Duoxa2 (dual oxidase maturation factor 2)

Advanced Search (OLGA)

Gene: Duoxa2 (dual oxidase maturation factor 2) Mus musculus

Analyze

Symbol:

Duoxa2

Name:

dual oxidase maturation factor 2

RGD ID:

1620045

MGI Page

MGI

Description:

Predicted to enable enzyme binding activity. Acts upstream of or within hydrogen peroxide metabolic process; regulation of inflammatory response; and regulation of thyroid hormone generation. Predicted to be located in several cellular components, including apical part of cell; cell leading edge; and endoplasmic reticulum. Predicted to be active in membrane. Is expressed in several structures, including genitourinary system; hemolymphoid system gland; liver; lung; and small intestine. Human ortholog(s) of this gene implicated in thyroid dyshormonogenesis 5. Orthologous to human DUOXA2 (dual oxidase maturation factor 2).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

9030623N16Rik; N; Nip2; Numb-interacting protein 2; RP23-173H17.3

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	DUOXA2 (dual oxidase maturation factor 2)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Duoxa2 (dual oxidase maturation factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Duoxa2 (dual oxidase maturation factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	DUOXA2 (dual oxidase maturation factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	DUOXA2 (dual oxidase maturation factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Duoxa2 (dual oxidase maturation factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	DUOXA2 (dual oxidase maturation factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	DUOXA2 (dual oxidase maturation factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Duoxa2 (dual oxidase maturation factor 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Duoxa2 (dual oxidase maturation factor 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	DUOXA2 (dual oxidase maturation factor 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	duox2 (dual oxidase 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	doxa-1	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	mol	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	duoxa1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|OMA\|OrthoFinder\|OrthoInspector\|PhylomeDB)

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	122,129,381 - 122,133,088 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	122,129,381 - 122,133,366 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	122,298,900 - 122,302,885 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	122,298,900 - 122,302,885 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	122,124,636 - 122,128,621 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	121,990,341 - 121,994,326 (+)	NCBI		MGSCv36	mm8
Celera	2	123,449,032 - 123,452,872 (+)	NCBI		Celera
Cytogenetic Map	2	E5	NCBI
cM Map	2	60.62	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

AGAT deficiency (ISO)

Bloom syndrome (ISO)

colorectal cancer (ISO)

congenital hypothyroidism (ISO)

genetic disease (ISO)

thyroid dyshormonogenesis 5 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1-naphthyl isothiocyanate (ISO)

17beta-estradiol (ISO)

17beta-estradiol 3-benzoate (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2-hydroxypropanoic acid (ISO)

3,4-methylenedioxymethamphetamine (EXP)

benzo[a]pyrene (ISO)

dextran sulfate (EXP)

dimethylarsinic acid (EXP)

fonofos (ISO)

furan (ISO)

genistein (EXP)

gentamycin (ISO)

methotrexate (ISO)

methylarsonic acid (EXP)

nickel atom (ISO)

parathion (ISO)

perfluorohexanesulfonic acid (EXP)

rac-lactic acid (ISO)

resveratrol (ISO)

sodium arsenate (EXP)

sodium arsenite (EXP,ISO)

terbufos (ISO)

testosterone (ISO)

trichloroethene (ISO)

triptonide (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

hydrogen peroxide metabolic process (IGI)

positive regulation of cell motility (ISO)

positive regulation of hydrogen peroxide biosynthetic process (ISO)

protein localization (ISO)

protein maturation (ISO)

protein transport (IEA)

regulation of inflammatory response (IGI)

regulation of thyroid hormone generation (IGI)

Cellular Component

apical part of cell (ISO)

cell leading edge (ISO)

cytosol (ISO)

endoplasmic reticulum (ISO)

endoplasmic reticulum membrane (IEA)

membrane (IBA)

plasma membrane (ISO)

Molecular Function

enzyme binding (ISO)

protein binding (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal auditory brainstem response (IEA)

abnormal bone structure (IEA)

abnormal clavicle morphology (IEA)

abnormal cranium morphology (IEA)

abnormal eyelid morphology (IEA)

abnormal femur morphology (IEA)

abnormal hair growth (IEA)

abnormal head morphology (IEA)

abnormal humerus morphology (IEA)

abnormal iris morphology (IEA)

abnormal joint morphology (IEA)

abnormal radius morphology (IEA)

abnormal snout morphology (IEA)

abnormal thoracic cage shape (IEA)

abnormal tibia morphology (IEA)

abnormal ulna morphology (IEA)

abnormal vertebrae morphology (IEA)

abnormal vertebral arch morphology (IEA)

abnormal zygomatic bone morphology (IEA)

absent pinna reflex (IEA)

decreased B cell number (IEA)

decreased B-2 B cell number (IEA)

decreased body length (IEA)

decreased bone mineral content (IEA)

decreased bone mineral density (IEA)

decreased CD11b-high dendritic cell number (IEA)

decreased CD8-positive, alpha-beta T cell number (IEA)

decreased circulating amylase level (IEA)

decreased circulating glucose level (IEA)

decreased circulating thyroxine level (IEA)

decreased effector memory T-helper cell number (IEA)

decreased erythrocyte cell number (IEA)

decreased follicular B cell number (IEA)

decreased grip strength (IEA)

decreased heart weight (IEA)

decreased hematocrit (IEA)

decreased hemoglobin content (IEA)

decreased immature B cell number (IEA)

decreased KLRG1-positive NK cell number (IEA)

decreased lean body mass (IEA)

decreased leukocyte cell number (IEA)

decreased Ly6C low monocyte number (IEA)

decreased mature B cell number (IEA)

decreased mean platelet volume (IEA)

decreased memory CD4-positive, CD25-positive, alpha-beta regulatory T cell number (IEA)

decreased memory-marker gamma-delta T cell number (IEA)

decreased NK cell number (IEA)

decreased red blood cell distribution width (IEA)

decreased total body fat amount (IEA)

decreased transitional stage T1 B cell number (IEA)

improved glucose tolerance (IEA)

increased alpha-beta T cell number (IEA)

increased blood urea nitrogen level (IEA)

increased CD4-positive, alpha-beta T cell number (IEA)

increased CD4-positive, CD25-positive, alpha-beta regulatory T cell number (IEA)

increased CD8-positive, alpha-beta T cell number (IEA)

increased CD8-positive, naive alpha-beta T cell number (IEA)

increased circulating calcium level (IEA)

increased circulating cholesterol level (IEA)

increased circulating creatinine level (IEA)

increased circulating fructosamine level (IEA)

increased circulating HDL cholesterol level (IEA)

increased circulating iron level (IEA)

increased circulating LDL cholesterol level (IEA)

increased circulating serum albumin level (IEA)

increased circulating sodium level (IEA)

increased circulating total protein level (IEA)

increased effector memory CD8-positive, alpha-beta T cell number (IEA)

increased fasting circulating glucose level (IEA)

increased lean body mass (IEA)

increased mean corpuscular hemoglobin (IEA)

increased mean corpuscular hemoglobin concentration (IEA)

increased neutrophil cell number (IEA)

increased plasmacytoid dendritic cell number (IEA)

increased T cell number (IEA)

increased T-helper cell number (IEA)

increased total body fat amount (IEA)

no abnormal phenotype detected (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
2.	Mouse MP Annotation Import Pipeline	RGD automated import pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10349636	PMID:11042159	PMID:11076861	PMID:11217851	PMID:12466851	PMID:12477932	PMID:14670962	PMID:15489334	PMID:16141072	PMID:16141073	PMID:20233719	PMID:21677750
PMID:21873635	PMID:22301785	PMID:23770197	PMID:23860501	PMID:26261005	PMID:27626380	PMID:30973865	PMID:31132747	PMID:31871440	PMID:32245826	PMID:33127391	PMID:38355793

Genomics

Comparative Map Data

Duoxa2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	2	122,129,381 - 122,133,088 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	2	122,129,381 - 122,133,366 (+)	Ensembl		GRCm39 Ensembl
GRCm38	2	122,298,900 - 122,302,885 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	2	122,298,900 - 122,302,885 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	2	122,124,636 - 122,128,621 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	2	121,990,341 - 121,994,326 (+)	NCBI		MGSCv36	mm8
Celera	2	123,449,032 - 123,452,872 (+)	NCBI		Celera
Cytogenetic Map	2	E5	NCBI
cM Map	2	60.62	NCBI

DUOXA2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	45,114,326 - 45,118,421 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	45,114,326 - 45,118,421 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	45,406,524 - 45,410,619 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	43,193,816 - 43,197,596 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	15	22,297,958 - 22,301,739 (+)	NCBI		Celera
Cytogenetic Map	15	q21.1	NCBI
HuRef	15	22,230,735 - 22,234,516 (+)	NCBI		HuRef
CHM1_1	15	45,524,856 - 45,528,637 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	15	42,922,347 - 42,926,442 (+)	NCBI		T2T-CHM13v2.0

Duoxa2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	3	129,698,938 - 129,702,656 (+)	NCBI		GRCr8
mRatBN7.2	3	109,245,337 - 109,249,055 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	3	109,245,476 - 109,248,968 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	3	112,919,191 - 112,922,563 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	3	121,514,712 - 121,518,084 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	3	119,175,086 - 119,178,458 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	3	114,236,718 - 114,240,086 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	3	114,236,718 - 114,240,086 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	3	120,776,164 - 120,779,532 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	3	109,077,891 - 109,081,259 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	3	108,143,293 - 108,146,662 (+)	NCBI		Celera
Cytogenetic Map	3	q35	NCBI

Duoxa2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955409	8,266,873 - 8,270,486 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955409	8,266,873 - 8,270,486 (-)	NCBI	ChiLan1.0	ChiLan1.0

DUOXA2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	34,354,178 - 34,358,614 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	38,532,344 - 38,536,773 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	24,061,922 - 24,066,016 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	42,415,195 - 42,418,979 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	42,415,195 - 42,418,974 (+)	Ensembl	panpan1.1		panPan2

DUOXA2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	11,541,849 - 11,546,019 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	30	11,542,078 - 11,545,811 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	11,597,991 - 11,602,183 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	11,678,623 - 11,690,210 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	11,678,874 - 11,682,607 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	11,584,860 - 11,589,033 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	11,707,421 - 11,711,539 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	11,826,699 - 11,831,334 (+)	NCBI		UU_Cfam_GSD_1.0

Duoxa2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	89,984,217 - 89,987,570 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	7,832,234 - 7,835,476 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936471	7,832,234 - 7,835,488 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

DUOXA2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	126,613,201 - 126,623,388 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	126,616,631 - 126,620,359 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	141,198,367 - 141,205,268 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

DUOXA2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	38,084,943 - 38,089,701 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	26	38,086,092 - 38,089,420 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666048	102,969,087 - 102,972,867 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Duoxa2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624731	14,118,426 - 14,121,928 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624731	14,118,526 - 14,121,811 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Duoxa2
124 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	136
Count of miRNA genes:	123
Interacting mature miRNAs:	134
Transcripts:	ENSMUST00000028656
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1302033	Nsv1_m	Neuroadapted Sindbis viral RNA level 1 (mouse)			Not determined		2	111623386	145623526	Mouse
1301905	Lgth2_m	body length 2 (mouse)			Not determined		2	111173704	145173821	Mouse
12904007	Cfq7_m	conditioned fear QTL 7 (mouse)					2	118356772	125048872	Mouse
13506762	Tbvq2_m	trabecular bone volume QTL 2 (mouse)					2	115430481	124741920	Mouse
13824983	Vclq1_m	curvilinear velocity QTL 1 (mouse)					2	61830344	136841920	Mouse
1301909	Smdq2_m	segregation of mitochondrial DNA QTL 2 (mouse)			Not determined		2	92778465	126778607	Mouse
11039520	Ltpr2h_m	Leishmania tropica response 2h (mouse)					2	112212746	146213005	Mouse
11039521	Ltpr2g_m	Leishmania tropica response 2g (mouse)					2	115212857	149212994	Mouse
12910799	Pwgrq2_m	pre-weaning growth rate QTL 2 (mouse)					2	118589253	160611165	Mouse
1302174	Dssc2_m	dextran sodium sulfate induced colitis QTL2 (mouse)			Not determined		2	24224632	148700377	Mouse
12910795	Pwbwq5_m	post-weaning body weight QTL 5 (mouse)					2	118589253	160611165	Mouse
27226761	Feml18_m	femur length 18, 16 week (mouse)					2	94230345	154241920	Mouse
12910812	Pwgrq1_m	pre-weaning growth rate QTL 1 (mouse)					2	118589253	160611165	Mouse
12910814	Pwbwq1_m	pre-weaning body weight QTL 1 (mouse)					2	118589253	160611165	Mouse
4141854	T2dm2sa_m	type 2 diabetes mellitus 2 in SMXA RI mice (mouse)			Not determined		2	29307947	148374934	Mouse
12904935	Edlmmq2_m	extensor digitorum longus muscle mass QTL 2 (mouse)					2	97210364	131210364	Mouse
1302071	Fembrs1_m	femur breaking strength 1 (mouse)			Not determined		2	100942930	134943090	Mouse
10045885	Cplaq15_m	circadian period of locomotor activity 15 (mouse)			Not determined		2	110916118	154354667	Mouse
1302203	Gvhd3_m	graft-versus host disease 3 (mouse)			Not determined		2	100942930	134943090	Mouse
1300793	Pcfm2_m	periosteal circumference and femur length 2 (mouse)			Not determined		2	111173704	145173821	Mouse
10412082	Hylaq1_m	Hyperlocomotor activity related QTL 1 (mouse)			Not determined		2	84013198	148667470	Mouse
1300798	Actre3_m	activity response to ethanol 3 (mouse)			Not determined		2	112024987	128173821	Mouse
5491197	Mobq5_m	multigenic obesity QTL 5 (mouse)			Not determined		2	65269746	162518926	Mouse
5491196	Mobq6_m	multigenic obesity QTL 6 (mouse)			Not determined		2	85724269	180896594	Mouse
4142223	Femwf4_m	femur work to failure 4 (mouse)			Not determined			88143423	122143570	Mouse
1301415	Actre4_m	activity response to ethanol 4 (mouse)			Not determined		2	112024987	128173821	Mouse
1301029	T2dm3_m	type 2 diabetes mellitus 3 (mouse)			Not determined		2	114288075	132714157	Mouse
27226788	Feml13_m	femur length 13, 10 week (mouse)					2	102630345	159941920	Mouse
1301295	Prdt1_m	prion disease incubation time 1 (mouse)			Not determined		2	116077623	150077741	Mouse
1558825	Aabpr_m	aberrant activation of B cell proliferation (mouse)			Not determined		2	116033229	122207534	Mouse
12904954	Gmmq2_m	gastrocnemius muscle mass QTL 2 (mouse)					2	97210364	131210364	Mouse
11038696	Ltpr2f_m	Leishmania tropica response 2f (mouse)					2	115212857	149212994	Mouse
1301330	Tbbmd2_m	total body bone mineral density 2 (mouse)			Not determined		2	100942930	134943090	Mouse
1301201	Chab1_m	cholesterol absorption 1 (mouse)			Not determined		2	111551028	145551163	Mouse
11038699	Ltpr2b_m	Leishmania tropica response 2b (mouse)					2	112212746	146213005	Mouse
11038700	Ltpr2a_m	Leishmania tropica response 2a (mouse)					2	112212746	146213005	Mouse
11038702	Ltpr2_m	Leishmania tropica response 2 (mouse)					2	103095716	167212356	Mouse
11049568	Lmr28c_m	leishmaniasis resistance 28c (mouse)					2	97123370	131123532	Mouse
11049569	Lmr28d_m	leishmaniasis resistance 28d (mouse)					2	97123370	131123532	Mouse
11528549	Sluc31_m	susceptibility to lung cancer 31 (mouse)					2	74524117	129213005	Mouse
1301087	Bbaa15_m	B.burgdorferi-associated arthritis 15 (mouse)			Not determined		2	110489658	144489807	Mouse
1301825	Pbrgcsf1_m	peripheral blood stem cell response to granulocyte colony stimulating factor 1 (mouse)			Not determined		2	106233580	140233729	Mouse
4141802	Ignpq1_m	IgA nephropathy QTL 1 (mouse)			Not determined		2	100824060	134824269	Mouse
1558990	Skmw9_m	skeletal muscle weight 9 (mouse)			Not determined		2	111173704	145173821	Mouse
11041906	Lmr28a_m	leishmaniasis resistance 28a (mouse)					2	103095716	129213005	Mouse
4141155	Plast2b_m	plasma plant sterol 2b (mouse)			Not determined		2	84013198	148522175	Mouse
1301618	Bglu1_m	blood glucose level 1 (mouse)			Not determined		2	117942930	174324863	Mouse
1301755	Hrq1_m	heart rate quantitative locus 1 (mouse)			Not determined		2	111173704	145173821	Mouse
1301344	Lith1_m	lithogenic gene 1 (mouse)			Not determined		2	45347635	145312647	Mouse
1558881	Ses7_m	salmonella enteritidis susceptibility 7 (mouse)			Not determined		2	116306330	150306474	Mouse
1301098	Cd8mts3_m	CD8 memory T cell subset 3 (mouse)			Not determined		2	91089974	125090104	Mouse
10043875	Bw25_m	body weight QTL 25 (mouse)			Not determined		2	107255676	141255676	Mouse

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_025777	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AK008816	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK018569	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AL844566	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC031111	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466519	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000028656 ⟹ ENSMUSP00000028656

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	2	122,129,381 - 122,133,366 (+)	Ensembl
GRCm38.p6 Ensembl	2	122,298,900 - 122,302,885 (+)	Ensembl

RefSeq Acc Id:

NM_025777 ⟹ NP_080053

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	2	122,129,381 - 122,133,088 (+)	NCBI
GRCm38	2	122,298,900 - 122,302,885 (+)	ENTREZGENE
MGSCv37	2	122,124,636 - 122,128,621 (+)	RGD
Celera	2	123,449,032 - 123,452,872 (+)	RGD
cM Map	2		ENTREZGENE

Sequence:

show sequence

GAACACTGCGTGAAGTCGCAGGGCCAGGAAAGAGTTTCGGGAGATCACGCCTCTGCGCTTCTTA
GGAGAGCCGCAGGGCTCGGACTTTTTATCACTCATCCCAGCTCGCTGCCTGCGAACAGTTCTCG
AACTTCTTGCAGGATGACTGCGTGGGACGGGGTGCTACCCTTTTACCCCCAGCCCAGGCATGCC
GCCAGCTTCAGCGTACCGCTGCTCATTGTTATCCTGGTGTTCTTGTCTTTGGCTGCTAGCTTCC
TGTTCATCTTGCCTGGAATCCGTGGGCACTCGCGCTGGTTCTGGTTGGTGAGAGTCCTTCTTAG
CCTGTTCATAGGTGCCGAAATTGTGGCTGTGCACTTCAGTGGAGACTGGTTCGTGGGGAGAGTG
TGGACCAACACATCCTACAAAGCCTTCAGTCCATCCCGTGTTCAAGTCCATGTCGGTCTGCACG
TGGGGCTGGCGGGCGTTAACATTACACTCCGAGGAACACCGAGGCAGCAGCTGAACGAGACCAT
TGACTACAATGAGCGTTTCACTTGGCGTCTGAACGAAGACTACACCAAGGAGTATGTCCATGCC
TTGGAGAAGGGACTGCCGGACCCAGTGCTATACCTGGCAGAGAAGTTCACACCGAGCAGTCCTT
GCGGGCTGTACCACCAATATCACCTGGCCGGTCACTATGCCGCAGCAACACTGTGGGTGGCATT
CTGCTTCTGGATCATCGCCAATGCGCTGCTCTCCATGCCCGCCCCACTCTACGGAGGCCTGGCT
TTGCTCACCACCGGTGCCTTCACGCTCTTCGGTGTCTTCGCCTTCGCCTCGATTTCCAGCGTGC
CGCTCTGCCACTTCCGCCTGGGCTCCGCCGTCCTCACGCCTTACTACGGCGCCTCCTTTTGGCT
CACGCTGGCCACCGGCATCCTGAGCCTCCTCCTCGGAGGGGCGGTGGTGATTCTCCACTATACT
CGGCCCAGCGCCCTTCGCTCCTTTCTGGATCTAAGTGTCAAAGACTGTAGCAACCAGGCTAAAG
GAAACTCACCTCTCACCCTCAACAACCCGCAACACGAACAGTTGAAGAGTCCAGACTTAAATAT
TACCACTCTCCTGTGAAAATAACTGACTCCGGATTTCTACCCCTCTTTGGGACCCCATAGACCT
GAAGACTGTGTTAAGAGCGCGTGCCAGGAGCATAGCTTAGTCTGGAGAACTGCTTGTCCCTGCG
GGACGACAAGGGGGCACCCCATGTGCCTTTGCTCTAGAGAATGGATTTCTCAGGAGAACTGTAA
ATAAACTTTTTTGTTTCTTTTTTTTTCTTCAAAATTCCCATGCCCATCAATTTCCTTGGCTTCT
CTTGGCCATTTGGAGCTACAACCTTGAGAAACTCCTCTAGGCTAGTAAGAGCCTAGTACTGTAT
GTACATTCAGGTGCTGAGAAGCCTGAGAAACACAGTAGGGCTCTGGGGGAGGTGCGCCCTCTAG
TGAGATCTGAGAGGAACTGGCAGGCATCTCCTCCAACGGGTGGTGGGTTACGTTCTACCCAAAT
CTCTACTAGCCACACTGAATGTATTGGGGAAGATTAGGATTTTGGCGTTCATTCGC

hide sequence

Protein Sequences


Protein RefSeqs	NP_080053	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAH31111	(Get FASTA)	NCBI Sequence Viewer
	BAB25910	(Get FASTA)	NCBI Sequence Viewer
	BAB31281	(Get FASTA)	NCBI Sequence Viewer
	EDL28095	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000028656
	ENSMUSP00000028656.2
GenBank Protein	Q9D311	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_080053 ⟸ NM_025777

- UniProtKB:

A2AQ98 (UniProtKB/Swiss-Prot), Q9D7U8 (UniProtKB/Swiss-Prot), Q9D311 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MTAWDGVLPFYPQPRHAASFSVPLLIVILVFLSLAASFLFILPGIRGHSRWFWLVRVLLSLFIG
AEIVAVHFSGDWFVGRVWTNTSYKAFSPSRVQVHVGLHVGLAGVNITLRGTPRQQLNETIDYNE
RFTWRLNEDYTKEYVHALEKGLPDPVLYLAEKFTPSSPCGLYHQYHLAGHYAAATLWVAFCFWI
IANALLSMPAPLYGGLALLTTGAFTLFGVFAFASISSVPLCHFRLGSAVLTPYYGASFWLTLAT
GILSLLLGGAVVILHYTRPSALRSFLDLSVKDCSNQAKGNSPLTLNNPQHEQLKSPDLNITTLL

hide sequence

Ensembl Acc Id:

ENSMUSP00000028656 ⟸ ENSMUST00000028656

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9D311-F1-model_v2	AlphaFold	Q9D311	1-320	view protein structure

Promoters

RGD ID:

6878514

Promoter ID:

EPDNEW_M2708

Type:

single initiation site

Name:

Duoxa2_1

Description:

Mus musculus dual oxidase maturation factor 2 , mRNA.

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38	2	122,298,900 - 122,298,960	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:1914061	AgrOrtholog
Ensembl Genes	ENSMUSG00000027225	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000028656	ENTREZGENE
	ENSMUST00000028656.2	UniProtKB/Swiss-Prot
InterPro	Dual_oxidase_maturation_fac	UniProtKB/Swiss-Prot
KEGG Report	mmu:66811	UniProtKB/Swiss-Prot
MGD	MGI:1914061	ENTREZGENE
NCBI Gene	66811	ENTREZGENE
PANTHER	DUAL OXIDASE MATURATION FACTOR 2	UniProtKB/Swiss-Prot
	PTHR31158	UniProtKB/Swiss-Prot
Pfam	DuoxA	UniProtKB/Swiss-Prot
PhenoGen	Duoxa2	PhenoGen
UniProt	A2AQ98	ENTREZGENE
	DOXA2_MOUSE	UniProtKB/Swiss-Prot, ENTREZGENE
	Q9D7U8	ENTREZGENE
UniProt Secondary	A2AQ98	UniProtKB/Swiss-Prot
	Q9D7U8	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Mammalian Phenotype

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Mammalian Phenotype