISO)

zerumbone (ISO)

zinc atom (ISO)

zinc dichloride (ISO)

zinc(0) (ISO)

zoledronic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

cerebral cortex development (ISO)

extrinsic apoptotic signaling pathway in absence of ligand (IBA)

intrinsic apoptotic signaling pathway in response to DNA damage (IBA)

mitochondrial fusion (IBA)

positive regulation of apoptotic process (IBA)

release of cytochrome c from mitochondria (IBA)

response to cisplatin (ISO)

Cellular Component

cytoplasm (ISO)

mitochondrial outer membrane (IBA)

Molecular Function

BH domain binding (ISO)

channel activity (IBA)

protein binding (ISO)

protein-containing complex binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

intrinsic apoptotic pathway (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal dendritic cell physiology (IAGP)

decreased CD4-positive, alpha-beta memory T cell number (IAGP)

decreased central memory CD4-positive, alpha-beta T cell number (IAGP)

decreased dendritic cell number (IAGP)

decreased effector memory CD4-positive, alpha-beta T cell number (IAGP)

decreased gamma-delta T cell number (IAGP)

decreased regulatory T cell number (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	The Bcl-2 apoptotic switch in cancer development and therapy.	Adams JM and Cory S, Oncogene. 2007 Feb 26;26(9):1324-37.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
3.	Essential role of the prosurvival bcl-2 homologue A1 in mast cell survival after allergic activation.	Xiang Z, etal., J Exp Med 2001 Dec 3;194(11):1561-69.

Additional References at PubMed

PMID:8889548	PMID:9645611	PMID:10349636	PMID:11042159	PMID:11076861	PMID:11217851	PMID:12466851	PMID:12477932	PMID:14681479	PMID:15728238	PMID:15747579	PMID:16141072
PMID:16141073	PMID:21267068	PMID:21873635	PMID:25559680	PMID:28085150	PMID:28362427	PMID:29339775	PMID:31216482

Genomics

Comparative Map Data

Bcl2a1b
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	89,081,326 - 89,089,891 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	89,081,262 - 89,089,880 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	89,199,273 - 89,207,838 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	89,199,209 - 89,207,827 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	89,094,111 - 89,102,676 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	88,997,122 - 89,005,719 (+)	NCBI		MGSCv36	mm8
Celera	9	87,568,132 - 87,573,632 (-)	NCBI		Celera
Cytogenetic Map	9	E3.1	NCBI
cM Map	9	47.24	NCBI

BCL2A1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	79,960,892 - 79,971,196 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	79,960,892 - 79,971,196 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	80,253,234 - 80,263,538 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	78,040,290 - 78,050,698 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	15	78,040,289 - 78,050,698	NCBI
Celera	15	57,189,526 - 57,199,937 (-)	NCBI		Celera
Cytogenetic Map	15	q25.1	NCBI
HuRef	15	57,011,277 - 57,021,688 (-)	NCBI		HuRef
CHM1_1	15	80,370,121 - 80,380,532 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	77,823,803 - 77,834,097 (-)	NCBI		T2T-CHM13v2.0

Bcl2a1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	98,596,806 - 98,604,890 (+)	NCBI		GRCr8
mRatBN7.2	8	89,716,914 - 89,724,998 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	8	89,716,914 - 89,724,998 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	95,382,133 - 95,390,252 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	93,581,342 - 93,589,461 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	91,445,125 - 91,453,238 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	96,551,424 - 96,559,527 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	96,551,245 - 96,559,483 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	96,059,040 - 96,067,299 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	94,045,109 - 94,053,777 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
RGSC_v3.1	8	94,064,563 - 94,073,232 (+)	NCBI
Celera	8	89,278,398 - 89,286,468 (+)	NCBI		Celera
Cytogenetic Map	8	q31	NCBI

Bcl2a1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955533	773,912 - 785,037 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955533	773,912 - 785,040 (-)	NCBI	ChiLan1.0	ChiLan1.0

BCL2A1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	69,210,990 - 69,220,256 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	73,375,852 - 73,385,125 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	58,925,853 - 58,935,122 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	77,884,030 - 77,893,167 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	77,882,940 - 77,893,628 (-)	Ensembl	panpan1.1		panPan2

BCL2A1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	3	57,451,512 - 57,463,692 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	3	57,424,555 - 57,463,692 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	3	60,109,775 - 60,121,887 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	3	57,884,668 - 57,896,576 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	3	57,883,834 - 57,896,576 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	3	57,383,698 - 57,395,826 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	3	57,590,934 - 57,602,831 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	3	57,937,969 - 57,949,867 (+)	NCBI		UU_Cfam_GSD_1.0

Bcl2a1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	120,133,708 - 120,163,718 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	37,981,772 - 37,993,116 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936471	37,981,851 - 37,993,097 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

BCL2A1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	7	48,887,094 - 48,897,870 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	7	48,887,227 - 48,897,667 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	7	54,395,262 - 54,419,816 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

BCL2A1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	3,451,773 - 3,461,215 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	3,451,873 - 3,461,180 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	138,408,361 - 138,418,275 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Bcl2a1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624941	907,119 - 933,356 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624941	907,382 - 932,751 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Bcl2a1b
123 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	82
Count of miRNA genes:	80
Interacting mature miRNAs:	82
Transcripts:	ENSMUST00000068569
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
10401247	Bglu14_m	blood glucose level 14 (mouse)			Not determined		9	79279863	113279941	Mouse
1357461	Idd2_m	insulin dependent diabetes susceptibility 2 (mouse)			Not determined		9	82792386	116792481	Mouse
1301456	Adip5_m	adiposity 5 (mouse)			Not determined		9	59369946	93370128	Mouse
1302103	Dob2_m	dietary obesity 2 (mouse)			Not determined		9	86121898	120118690	Mouse
10054492	El7_m	epilepsy 7 (mouse)			Not determined		9	75682646	114303447	Mouse
1300884	Sluc11_m	susceptibility to lung cancer 11 (mouse)			Not determined		9	82792386	116792481	Mouse
10412180	Msam3_m	muscle, skeletal, activity measure 3 (mouse)			Not determined		9	85779563	108518385	Mouse
1301407	Rapop2_m	radiation-induced apoptosis 2 (mouse)			Not determined		9	76417989	110418183	Mouse
1301725	Lifespan1_m	life span 1 (mouse)			Not determined		9	74250230	108250378	Mouse
10412174	Habiir4_m	hyperoxic acute lung injury imprinted region 4 (mouse)			Not determined		9	69267747	98701707	Mouse
10766454	Char10_m	P. chabaudi malaria resistance QTL 10 (mouse)					9	82792386	116792481	Mouse
4141545	Tailaq2_m	tail length adjusted QTL 2 (mouse)			Not determined			63239711	120191934	Mouse
1301573	Etohcta8_m	ethanol conditioned taste aversion 8 (mouse)			Not determined		9	72859058	106859205	Mouse
1300549	Bbaa17_m	B. burgdorferi-associated arthritis 17 (mouse)			Not determined		9	86107600	120107729	Mouse
4141224	Dxmod_m	doxorubicin nephropathy modifier (mouse)			Not determined			49452421	101406120	Mouse
1357635	Splq4_m	spleen weight QTL 4 (mouse)			Not determined		9	63239711	120191934	Mouse
1301636	Lith5_m	lithogenic gene 5 (mouse)			Not determined		9	66089077	100089175	Mouse
13207569	Tcq13_m	total cholesterol QTL 13 (mouse)					9	59897283	109089068	Mouse
1301192	Skts6_m	skin tumor susceptibility 6 (mouse)			Not determined		9	78522698	112522808	Mouse
10045638	Heal29_m	wound healing/regeneration 29 (mouse)			Not determined		9	67006220	101006220	Mouse
1302065	El1_m	epilepsy 1 (mouse)			Not determined		9	75682646	114303447	Mouse
12880422	V25Dq6_m	vitamin D inactive form serum level QTL 6 (mouse)					9	87677199	121677199	Mouse
1300848	Skull13_m	skull morphology 13 (mouse)			Not determined		9	59369946	93370128	Mouse
11081165	Psl6_m	promotion susceptibility QTL 6 (mouse)					9	65041191	95522808	Mouse
4142042	Alpq3_m	alcohol preference QTL 3 (mouse)			Not determined		9	37306197	98701707	Mouse
1301302	Pas4_m	pulmonary adenoma susceptibility 4 (mouse)			Not determined		9	69121898	103121973	Mouse
1301621	Hpic1_m	haloperidol-induced catalepsy 1 (mouse)			Not determined		9	69428566	103428698	Mouse
1301172	Fembrs6_m	femur breaking strength 6 (mouse)			Not determined		9	59024387	93024534	Mouse
5491195	Mobq8_m	multigenic obesity QTL 8 (mouse)			Not determined		9	59369946	93370128	Mouse
1301241	Renf1_m	renal failure 1 (mouse)			Not determined		9	52034478	99792481	Mouse
10054068	El8_m	epilepsy 8 (mouse)			Not determined		9	72859058	106859205	Mouse
11251716	Siim2_m	stress induced immobility 2 (mouse)					9	86625682	120625682	Mouse
4141833	W10q13_m	weight 10 weeks QTL 13 (mouse)			Not determined			63239711	120191934	Mouse
1301924	Bmd10_m	bone mineral density 10 (mouse)			Not determined		9	68779563	102779705	Mouse
1301732	Char1_m	P. chabaudi malaria resistance QTL 1 (mouse)			Not determined		9	81680321	115680445	Mouse
1301803	Stheal9_m	soft tissue heal 9 (mouse)			Not determined		9	59024387	93024534	Mouse
1301611	Lrnx3_m	learning contextual 3 (mouse)			Not determined		9	62149767	96149881	Mouse
10043877	Adip21_m	adiposity 21 (mouse)			Not determined		9	56439108	90439255	Mouse
1301487	Nociq1_m	nociceptive sensitivity inflammatory QTL 1 (mouse)			Not determined		9	84406017	118406120	Mouse
1357610	Vtbt8_m	vertebral trabecular bone trait 8 (mouse)			Not determined		9	68779563	102779705	Mouse
1301869	Tbbmd4_m	total body bone mineral density 4 (mouse)			Not determined		9	76024387	101406120	Mouse

Markers in Region

U23778

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
Cytogenetic Map	9	E3.1	UniSTS
Whitehead/MRC_RH	9	962.74	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_007534	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AF293360	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AH005845	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK138369	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK152200	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC100462	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC116241	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BE650553	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BP773251	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CT030686	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000068569 ⟹ ENSMUSP00000065612

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	9	89,081,262 - 89,089,880 (+)	Ensembl
GRCm38.p6 Ensembl	9	89,199,209 - 89,207,827 (+)	Ensembl

RefSeq Acc Id:

NM_007534 ⟹ NP_031560

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	9	89,081,326 - 89,089,891 (+)	NCBI
GRCm38	9	89,199,273 - 89,207,838 (+)	ENTREZGENE
MGSCv37	9	89,094,111 - 89,102,676 (+)	RGD
cM Map	9		ENTREZGENE

Sequence:

show sequence

GGGTTCCTCCCCTGACAAGACCTATCTTTGCAGTCTTTGCCTCCTTGGCCTCTAGGTGGGCAGC
AGCAGTCAGCTCTGCCAGGGAAGATGGCTGAGTACGAGTTCATGTATATCCACTCCCTGGCTGA
GCACTATCTTCAGTATGTGCTACAGGTACCCGCCTTTGAGTCGGCTCCAAGCAAAGCATGCAGA
GTGCTACAAAGAGTTGCTTTCTCCGTTCAGAAGGAAGTTGAAAAGAATCTGAAGTCATACTTGG
ATGACTTTCACGTGGAATCCATAGATACCGCCAGAATAATATTCAACCAAGTGATGGAAAAAGA
GTTTGAAGATGGCATCATTAACTGGGGAAGGATTGTGACTATATTTGCCTTTGGGGGTGTTCTC
CTCAAAAAACTTCCGCAAGAGCAGATTGCCCTGGATGTAGGTGCTTACAAACAAGTTTCCAGTT
TTGTGGCAGAATTCATAATCAATAACACAGGAGAATGGATACGGCGGAATGGAGGTTGGGAAGA
TGGCTTCATAAAGAAGTTTGAACCCAAATCTGGCTGGCTGACTTTTCTGCAGATGACAGGACAG
TTCTGGGAAATGCTCTTTCTCCTCAAGTAACACTACGGACCAGAGAGAACCTTGGCTCCCACGA
GAATGGTTATCAGCACTTGGCATTTCCATTTACAAACATGAAACTTGTCTTTCCAGAGTTGCAG
ATATTTTGTTTCAACTTTAATGAATAAATTACTAGTATTTGTTTCTGTACATGTTTCATG

hide sequence

Protein Sequences


Protein RefSeqs	NP_031560	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAB97954	(Get FASTA)	NCBI Sequence Viewer
	AAG02475	(Get FASTA)	NCBI Sequence Viewer
	AAI00463	(Get FASTA)	NCBI Sequence Viewer
	AAI16242	(Get FASTA)	NCBI Sequence Viewer
	BAE23635	(Get FASTA)	NCBI Sequence Viewer
	BAE31029	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000065612
	ENSMUSP00000065612.5

RefSeq Acc Id:	NP_031560 ⟸ NM_007534
- UniProtKB:	Q497M6 (UniProtKB/TrEMBL), O55177 (UniProtKB/TrEMBL), Q4FK02 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAEYEFMYIHSLAEHYLQYVLQVPAFESAPSKACRVLQRVAFSVQKEVEKNLKSYLDDFHVESI DTARIIFNQVMEKEFEDGIINWGRIVTIFAFGGVLLKKLPQEQIALDVGAYKQVSSFVAEFIIN NTGEWIRRNGGWEDGFIKKFEPKSGWLTFLQMTGQFWEMLFLLK hide sequence

Ensembl Acc Id:

ENSMUSP00000065612 ⟸ ENSMUST00000068569

Protein Domains

Bcl-2 Bcl-2 homology region 1-3

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q497M6-F1-model_v2	AlphaFold	Q497M6	1-172	view protein structure

Promoters

RGD ID:

6844259

Promoter ID:

MM_KWN:58329

Type:

Non-CpG

SO ACC ID:

SO:0000170

Source:

MPROMDB

Tissues & Cell Lines:

BoneMarrow_2Hour, BoneMarrow_4Hour

Transcripts:

NM_007534_BCL2A1B, OTTMUST00000079194

Position:

Mouse Assembly	Chr	Position (strand)	Source
MGSCv36	9	89,093,054 - 89,093,554 (+)	MPROMDB

RGD ID:

8670410

Promoter ID:

EPDNEW_M13235

Type:

initiation region

Name:

Bcl2a1b_1

Description:

Mus musculus B cell leukemia/lymphoma 2 related protein A1b ,mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	9	89,199,304 - 89,199,364	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:1278326	AgrOrtholog
Ensembl Genes	ENSMUSG00000089929	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSMUST00000068569	ENTREZGENE
	ENSMUST00000068569.5	UniProtKB/TrEMBL
Gene3D-CATH	1.10.437.10	UniProtKB/TrEMBL
InterPro	Apop_reg_Bcl2Rel	UniProtKB/TrEMBL
	Bcl-2_BH1-3	UniProtKB/TrEMBL
	Bcl2-like_apoptosis	UniProtKB/TrEMBL
	Bcl2_BH1_motif_CS	UniProtKB/TrEMBL
	Bcl2_BH2_motif_CS	UniProtKB/TrEMBL
	Blc2-like_sf	UniProtKB/TrEMBL
	Blc2_fam	UniProtKB/TrEMBL
KEGG Report	mmu:12045	UniProtKB/TrEMBL
MGD	MGI:1278326	ENTREZGENE
NCBI Gene	12045	ENTREZGENE
PANTHER	PTHR11256	UniProtKB/TrEMBL
	PTHR11256:SF10	UniProtKB/TrEMBL
Pfam	Bcl-2	UniProtKB/TrEMBL
PhenoGen	Bcl2a1b	PhenoGen
PRINTS	BCL2FAMILY	UniProtKB/TrEMBL
	BCL2RLATEDA1	UniProtKB/TrEMBL
PROSITE	BCL2_FAMILY	UniProtKB/TrEMBL
	BH1	UniProtKB/TrEMBL
	BH2	UniProtKB/TrEMBL
SMART	BCL	UniProtKB/TrEMBL
Superfamily-SCOP	SSF56854	UniProtKB/TrEMBL
UniProt	O55177	ENTREZGENE, UniProtKB/TrEMBL
	Q497M6	ENTREZGENE, UniProtKB/TrEMBL
	Q4FK02	ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2012-02-07	Bcl2a1b	B cell leukemia/lymphoma 2 related protein A1b	Bcl2a1b	B-cell leukemia/lymphoma 2 related protein A1b	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

RGD Manual Annotations

Mammalian Phenotype