Advanced Search (OLGA)

Gene: Vmn1r54 (vomeronasal 1 receptor 54) Mus musculus

Analyze

No known orthologs.

Symbol:

Vmn1r54

Name:

vomeronasal 1 receptor 54

RGD ID:

1618222

MGI Page

MGI

Description:

Predicted to enable signaling receptor activity. Predicted to be involved in G protein-coupled receptor signaling pathway and response to pheromone. Predicted to act upstream of or within sensory perception of chemical stimulus. Predicted to be located in plasma membrane. Orthologous to human VN1R17P (vomeronasal 1 receptor 17 pseudogene).

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

pheromone receptor VN7; V; V1; V1ra9; VN7; vomernasal 1 receptor Vmn1r54; vomeronasal 1 receptor, A9; vomeronasal receptor 7; vomeronasal type 1 receptor A9; vomeronasal type-1 receptor 54; vomeronasal type-1 receptor A9

RGD Orthologs

Alliance Orthologs

More Info

homologs ...

Latest Assembly:

GRCm39 - Mouse Genome Assembly GRCm39

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	6	90,246,088 - 90,247,035 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	6	90,223,282 - 90,248,195 (+)	Ensembl		GRCm39 Ensembl
GRCm38	6	90,269,106 - 90,270,053 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	6	90,246,300 - 90,271,213 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	6	90,219,100 - 90,220,047 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	6	90,234,610 - 90,235,557 (+)	NCBI		MGSCv36	mm8
Celera	6	92,162,757 - 92,163,704 (+)	NCBI		Celera
Cytogenetic Map	6	D1	NCBI
cM Map	6	40.1	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (EXP)

dichloroacetic acid (EXP)

tetrachloroethene (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

G protein-coupled receptor signaling pathway (IEA)

response to pheromone (IEA)

sensory perception of chemical stimulus (TAS)

Cellular Component

plasma membrane (IEA)

Molecular Function

pheromone receptor activity (IEA)

signaling receptor activity (ISS)

References

Additional References at PubMed

PMID:11116090	PMID:11752409	PMID:12214233	PMID:12466851	PMID:19952141	PMID:20003482	PMID:21873635

Genomics

Variants

Variants in Vmn1r54
49 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	98
Count of miRNA genes:	95
Interacting mature miRNAs:	98
Transcripts:	ENSMUST00000058039
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCm39)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4142271	Egq8_m	early growth QTL 8 (mouse)			Not determined			4503823	96633110	Mouse
10043864	T2dm4sa_m	type 2 diabetes mellitus 4 in SMXA RI mice (mouse)			Not determined		6	83690851	146954059	Mouse
1301521	Pas1c_m	pulmonary adenoma susceptibility 1c (mouse)			Not determined		6	71958006	105958152	Mouse
10412119	Stv_m	striatal volumne (mouse)			Not determined		6	60026991	100026967	Mouse
1300954	Fcsa1_m	femoral cross-sectional area 1 (mouse)			Not determined		6	71958006	105958152	Mouse
13824985	Alh1_m	amplitude of lateral head displacement 1 (mouse)					6	77976983	96976961	Mouse
4142259	Tabw2_m	tally ho associated body weight 2 (mouse)			Not determined			46912919	136400690	Mouse
25314319	Histh6_m	histamine hypersensitivity 6 (mouse)					6	48696934	125336963	Mouse
12792979	Fbmd2_m	femoral bone mineral density 2, females only (mouse)					6	75026989	115026943	Mouse
1301571	Arrd1_m	age-related retinal degeneration 1 (mouse)			Not determined		6	75521339	92584431	Mouse
4142126	W3q3_m	weight 3 weeks QTL 3 (mouse)			Not determined			4503823	96633110	Mouse
1300674	Nidd3n_m	non-insulin-dependent diabetes mellitus 3 in NSY (mouse)			Not determined		6	75521339	94202936	Mouse
25314320	Histh5_m	histamine hypersensitivity 5 (mouse)					6	48696934	148351498	Mouse
1558977	Skmw10_m	skeletal muscle weight 10 (mouse)			Not determined		6	58424566	92424693	Mouse
1300869	Stheal5_m	soft tissue heal 5 (mouse)			Not determined		6	71552042	105552160	Mouse
1302020	Bbaa20_m	B.burgdorferi-associated arthritis 20 (mouse)			Not determined		6	71299605	93441074	Mouse
1301962	Eila2_m	ethanol induced locomotor activity 2 (mouse)			Not determined		6	48703490	125333748	Mouse
1301320	Ots1_m	ovarian teratoma susceptibility 1 (mouse)			Not determined		6	75424566	104480516	Mouse
10043972	Obq28_m	obesity QTL 28 (mouse)			Not determined		6	58517416	92517416	Mouse
1301262	Gasa3_m	gastritis type A susceptibility locus 3 (mouse)			Not determined		6	88982366	122982564	Mouse
1558984	Cplaq9_m	circadian period of locomotor activity 9 (mouse)			Not determined		6	38646560	92584431	Mouse
10412157	Fl1n_m	fatty liver 1 in NSY (mouse)			Not determined		6	45290993	128811995	Mouse
11251720	Ewc4_m	ethanol withdrawal and consumption 4 (mouse)					6	84099474	118099474	Mouse
1301744	Hdlq11_m	HDL QTL 11 (mouse)			Not determined		6	87480321	121480516	Mouse
25440480	Moaq2_m	modifier of alien QTL 2 (mouse)					6	3050001	117476961	Mouse
26884414	Bzwq12_m	bi-zygomatic width QTL 12, 16 week (mouse)					6	3400000	139076998	Mouse
10043901	Pfat5_m	predicted fat percentage 5 (mouse)			Not determined		6	75584287	109584431	Mouse
1301687	Mnic2_m	macronutrient intake (mouse)			Not determined		6	86783787	113521563	Mouse
4142361	W10q11_m	weight 10 weeks QTL 11 (mouse)			Not determined			4503823	96633110	Mouse
1301813	Skl3_m	skeletal size (tail length) 3 (mouse)			Not determined		6	70402880	104403016	Mouse
4142232	W6q4_m	weight 6 weeks QTL 4 (mouse)			Not determined			4503823	96633110	Mouse
1357683	Igf1sl1_m	IGF-1 serum levels 1 (mouse)			Not determined		6	52138693	116132228	Mouse
1301876	Bits2_m	bitterness sensitivity 2 (mouse)			Not determined		6	70402880	104403016	Mouse
1357875	Pfat2_m	predicted fat percentage 2 (mouse)			Not determined		6	76440930	110441074	Mouse
15039373	Adip28_m	adiposity 28 (mouse)					6	56285194	90285194	Mouse
15039375	Bw41_m	body weight QTL 41 (mouse)					6	56285194	90285194	Mouse
1301369	Im4_m	immunoregulatory 4 (mouse)			Not determined		6	63461721	97461888	Mouse
10412208	Cypr4_m	cytokine production 4 (mouse)			Not determined		6	75693484	109693678	Mouse
1300650	Bw18_m	body weight QTL 18 (mouse)			Not determined		6	66690851	100691013	Mouse
1301034	Egrm2_m	early growth rate (mouse)			Not determined		6	70402880	104403016	Mouse
14696731	Pairq1_m	P. aeruginosa infection resistance QTL 1 (mouse)					6	81476981	102176961	Mouse
13506930	Recrq9_m	recombination rate in male meiosis QTL 9 (mouse)					6	73476983	134676963	Mouse
10412195	Efw_m	epididymal fat weight (mouse)			Not determined		6	75521339	94202936	Mouse
1301740	Bwq2_m	body weight QTL 2 (mouse)			Not determined		6	60034663	94034782	Mouse
4141376	Dbm1_m	diabetes modifier 1 (mouse)			Not determined		6	78606487	121092347	Mouse

Markers in Region

UniSTS:493167

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	6	90,269,106 - 90,270,053	UniSTS	GRCm38
MGSCv37	6	90,219,100 - 90,220,047	UniSTS	GRCm37
Celera	6	92,162,757 - 92,163,704	UniSTS
Cytogenetic Map	6	D1	UniSTS

UniSTS:495549

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	6	90,269,076 - 90,270,081	UniSTS	GRCm38
MGSCv37	6	90,219,070 - 90,220,075	UniSTS	GRCm37
Celera	6	92,162,727 - 92,163,732	UniSTS
Cytogenetic Map	6	D1	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_053224	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC165969	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF129005	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF291488	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466523	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782630	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782631	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782632	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782633	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782634	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782635	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782636	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782637	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782638	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782639	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782640	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782641	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782642	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782643	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782644	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782645	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782646	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782647	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782648	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782649	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782650	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782651	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782652	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782653	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782654	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782655	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782656	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JF782657	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSMUST00000058039 ⟹ ENSMUSP00000063052

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	6	90,246,088 - 90,247,035 (+)	Ensembl
GRCm38.p6 Ensembl	6	90,269,106 - 90,270,053 (+)	Ensembl

Ensembl Acc Id:

ENSMUST00000226921 ⟹ ENSMUSP00000154354

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39 Ensembl	6	90,223,282 - 90,248,195 (+)	Ensembl
GRCm38.p6 Ensembl	6	90,246,300 - 90,271,213 (+)	Ensembl

RefSeq Acc Id:

NM_053224 ⟹ NP_444454

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	6	90,246,088 - 90,247,035 (+)	NCBI
GRCm38	6	90,269,106 - 90,270,053 (+)	ENTREZGENE
MGSCv37	6	90,219,100 - 90,220,047 (+)	RGD
Celera	6	92,162,757 - 92,163,704 (+)	RGD
cM Map	6		ENTREZGENE

Sequence:

show sequence

ATGAATAAAATGAATAGACTGTCCCATAACACCGAGATAAGAAATGCTATTTATTCTGGAGTTG
GCATTGGGATCTCAGGCAACAGCTTCCTTCTTCTCTTCCACATCTTCAAGTACATTCGTGGGCA
GAGGTCCAGACATATTGACCTGCCCATTGGTCTCTTGTCCCTAATCCACCTGGTGATGCTGATA
GCCATGAGTTTAGTAGCTACAGACATCTTTATGCCATGGGGGAGATGGGGTGACACCACATGCA
AATGTGTTATATCCTTGTACAGGTTTTGTAGGAGTCTCTCTCTTTGTGCCACCAGCCTGCTCAG
CATCCTCCAGGCTGTCACTCTCAATCCCAGAAACTCCTGCTTAGAAAAGTTCAAGCGTAAATCT
CCACACTACATGCTAGGTTGTCTTCTTTTCCTGAGTGTCTTCTATACATTCATTAGCAGTCCCC
TTGCAACATATATAACTGCAAAGTCTAATTTGACCTCACCTAGCTTTACATATATCACTACATC
GTGCTCTCTGGCACCCATGAGTTACTCTTTCCATCTCACAGTTTTTATACTGTTGACCTCCAGG
GATGTCATCTTTGTAGGTCTCATGCTCCTCTCCAGTGGATACATGGTGACTTTCCTAGGCAGAC
ATAAAAAGCAATCCCAATTTCTCCATATCACCAGCTTTTCCCTCAAACCATCTGCAGAAAAAAG
AGCCATGAGGACCATTCTGTGCCTCATGAGCTTCTTTGTGCTGATGTACACCTTGGACAGCATT
GTCTCCTACATAAGAAGTATCGATGATGGTCAGATTTTTTATTGTGTCCACATTTTCACAGCCC
ATGGCTATGCCACAGTCAGTCCTTTTTTGATCCTCAGTACTGAAAAATATATCATCAACATTTT
CAGATCCACATTTGGAAGGATGGTAACCATCATATTGCTCAGGAATAGGTAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_444454	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAG42082	(Get FASTA)	NCBI Sequence Viewer
	AAG43252	(Get FASTA)	NCBI Sequence Viewer
	AEE99789	(Get FASTA)	NCBI Sequence Viewer
	AEE99790	(Get FASTA)	NCBI Sequence Viewer
	AEE99791	(Get FASTA)	NCBI Sequence Viewer
	AEE99792	(Get FASTA)	NCBI Sequence Viewer
	AEE99793	(Get FASTA)	NCBI Sequence Viewer
	AEE99794	(Get FASTA)	NCBI Sequence Viewer
	AEE99795	(Get FASTA)	NCBI Sequence Viewer
	AEE99796	(Get FASTA)	NCBI Sequence Viewer
	AEE99797	(Get FASTA)	NCBI Sequence Viewer
	AEE99798	(Get FASTA)	NCBI Sequence Viewer
	AEE99799	(Get FASTA)	NCBI Sequence Viewer
	AEE99800	(Get FASTA)	NCBI Sequence Viewer
	AEE99801	(Get FASTA)	NCBI Sequence Viewer
	AEE99802	(Get FASTA)	NCBI Sequence Viewer
	AEE99803	(Get FASTA)	NCBI Sequence Viewer
	AEE99804	(Get FASTA)	NCBI Sequence Viewer
	AEE99805	(Get FASTA)	NCBI Sequence Viewer
	AEE99806	(Get FASTA)	NCBI Sequence Viewer
	AEE99807	(Get FASTA)	NCBI Sequence Viewer
	AEE99808	(Get FASTA)	NCBI Sequence Viewer
	AEE99809	(Get FASTA)	NCBI Sequence Viewer
	AEE99810	(Get FASTA)	NCBI Sequence Viewer
	AEE99811	(Get FASTA)	NCBI Sequence Viewer
	AEE99812	(Get FASTA)	NCBI Sequence Viewer
	AEE99813	(Get FASTA)	NCBI Sequence Viewer
	EDK99280	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSMUSP00000063052
	ENSMUSP00000063052.3
	ENSMUSP00000154354.2
GenBank Protein	Q9EPB8	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:

NP_444454 ⟸ NM_053224

- UniProtKB:

Q9EPB8 (UniProtKB/Swiss-Prot), F6MA41 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MNKMNRLSHNTEIRNAIYSGVGIGISGNSFLLLFHIFKYIRGQRSRHIDLPIGLLSLIHLVMLI
AMSLVATDIFMPWGRWGDTTCKCVISLYRFCRSLSLCATSLLSILQAVTLNPRNSCLEKFKRKS
PHYMLGCLLFLSVFYTFISSPLATYITAKSNLTSPSFTYITTSCSLAPMSYSFHLTVFILLTSR
DVIFVGLMLLSSGYMVTFLGRHKKQSQFLHITSFSLKPSAEKRAMRTILCLMSFFVLMYTLDSI
VSYIRSIDDGQIFYCVHIFTAHGYATVSPFLILSTEKYIINIFRSTFGRMVTIILLRNR

hide sequence

Ensembl Acc Id:

ENSMUSP00000154354 ⟸ ENSMUST00000226921

Ensembl Acc Id:

ENSMUSP00000063052 ⟸ ENSMUST00000058039

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q9EPB8-F1-model_v2	AlphaFold	Q9EPB8	1-315	view protein structure

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:2148514	AgrOrtholog
Ensembl Genes	ENSMUSG00000047203	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000058039	ENTREZGENE
	ENSMUST00000058039.3	UniProtKB/Swiss-Prot
	ENSMUST00000226921.2	UniProtKB/Swiss-Prot
Gene3D-CATH	Rhodopsin 7-helix transmembrane proteins	UniProtKB/Swiss-Prot
InterPro	GPCR_Rhodpsn_7TM	UniProtKB/Swiss-Prot
	Vmron_rcpt_1	UniProtKB/Swiss-Prot
KEGG Report	mmu:113851	UniProtKB/Swiss-Prot
MGD	MGI:2148514	ENTREZGENE
NCBI Gene	113851	ENTREZGENE
PANTHER	PTHR24062	UniProtKB/Swiss-Prot
Pfam	V1R	UniProtKB/Swiss-Prot
PhenoGen	Vmn1r54	PhenoGen
PRINTS	VOMERONASL1R	UniProtKB/Swiss-Prot
PROSITE	G_PROTEIN_RECEP_F1_2	UniProtKB/Swiss-Prot
Superfamily-SCOP	Family A G protein-coupled receptor-like	UniProtKB/Swiss-Prot
UniProt	F6MA41	ENTREZGENE
	Q9EPB8	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-07-27	Vmn1r54	vomeronasal 1 receptor 54	V1ra9	vomeronasal 1 receptor, A9	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message