Ucn2 (urocortin 2) - Rat Genome Database

Name: Ucn2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| FTP Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References FTP Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer ACP Haplotyper Genome Scanner Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Ucn2 (urocortin 2) Mus musculus

Analyze

Symbol:

Ucn2

Name:

urocortin 2

RGD ID:

1614218

MGI Page

MGI

Description:

Exhibits G protein-coupled receptor binding activity. Predicted to be involved in several processes, including adenylate cyclase-activating G protein-coupled receptor signaling pathway; hormone-mediated signaling pathway; and negative regulation of gonadotropin secretion. Predicted to localize to extracellular space. Human ortholog(s) of this gene implicated in hypertension. Orthologous to human UCN2 (urocortin 2).

Type:

protein-coding

RefSeq Status:

REVIEWED

Also known as:

Ucn II; Ucn-; Ucn-2; ucn-II; Urocortin II; urocortin-2

RGD Orthologs

Human

Rat

Chinchilla

Bonobo

Dog

Squirrel

Pig

Green Monkey

Naked Mole-Rat

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	UCN2 (urocortin 2)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Ucn2 (urocortin 2)	HGNC	Treefam, EggNOG, OrthoMCL, NCBI, OMA, HomoloGene, Inparanoid, Panther, OrthoDB, Ensembl
Chinchilla lanigera (long-tailed chinchilla):	Ucn2 (urocortin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	UCN2 (urocortin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	UCN2 (urocortin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ucn2 (urocortin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	UCN2 (urocortin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (African green monkey):	UCN2 (urocortin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Ucn2 (urocortin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Rattus norvegicus (Norway rat):	Ucn2 (urocortin 2)	Alliance	DIOPT (Hieranoid\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|TreeFam)
Homo sapiens (human):	UCN2 (urocortin 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|Roundup\|TreeFam)
Danio rerio (zebrafish):	ucn3l (urocortin 3, like)	Alliance	DIOPT (Ensembl Compara\|PANTHER\|TreeFam)

Latest Assembly:

GRCm38 - Mouse Genome Assembly GRCm38

Position:

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	108,815,231 - 108,816,232 (+)	NCBI	GRCm39		mm39
GRCm38	9	108,986,163 - 108,987,164 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	108,986,010 - 108,987,164 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	108,888,208 - 108,889,209 (+)	NCBI	GRCm37		mm9	NCBIm37
Celera	9	108,544,152 - 108,545,153 (+)	NCBI		Celera
Cytogenetic Map	9	F2	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Anorexia (ISO)

atherosclerosis (ISO)

colitis (ISO)

congestive heart failure (ISO)

hypertension (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (EXP)

17beta-estradiol (ISO)

ammonium chloride (ISO)

bisphenol A (ISO)

cadmium dichloride (ISO)

corticotropin (EXP)

cortisol (EXP)

furan (ISO)

graphite (ISO)

methylmercury chloride (ISO)

paracetamol (ISO)

pirinixic acid (EXP)

propanal (ISO)

rotenone (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adenylate cyclase-activating G protein-coupled receptor signaling pathway (IBA,ISO)

cell population proliferation (ISO)

cellular response to glucocorticoid stimulus (ISO)

cellular response to hypoxia (ISO)

cellular response to nutrient levels (IBA)

digestion (IEA)

hormone-mediated signaling pathway (IBA,ISO,ISS)

negative regulation of follicle-stimulating hormone secretion (ISO)

negative regulation of gene expression (ISO)

negative regulation of luteinizing hormone secretion (ISO)

response to immobilization stress (ISO)

Cellular Component

extracellular region (IEA)

extracellular space (IBA,ISO)

Molecular Function

corticotropin-releasing hormone receptor 2 binding (ISO)

corticotropin-releasing hormone receptor binding (IBA,ISO,ISS)

G protein-coupled receptor binding (IDA)

hormone activity (IEA)

hormone binding (ISO)

protein binding (IPI)

Molecular Pathway Annotations Click to see Annotation Detail View

corticotropin-releasing hormone signaling pathway (ISO)

Phenotype Annotations Click to see Annotation Detail View

Mammalian Phenotype

abnormal drinking behavior (IAGP)

abnormal locomotor activation (IAGP)

decreased food intake (IAGP)

increased circulating adrenocorticotropin level (IAGP)

increased circulating corticosterone level (IAGP)

References

References - curated


1.	Chang J, etal., Peptides. 2007 Jul;28(7):1453-60. Epub 2007 May 21.
2.	Dieterle T, etal., Hypertension. 2009 Apr;53(4):739-44. Epub 2009 Feb 9.
3.	Douglas SA, etal., Lancet. 2002 Jun 8;359(9322):1990-7.
4.	Hassan GS, etal., Peptides. 2005 Dec;26(12):2464-72. Epub 2005 Jul 18.
5.	Hillhouse EW and Grammatopoulos DK, Endocr Rev. 2006 May;27(3):260-86. Epub 2006 Feb 16.
6.	RGD automated import pipeline
7.	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
8.	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:10349636	PMID:11042159	PMID:11076861	PMID:11217851	PMID:11226328	PMID:11329063	PMID:11416224	PMID:12466851	PMID:12764078	PMID:12970163	PMID:14736736	PMID:15514029
PMID:16054139	PMID:16141072	PMID:16141073	PMID:16424218	PMID:16707802	PMID:17050686	PMID:17194724	PMID:18308934	PMID:19318426	PMID:19914944	PMID:19919977	PMID:20610744
PMID:20937857	PMID:21627635	PMID:21873635	PMID:22138165	PMID:22192627	PMID:22640813	PMID:23320836	PMID:23493376	PMID:24043794	PMID:24083959	PMID:25358399	PMID:25426872
PMID:26648475	PMID:27699250	PMID:28665499	PMID:28851616

Genomics

Comparative Map Data

Ucn2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	108,815,231 - 108,816,232 (+)	NCBI	GRCm39		mm39
GRCm38	9	108,986,163 - 108,987,164 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	108,986,010 - 108,987,164 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	108,888,208 - 108,889,209 (+)	NCBI	GRCm37		mm9	NCBIm37
Celera	9	108,544,152 - 108,545,153 (+)	NCBI		Celera
Cytogenetic Map	9	F2	NCBI

UCN2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38.p13 Ensembl	3	48,561,718 - 48,563,781 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh38	3	48,561,718 - 48,563,781 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh37	3	48,599,151 - 48,601,201 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	3	48,574,155 - 48,576,205 (-)	NCBI	NCBI36		hg18	NCBI36
Build 34	3	48,574,171 - 48,576,205	NCBI
Celera	3	48,554,893 - 48,556,936 (-)	NCBI
Cytogenetic Map	3	p21.31	NCBI
HuRef	3	48,657,480 - 48,659,523 (-)	NCBI		HuRef
CHM1_1	3	48,551,458 - 48,553,508 (-)	NCBI		CHM1_1

Ucn2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Rnor_6.0	8	117,727,216 - 117,728,765 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	117,727,877 - 117,728,764 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	117,078,961 - 117,080,510 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	8	114,003,817 - 114,005,366 (+)	NCBI	RGSC3.4		rn4	RGSC3.4
RGSC_v3.1	8	114,023,950 - 114,024,334 (+)	NCBI
Celera	8	108,931,358 - 108,932,907 (+)	NCBI		Celera
Cytogenetic Map	8	q32	NCBI

Ucn2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955532	648,845 - 650,020 (-)	NCBI	ChiLan1.0	ChiLan1.0

UCN2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
PanPan1.1	3	49,566,535 - 49,566,873 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
Mhudiblu_PPA_v0	3	48,484,628 - 48,485,179 (-)	NCBI	Mhudiblu_PPA_v0		panPan3

UCN2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	40,551,060 - 40,552,920 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1

Ucn2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
SpeTri2.0	NW_004936529	347,411 - 348,040 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

UCN2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	13	31,261,196 - 31,261,534 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	13	31,261,196 - 31,261,824 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	13	34,505,101 - 34,506,904 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

UCN2
(Chlorocebus sabaeus - African green monkey)

Vervet Assembly	Chr	Position (strand)	Source	Genome Browsers
Vervet Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	22	9,962,339 - 9,964,553 (-)	NCBI

Ucn2
(Heterocephalus glaber - naked mole-rat)

Molerat Assembly	Chr	Position (strand)	Source	Genome Browsers
Molerat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624730	2,567,154 - 2,568,387 (-)	NCBI

Position Markers

AW209154

Mouse Assembly	Chr	Position (strand)	Source	JBrowse
GRCm38	9	108,984,739 - 108,984,831	UniSTS	GRCm38
MGSCv37	9	108,886,784 - 108,886,876	UniSTS	GRCm37
Celera	9	108,542,677 - 108,542,769	UniSTS
Cytogenetic Map	9	F2	UniSTS
cM Map	9	61.0	UniSTS
Whitehead/MRC_RH	9	1108.69	UniSTS

QTLs in Region (GRCm38)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
4141833	W10q13_m	weight 10 weeks QTL 13 (mouse)			Not determined			63332429	120362868	Mouse
12904947	Tammq7_m	tibialis anterior muscle mass QTL 7 (mouse)					9	91683173	124595110	Mouse
13463478	Mchq18_m	mean corpuscular hemoglobin QTL 18 (mouse)					9	91641084	124595110	Mouse
13207569	Tcq13_m	total cholesterol QTL 13 (mouse)					9	59990000	109260000	Mouse
1302001	Bdln5_m	body length 5 (mouse)			Not determined		9	93762590	124595110	Mouse
13463474	Hbbcq5_m	hemoglobin concentration QTL 5 (mouse)					9	91641084	124595110	Mouse
10054492	El7_m	epilepsy 7 (mouse)			Not determined		9	75775364	114474379	Mouse
12910772	Lvic6_m	liver iron content 6 (mouse)					9	91413879	124595110	Mouse
1357461	Idd2_m	insulin dependent diabetes susceptibility 2 (mouse)			Not determined		9	82910333	116910428	Mouse
11081166	Psl5_m	promotion susceptibility QTL 5 (mouse)					9	94981301	112872929	Mouse
1357627	Tgq2_m	triglyceride QTL 2 (mouse)			Not determined		9	102000187	124595110	Mouse
1302103	Dob2_m	dietary obesity 2 (mouse)			Not determined		9	86239845	120289624	Mouse
1301192	Skts6_m	skin tumor susceptibility 6 (mouse)			Not determined		9	78640645	112640755	Mouse
13463477	Rbc9_m	red blood cell count 9 (mouse)					9	91641084	124595110	Mouse
10412290	Pvacm1l_m	plasma vascular cell adhesion molecule 1 levels (mouse)			Not determined		9	103289445	124595110	Mouse
10766454	Char10_m	P. chabaudi malaria resistance QTL 10 (mouse)					9	82910333	116910428	Mouse
1357635	Splq4_m	spleen weight QTL 4 (mouse)			Not determined		9	63332429	120362868	Mouse
1357657	Pymr_m	Plasmodium yoelli malaria resistance (mouse)			Not determined		9	89977005	118938021	Mouse
10412242	Alpq8_m	alcohol preference QTL 8 (mouse)			Not determined		9	89284925	123284925	Mouse
1300549	Bbaa17_m	B. burgdorferi-associated arthritis 17 (mouse)			Not determined		9	86230401	120230530	Mouse
12904961	Gmmq7_m	gastrocnemius muscle mass QTL 7 (mouse)					9	91683173	124595110	Mouse
1558767	Skmw11_m	skeletal muscle weight 11 (mouse)			Not determined		9	91641084	124595110	Mouse
13463480	Mchcq2_m	mean corpuscular hemoglobin concentration QTL 2 (mouse)					9	91641084	124595110	Mouse
12910773	Splic3_m	spleen iron content 3 (mouse)					9	91413879	124595110	Mouse
12879896	Berr3_m	berghei resistance locus 3 (mouse)					9	103289445	124595110	Mouse
11537364	Cnes5_m	C. neoformans susceptibility locus 5 (mouse)					9	96917590	124595110	Mouse
14746992	Manh67_m	mandible shape 67 (mouse)					9	94036768	124595110	Mouse
10401247	Bglu14_m	blood glucose level 14 (mouse)			Not determined		9	79397810	113397888	Mouse
4141545	Tailaq2_m	tail length adjusted QTL 2 (mouse)			Not determined			63332429	120362868	Mouse
1300884	Sluc11_m	susceptibility to lung cancer 11 (mouse)			Not determined		9	82910333	116910428	Mouse
1302065	El1_m	epilepsy 1 (mouse)			Not determined		9	75775364	114474379	Mouse
1301732	Char1_m	P. chabaudi malaria resistance QTL 1 (mouse)			Not determined		9	81798268	115798392	Mouse
1301789	Pbwg4_m	postnatal body weight growth 4 (mouse)			Not determined		9	103289445	124595110	Mouse
18182932	Metl3_m	metabolite locus 3, N-acetylglutamate (mouse)					9	89563342	123563342	Mouse
11251716	Siim2_m	stress induced immobility 2 (mouse)					9	86748483	120748483	Mouse
12880422	V25Dq6_m	vitamin D inactive form serum level QTL 6 (mouse)					9	87800000	121800000	Mouse
1301407	Rapop2_m	radiation-induced apoptosis 2 (mouse)			Not determined		9	76535936	110536130	Mouse
1357648	Obq18_m	obesity QTL 18 (mouse)			Not determined		9	102000187	124595110	Mouse
1301487	Nociq1_m	nociceptive sensitivity inflammatory QTL 1 (mouse)			Not determined		9	84528818	118528921	Mouse
1301297	Lcho1_m	liver cholesterol 1 (mouse)			Not determined		9	101060861	124595110	Mouse
1301649	Psl1_m	promotion susceptibility QTL 1 (mouse)			Not determined		9	89412277	123412396	Mouse
12910770	Splic1_m	spleen iron content 1 (mouse)					9	91413879	124595110	Mouse
1301484	Bwq6_m	body weight (mouse)			Not determined		9	93762590	124595110	Mouse
13463475	Hctq7_m	hematocrit QTL 7 (mouse)					9	91641084	124595110	Mouse
13515058	Adip20d_m	adiposity 20d (mouse)					9	108915010	118915010	Mouse
12904937	Edlmmq9_m	extensor digitorum longus muscle mass QTL 9 (mouse)					9	91683173	124595110	Mouse

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	228
Count of miRNA genes:	194
Interacting mature miRNAs:	209
Transcripts:	ENSMUST00000052724
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Expression

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_145077	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC140383	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC174646	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AF331517	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AK132113	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH466560	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSMUST00000052724 ⟹ ENSMUSP00000060405

RefSeq Status:

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm38.p6 Ensembl	9	108,986,010 - 108,987,164 (+)	Ensembl

RefSeq Acc Id:

NM_145077 ⟹ NP_659543

RefSeq Status:

REVIEWED

Type:

CODING

Position:

Mouse Assembly	Chr	Position (strand)	Source
GRCm39	9	108,815,231 - 108,816,232 (+)	NCBI
GRCm38	9	108,986,163 - 108,987,164 (+)	ENTREZGENE
MGSCv37	9	108,888,208 - 108,889,209 (+)	RGD
Celera	9	108,544,152 - 108,545,153 (+)	RGD
cM Map	9		ENTREZGENE

Sequence:

show sequence

CCTTCCCACATGATGACCAGGTGGGCACTGGTGGTGTTCGTGGTCCTGATGTTGGATAGGATCC
TATTTGTCCCAGGAACTCCTATCCCCACCTTCCAGCTCCTCCCTCAGAACTCTCTGGAGACAAC
TCCTAGCTCTGTGACCTCAGAGAGCTCCTCAGGTACCACCACAGGACCCTCAGCTTCCTGGAGC
AACTCTAAAGCCAGCCCTTACCTAGACACCCGTGTCATACTCTCCCTGGATGTTCCCATTGGCC
TCCTACGGATCTTACTGGAACAGGCTCGTTACAAGGCTGCCAGGAATCAGGCTGCCACTAATGC
TCAAATACTAGCCCATGTTGGCCGCCGCTGAGACTGAAGAAGGGGTTCCTAAAGATGGGGTGAC
CCTGGATGAGAAGTTCTGGAGGACAGCCACAAAGCTGGACAGTACTACATTTGGCCAAACACAT
ACCCAGAGATCACCGAGATGGACCACTGCCATAGCTTCCAAGTATCTACAGTGTGTTTCTACAG
CTTGGCCATATAGTGTCTTGCCATGCTTCTGAGCCCCTAACACTTAATATGTTTGGGCATCTTG
GACTCTAGCATGTATGTTCAATATATGTAATCTTGTCATGTCTAGCTGAGTCTGGCAGTCACAG
AGCATCTAGATACCACCATGTGAGCTCCATCCTTAAATGTAAAGGAGAGTCAACATAGAACCCC
AGTGCTGCACCTGAAGTCCATCTAAGGTCCACAGGCCTGCCCCCCTCCCCAGGCTGCTACACCA
GAGAGTGCTGGAGGGGGTCACATGCTTGTTTTGTGGTCTTGTTTTTGTTTTTAAAGACAGTCTT
GGGCTGGTGAGATGGCTCAGAGGTTATGAGCCCTAGTTGCTCTTCCAGAGGTCCTGAGTTCAGT
TCCCAGCAACCACCTGGTGGCTCACAACTATCTATAAGGGGATCTGATGCCTTCTTCTGGCCTA
TGGAAGTATATGCAGCAGAGCATTCACACAATAAATAAATTT

hide sequence

Protein Sequences


Protein RefSeqs	NP_659543	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAK16157	(Get FASTA)	NCBI Sequence Viewer
	EDL21326	(Get FASTA)	NCBI Sequence Viewer
	Q99ML8	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	NP_659543 ⟸ NM_145077
- Peptide Label:	preproprotein
- UniProtKB:	Q99ML8 (UniProtKB/Swiss-Prot)
- Sequence:	show sequence MMTRWALVVFVVLMLDRILFVPGTPIPTFQLLPQNSLETTPSSVTSESSSGTTTGPSASWSNSK ASPYLDTRVILSLDVPIGLLRILLEQARYKAARNQAATNAQILAHVGRR hide sequence

RefSeq Acc Id:

ENSMUSP00000060405 ⟸ ENSMUST00000052724

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	MGI:2176375	AgrOrtholog
Ensembl Genes	ENSMUSG00000049699	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Protein	ENSMUSP00000060405	ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSMUST00000052724	ENTREZGENE, UniProtKB/Swiss-Prot
InterPro	CRF	UniProtKB/Swiss-Prot
	Urocortin_II	UniProtKB/Swiss-Prot
	Urocortin_II/III	UniProtKB/Swiss-Prot
KEGG Report	mmu:171530	UniProtKB/Swiss-Prot
MGD	MGI:2176375	ENTREZGENE
NCBI Gene	171530	ENTREZGENE
PANTHER	PTHR17575	UniProtKB/Swiss-Prot
	PTHR17575:SF0	UniProtKB/Swiss-Prot
Pfam	CRF	UniProtKB/Swiss-Prot
PharmGKB	UCN2	RGD
PhenoGen	Ucn2	PhenoGen
UniGene	Mm.388865	ENTREZGENE
UniProt	Q99ML8	ENTREZGENE, UniProtKB/Swiss-Prot
UniProt Secondary	F8WIL4	UniProtKB/Swiss-Prot

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - CTD

RGD Manual Annotations