IFNE (interferon epsilon) - Rat Genome Database

Name: IFNE
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Gene: IFNE (interferon epsilon) Homo sapiens

Analyze

Symbol:

IFNE

Name:

interferon epsilon

RGD ID:

1606106

HGNC Page

HGNC:18163

Description:

Predicted to enable cytokine activity and type I interferon receptor binding activity. Predicted to be involved in several processes, including B cell activation; defense response to other organism; and lymphocyte activation involved in immune response. Predicted to be located in extracellular region. Predicted to be active in extracellular space.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

IFN-E; IFN-epsilon; IFNE1; IFNT1; INFE1; interferon epsilon 1; interferon epsilon-1; interferon tau-1; interferon, epsilon; interferon-epsilon; MGC119018; MGC119020; PRO655

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Mus musculus (house mouse):	Ifne (interferon epsilon)	HGNC	EggNOG, Ensembl, HGNC, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Rattus norvegicus (Norway rat):	Ifne (interferon, epsilon)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Chinchilla lanigera (long-tailed chinchilla):	Ifne (interferon epsilon)	NCBI	Ortholog
Pan paniscus (bonobo/pygmy chimpanzee):	IFNE (interferon epsilon)	NCBI	Ortholog
Canis lupus familiaris (dog):	IFNE (interferon epsilon)	HGNC	Inparanoid, NCBI, OMA
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Ifne (interferon epsilon)	NCBI	Ortholog
Sus scrofa (pig):	IFNE (interferon epsilon)	HGNC	EggNOG, Ensembl, Inparanoid, NCBI, OMA, OrthoDB, Panther, Treefam
Heterocephalus glaber (naked mole-rat):	Ifne (interferon epsilon)	NCBI	Ortholog
Alliance orthologs ³
Mus musculus (house mouse):	Ifne (interferon epsilon)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Rattus norvegicus (Norway rat):	Ifne (interferon, epsilon)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	ifnphi3 (interferon phi 3)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	ifnphi2 (interferon phi 2)	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)

Related Pseudogenes:

IFNNP1

Allele / Splice:

See ClinVar data

Latest Assembly:

GRCh38 - Human Genome Assembly GRCh38

Position:

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	21,480,839 - 21,482,313 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	21,480,839 - 21,482,313 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	21,480,838 - 21,482,312 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	21,470,838 - 21,472,312 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	9	21,419,150 - 21,420,624 (-)	NCBI		Celera
Cytogenetic Map	9	p21.3	NCBI
HuRef	9	21,444,236 - 21,445,710 (-)	NCBI		HuRef
CHM1_1	9	21,480,654 - 21,482,129 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	21,495,017 - 21,496,491 (-)	NCBI		T2T-CHM13v2.0

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (IAGP)

schizophrenia (IAGP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2-dichloroethane (ISO)

17beta-estradiol (EXP)

aristolochic acid A (EXP)

butanal (EXP)

disodium selenite (EXP)

epoxiconazole (ISO)

nickel sulfate (EXP)

paracetamol (EXP)

pentanal (EXP)

potassium chromate (EXP)

sodium arsenite (ISO)

trichloroethene (ISO)

valproic acid (ISO)

vanadyl sulfate (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adaptive immune response (IBA)

B cell differentiation (IBA)

B cell proliferation (IBA)

cellular response to virus (NAS)

cytokine-mediated signaling pathway (IBA)

defense response (IEA)

defense response to bacterium (IEA,ISS)

defense response to virus (IEA,ISS)

humoral immune response (IBA)

natural killer cell activation (ISO)

natural killer cell activation involved in immune response (IBA)

negative regulation of cell population proliferation (ISO)

positive regulation of peptidyl-serine phosphorylation of STAT protein (IBA)

positive regulation of receptor signaling pathway via JAK-STAT (ISO)

response to exogenous dsRNA (IBA)

signal transduction (IEA)

T cell activation involved in immune response (IBA)

type I interferon-mediated signaling pathway (NAS)

Cellular Component

extracellular region (IEA)

extracellular space (IBA,IEA)

Molecular Function

cytokine activity (IBA,IEA)

cytokine receptor binding (IEA)

type I interferon receptor binding (IBA)

Molecular Pathway Annotations Click to see Annotation Detail View

Jak-Stat signaling pathway (IEA)

Retinoic acid-inducible gene (RIG) I-like receptor signaling pathway (IEA)

Phenotype Annotations Click to see Annotation Detail View

Human Phenotype

Schizophrenia (IAGP)

References

References - curated

#	Reference Title	Reference Citation
1.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12477932	PMID:12975309	PMID:15233997	PMID:15546383	PMID:17287131	PMID:17878351	PMID:18362232	PMID:18842358	PMID:20574843	PMID:20588308	PMID:20601674	PMID:21873635
PMID:22565157	PMID:23802172	PMID:23851686	PMID:24023261	PMID:24055696	PMID:26555708	PMID:27942584	PMID:28045025	PMID:28514442	PMID:29905034	PMID:30936491	PMID:33961781
PMID:35862222	PMID:36897927	PMID:37587335	PMID:38156399

Genomics

Comparative Map Data

IFNE
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	21,480,839 - 21,482,313 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	21,480,839 - 21,482,313 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	21,480,838 - 21,482,312 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	21,470,838 - 21,472,312 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Celera	9	21,419,150 - 21,420,624 (-)	NCBI		Celera
Cytogenetic Map	9	p21.3	NCBI
HuRef	9	21,444,236 - 21,445,710 (-)	NCBI		HuRef
CHM1_1	9	21,480,654 - 21,482,129 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	9	21,495,017 - 21,496,491 (-)	NCBI		T2T-CHM13v2.0

Ifne
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	88,797,775 - 88,798,438 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	88,797,775 - 88,798,438 (-)	Ensembl		GRCm39 Ensembl
GRCm38	4	88,879,538 - 88,880,201 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	88,879,538 - 88,880,201 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	88,525,442 - 88,526,105 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	88,350,769 - 88,351,432 (-)	NCBI		MGSCv36	mm8
Celera	4	87,361,557 - 87,362,220 (-)	NCBI		Celera
Cytogenetic Map	4	C4	NCBI
cM Map	4	42.04	NCBI

Ifne
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	5	108,687,443 - 108,688,103 (-)	NCBI		GRCr8
mRatBN7.2	5	103,571,630 - 103,572,290 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	103,569,675 - 103,572,256 (-)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	106,001,333 - 106,001,993 (-)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	107,730,936 - 107,731,596 (-)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	107,806,683 - 107,807,343 (-)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	107,178,124 - 107,203,908 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	107,233,230 - 107,233,799 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	111,209,796 - 111,210,371 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	108,451,998 - 108,452,573 (-)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	102,299,136 - 102,302,428 (-)	NCBI		Celera
Cytogenetic Map	5	q32	NCBI

Ifne
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0	NW_004955472	12,795,352 - 12,801,035 (-)	NCBI	ChiLan1.0	ChiLan1.0

IFNE
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	11	103,020,217 - 103,078,310 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	9	102,978,239 - 103,082,778 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	21,315,415 - 21,394,413 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	21,932,923 - 22,038,134 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	21,959,275 - 21,959,901 (-)	Ensembl	panpan1.1		panPan2
PanPan1.1 Ensembl	9	21,959,275 - 21,959,901 (-)	NCBI	panpan1.1		panPan2

IFNE
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	40,879,658 - 40,880,883 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	39,548,976 - 39,553,319 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	41,818,693 - 41,823,034 (-)	NCBI		ROS_Cfam_1.0
UMICH_Zoey_3.1	11	40,493,271 - 40,494,500 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	40,380,346 - 40,381,575 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	40,990,911 - 40,995,258 (-)	NCBI		UU_Cfam_GSD_1.0

Ifne
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	155,470,975 - 155,471,615 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936652	3,140,568 - 3,141,122 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936652	3,140,568 - 3,141,122 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

IFNE
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	201,221,665 - 201,227,047 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	201,219,848 - 201,228,361 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	224,419,123 - 224,441,395 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

Ifne
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla 1.0	NW_004624736	25,459,387 - 25,460,055 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in IFNE
13 total Variants

Clinical Variants

Name	Type	Condition(s)	Position(s)	Clinical significance
GRCh38/hg38 9p24.3-q34.3(chr9:193412-138179445)x3	copy number gain	See cases [RCV000050348]	Chr9:193412..138179445 [GRCh38] Chr9:204193..141073897 [GRCh37] Chr9:194193..140193718 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
GRCh38/hg38 9p24.3-13.1(chr9:204193-38815478)x3	copy number gain	See cases [RCV000050357]	Chr9:204193..38815478 [GRCh38] Chr9:204193..38815475 [GRCh37] Chr9:194193..38805475 [NCBI36] Chr9:9p24.3-13.1	pathogenic\|conflicting interpretations of pathogenicity\|conflicting data from submitters
GRCh38/hg38 9p24.3-13.1(chr9:204193-38741440)x3	copy number gain	See cases [RCV000051106]	Chr9:204193..38741440 [GRCh38] Chr9:204193..38741437 [GRCh37] Chr9:194193..38731437 [NCBI36] Chr9:9p24.3-13.1	pathogenic
GRCh38/hg38 9p21.3(chr9:21082471-23839529)x1	copy number loss	See cases [RCV000052902]	Chr9:21082471..23839529 [GRCh38] Chr9:21082470..23839527 [GRCh37] Chr9:21072470..23829527 [NCBI36] Chr9:9p21.3	pathogenic
GRCh38/hg38 9p24.3-13.1(chr9:203993-38815619)x3	copy number gain	See cases [RCV000053703]	Chr9:203993..38815619 [GRCh38] Chr9:203993..38815616 [GRCh37] Chr9:193993..38805616 [NCBI36] Chr9:9p24.3-13.1	pathogenic
GRCh38/hg38 9p24.3-21.3(chr9:204193-22086858)x3	copy number gain	See cases [RCV000053704]	Chr9:204193..22086858 [GRCh38] Chr9:204193..22086857 [GRCh37] Chr9:194193..22076857 [NCBI36] Chr9:9p24.3-21.3	pathogenic
GRCh38/hg38 9p24.3-13.3(chr9:204193-34599437)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053706]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053706]\|See cases [RCV000053706]	Chr9:204193..34599437 [GRCh38] Chr9:204193..34599435 [GRCh37] Chr9:194193..34589435 [NCBI36] Chr9:9p24.3-13.3	pathogenic
GRCh38/hg38 9p24.3-13.3(chr9:204193-33284638)x3	copy number gain	See cases [RCV000053707]	Chr9:204193..33284638 [GRCh38] Chr9:204193..33284636 [GRCh37] Chr9:194193..33274636 [NCBI36] Chr9:9p24.3-13.3	pathogenic
GRCh38/hg38 9p24.3-q34.3(chr9:193412-138124532)x3	copy number gain	See cases [RCV000053745]	Chr9:193412..138124532 [GRCh38] Chr9:204193..141018984 [GRCh37] Chr9:194193..140138805 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
GRCh38/hg38 9p24.3-q34.3(chr9:193412-138114463)x3	copy number gain	See cases [RCV000053746]	Chr9:193412..138114463 [GRCh38] Chr9:214367..141008915 [GRCh37] Chr9:204367..140128736 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
GRCh38/hg38 9p24.3-13.1(chr9:220253-38815419)x3	copy number gain	See cases [RCV000053747]	Chr9:220253..38815419 [GRCh38] Chr9:220253..38815416 [GRCh37] Chr9:210253..38805416 [NCBI36] Chr9:9p24.3-13.1	pathogenic
GRCh38/hg38 9p24.3-q34.3(chr9:193412-138179445)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053748]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053748]\|See cases [RCV000053748]	Chr9:193412..138179445 [GRCh38] Chr9:266045..141073897 [GRCh37] Chr9:256045..140193718 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
GRCh38/hg38 9p23-21.1(chr9:9543538-30266463)x3	copy number gain	See cases [RCV000053749]	Chr9:9543538..30266463 [GRCh38] Chr9:9543538..30266461 [GRCh37] Chr9:9533538..30256461 [NCBI36] Chr9:9p23-21.1	pathogenic
GRCh38/hg38 9p23-13.3(chr9:13526091-34261642)x3	copy number gain	Developmental Delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053750]\|Developmental delay and additional significant developmental and morphological phenotypes referred for genetic testing [RCV000053750]\|See cases [RCV000053750]	Chr9:13526091..34261642 [GRCh38] Chr9:13526090..34261640 [GRCh37] Chr9:13516090..34251640 [NCBI36] Chr9:9p23-13.3	pathogenic
GRCh38/hg38 9p24.3-q34.3(chr9:204193-138179445)	copy number gain	See cases [RCV000133791]	Chr9:204193..138179445 [GRCh38] Chr9:204193..141073897 [GRCh37] Chr9:194193..140193718 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
GRCh38/hg38 9p24.3-21.1(chr9:220257-29424848)x3	copy number gain	See cases [RCV000134037]	Chr9:220257..29424848 [GRCh38] Chr9:220257..29424846 [GRCh37] Chr9:210257..29414846 [NCBI36] Chr9:9p24.3-21.1	pathogenic
GRCh38/hg38 9p24.3-q21.11(chr9:13997-68401065)x3	copy number gain	See cases [RCV000135344]	Chr9:13997..68401065 [GRCh38] Chr9:13997..71015981 [GRCh37] Chr9:3997..70205801 [NCBI36] Chr9:9p24.3-q21.11	pathogenic
GRCh38/hg38 9p24.3-q21.12(chr9:193412-70630731)x3	copy number gain	See cases [RCV000136152]	Chr9:193412..70630731 [GRCh38] Chr9:220253..73245647 [GRCh37] Chr9:210253..72435467 [NCBI36] Chr9:9p24.3-q21.12	pathogenic
GRCh38/hg38 9p24.3-q21.13(chr9:193412-74615913)x3	copy number gain	See cases [RCV000135954]	Chr9:193412..74615913 [GRCh38] Chr9:204193..77230829 [GRCh37] Chr9:194193..76420649 [NCBI36] Chr9:9p24.3-q21.13	pathogenic
GRCh38/hg38 9p24.1-21.2(chr9:4661872-27661572)x3	copy number gain	See cases [RCV000136680]	Chr9:4661872..27661572 [GRCh38] Chr9:4661872..27661570 [GRCh37] Chr9:4651872..27651570 [NCBI36] Chr9:9p24.1-21.2	pathogenic
GRCh38/hg38 9p24.1-13.2(chr9:7162304-37038771)x3	copy number gain	See cases [RCV000137741]	Chr9:7162304..37038771 [GRCh38] Chr9:7162304..37038768 [GRCh37] Chr9:7152304..37028768 [NCBI36] Chr9:9p24.1-13.2	pathogenic
GRCh38/hg38 9p24.3-q21.11(chr9:204104-66233120)x4	copy number gain	See cases [RCV000137888]	Chr9:204104..66233120 [GRCh38] Chr9:204104..47212321 [GRCh37] Chr9:194104..47002141 [NCBI36] Chr9:9p24.3-q21.11	pathogenic\|conflicting data from submitters
GRCh38/hg38 9p24.3-q34.3(chr9:193412-138124524)x3	copy number gain	See cases [RCV000138783]	Chr9:193412..138124524 [GRCh38] Chr9:204090..141018976 [GRCh37] Chr9:194090..140138797 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
GRCh38/hg38 9p24.3-21.3(chr9:459131-24207894)x3	copy number gain	See cases [RCV000138499]	Chr9:459131..24207894 [GRCh38] Chr9:459131..24207892 [GRCh37] Chr9:449131..24197892 [NCBI36] Chr9:9p24.3-21.3	pathogenic
GRCh38/hg38 9p24.3-q21.11(chr9:204104-67549861)x3	copy number gain	See cases [RCV000139208]	Chr9:204104..67549861 [GRCh38] Chr9:204104..66516698 [GRCh37] Chr9:194104..66256518 [NCBI36] Chr9:9p24.3-q21.11	pathogenic
GRCh38/hg38 9p24.3-13.3(chr9:204104-34151476)x3	copy number gain	See cases [RCV000139015]	Chr9:204104..34151476 [GRCh38] Chr9:204104..34151474 [GRCh37] Chr9:194104..34141474 [NCBI36] Chr9:9p24.3-13.3	pathogenic\|likely benign
GRCh38/hg38 9p24.3-13.1(chr9:204104-38768294)x3	copy number gain	See cases [RCV000139126]	Chr9:204104..38768294 [GRCh38] Chr9:204104..38768291 [GRCh37] Chr9:194104..38758291 [NCBI36] Chr9:9p24.3-13.1	pathogenic
GRCh38/hg38 9p24.3-q34.3(chr9:193412-138159073)x3	copy number gain	See cases [RCV000138962]	Chr9:193412..138159073 [GRCh38] Chr9:204104..141053525 [GRCh37] Chr9:194104..140173346 [NCBI36] Chr9:9p24.3-q34.3	pathogenic\|conflicting data from submitters
GRCh38/hg38 9p22.2-q21.11(chr9:18344605-68257015)	copy number gain	See cases [RCV000140448]	Chr9:18344605..68257015 [GRCh38] Chr9:18344603..68995221 [GRCh37] Chr9:18334603..68285041 [NCBI36] Chr9:9p22.2-q21.11	pathogenic
GRCh38/hg38 9p22.1-21.1(chr9:19564275-28106622)x1	copy number loss	See cases [RCV000139905]	Chr9:19564275..28106622 [GRCh38] Chr9:19564273..28106620 [GRCh37] Chr9:19554273..28096620 [NCBI36] Chr9:9p22.1-21.1	pathogenic
GRCh38/hg38 9p24.3-21.2(chr9:204104-27963369)x3	copy number gain	See cases [RCV000139621]	Chr9:204104..27963369 [GRCh38] Chr9:204104..27963367 [GRCh37] Chr9:194104..27953367 [NCBI36] Chr9:9p24.3-21.2	pathogenic
GRCh38/hg38 9p21.3(chr9:21150820-21517343)x3	copy number gain	See cases [RCV000140758]	Chr9:21150820..21517343 [GRCh38] Chr9:21150819..21517342 [GRCh37] Chr9:21140819..21507342 [NCBI36] Chr9:9p21.3	likely benign
GRCh38/hg38 9p24.3-q22.1(chr9:203861-88130444)x4	copy number gain	See cases [RCV000141904]	Chr9:203861..88130444 [GRCh38] Chr9:203861..90745359 [GRCh37] Chr9:193861..89935179 [NCBI36] Chr9:9p24.3-q22.1	pathogenic
GRCh38/hg38 9p24.3-q34.3(chr9:203861-138125937)x3	copy number gain	See cases [RCV000141876]	Chr9:203861..138125937 [GRCh38] Chr9:203861..141020389 [GRCh37] Chr9:193861..140140210 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
GRCh38/hg38 9p21.3(chr9:21435578-21645004)x1	copy number loss	See cases [RCV000141797]	Chr9:21435578..21645004 [GRCh38] Chr9:21435577..21645003 [GRCh37] Chr9:21425577..21635003 [NCBI36] Chr9:9p21.3	uncertain significance
GRCh38/hg38 9p24.3-21.1(chr9:203861-31423873)x4	copy number gain	See cases [RCV000141662]	Chr9:203861..31423873 [GRCh38] Chr9:203861..31423871 [GRCh37] Chr9:193861..31413871 [NCBI36] Chr9:9p24.3-21.1	pathogenic
GRCh38/hg38 9p24.3-q21.31(chr9:193412-79877816)x3	copy number gain	See cases [RCV000143012]	Chr9:193412..79877816 [GRCh38] Chr9:204104..82492731 [GRCh37] Chr9:194104..81682551 [NCBI36] Chr9:9p24.3-q21.31	pathogenic
GRCh38/hg38 9p24.3-13.1(chr9:203861-38381642)	copy number gain	See cases [RCV000143411]	Chr9:203861..38381642 [GRCh38] Chr9:203861..38381639 [GRCh37] Chr9:193861..38371639 [NCBI36] Chr9:9p24.3-13.1	pathogenic
GRCh38/hg38 9p24.3-q34.3(chr9:203862-138125937)x3	copy number gain	See cases [RCV000143476]	Chr9:203862..138125937 [GRCh38] Chr9:203862..141020389 [GRCh37] Chr9:193862..140140210 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
GRCh38/hg38 9p24.3-q34.3(chr9:193412-138179445)x3	copy number gain	See cases [RCV000148113]	Chr9:193412..138179445 [GRCh38] Chr9:204193..141073897 [GRCh37] Chr9:194193..140193718 [NCBI36] Chr9:9p24.3-q34.3	pathogenic
GRCh38/hg38 9p24.3-13.1(chr9:204193-38815478)x3	copy number gain	See cases [RCV000148159]	Chr9:204193..38815478 [GRCh38] Chr9:204193..38815475 [GRCh37] Chr9:194193..38805475 [NCBI36] Chr9:9p24.3-13.1	pathogenic
GRCh38/hg38 9p11.2-q34.3(chr9:193412-138159073)x3	copy number gain	See cases [RCV000139207]	Chr9:193412..138159073 [GRCh38] Chr9:68420641..141053525 [GRCh37] Chr9:67910461..140173346 [NCBI36] Chr9:9p11.2-q34.3	pathogenic
GRCh37/hg19 9p24.3-13.1(chr9:163131-38763958)x3	copy number gain	See cases [RCV000240201]	Chr9:163131..38763958 [GRCh37] Chr9:9p24.3-13.1	pathogenic
GRCh37/hg19 9p24.3-11.2(chr9:213161-47212321)x4	copy number gain	See cases [RCV000240048]	Chr9:213161..47212321 [GRCh37] Chr9:9p24.3-11.2	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:163131-141122114)x3	copy number gain	See cases [RCV000240081]	Chr9:163131..141122114 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9p24.3-13.1(chr9:213161-39092820)x3	copy number gain	See cases [RCV000239869]	Chr9:213161..39092820 [GRCh37] Chr9:9p24.3-13.1	pathogenic
GRCh37/hg19 9p22.1-q33.1(chr9:19356861-119513311)	copy number loss	Distal tetrasomy 15q [RCV002280776]	Chr9:19356861..119513311 [GRCh37] Chr9:9p22.1-q33.1	uncertain significance
GRCh37/hg19 9p24.3-13.3(chr9:203861-35903398)x3	copy number gain	MISSED ABORTION [RCV002282974]	Chr9:203861..35903398 [GRCh37] Chr9:9p24.3-13.3	pathogenic
NM_176891.5(IFNE):c.521G>A (p.Arg174Gln)	single nucleotide variant	Inborn genetic diseases [RCV003245131]	Chr9:21481174 [GRCh38] Chr9:21481173 [GRCh37] Chr9:9p21.3	uncertain significance
GRCh37/hg19 9p24.3-q13(chr9:203861-68188391)x4	copy number gain	See cases [RCV000449165]	Chr9:203861..68188391 [GRCh37] Chr9:9p24.3-q13	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:62525-141006407)	copy number gain	See cases [RCV000449375]	Chr9:62525..141006407 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:203861-141020389)x3	copy number gain	not specified [RCV003986800]	Chr9:203861..141020389 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9p24.3-13.1(chr9:32396-39140211)	copy number gain	See cases [RCV000447246]	Chr9:32396..39140211 [GRCh37] Chr9:9p24.3-13.1	pathogenic
GRCh37/hg19 9p24.3-q13(chr9:203861-67983174)x4	copy number gain	See cases [RCV000446521]	Chr9:203861..67983174 [GRCh37] Chr9:9p24.3-q13	pathogenic
GRCh37/hg19 9p24.3-q21.11(chr9:13997-70919878)x4	copy number gain	See cases [RCV000448242]	Chr9:13997..70919878 [GRCh37] Chr9:9p24.3-q21.11	pathogenic
GRCh37/hg19 9p21.3(chr9:20951885-22447709)x1	copy number loss	See cases [RCV000448195]	Chr9:20951885..22447709 [GRCh37] Chr9:9p21.3	pathogenic
GRCh37/hg19 9p24.3-q21.11(chr9:203861-69002883)x3	copy number gain	See cases [RCV000448569]	Chr9:203861..69002883 [GRCh37] Chr9:9p24.3-q21.11	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:203864-141020389)x3	copy number gain	See cases [RCV000448978]	Chr9:203864..141020389 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9p22.2-21.1(chr9:17684434-30889762)x3	copy number gain	See cases [RCV000510665]	Chr9:17684434..30889762 [GRCh37] Chr9:9p22.2-21.1	pathogenic
GRCh37/hg19 9p24.1-21.1(chr9:5900425-30008330)x3	copy number gain	See cases [RCV000510425]	Chr9:5900425..30008330 [GRCh37] Chr9:9p24.1-21.1	pathogenic
GRCh37/hg19 9p24.3-13.1(chr9:203861-38787480)x3	copy number gain	See cases [RCV000510864]	Chr9:203861..38787480 [GRCh37] Chr9:9p24.3-13.1	pathogenic
GRCh37/hg19 9p22.2-13.3(chr9:17132123-35567051)x3	copy number gain	See cases [RCV000510986]	Chr9:17132123..35567051 [GRCh37] Chr9:9p22.2-13.3	pathogenic
NM_176891.5(IFNE):c.187C>G (p.Pro63Ala)	single nucleotide variant	Inborn genetic diseases [RCV003299497]	Chr9:21481508 [GRCh38] Chr9:21481507 [GRCh37] Chr9:9p21.3	uncertain significance
NM_176891.5(IFNE):c.278G>A (p.Arg93Lys)	single nucleotide variant	Inborn genetic diseases [RCV003286694]	Chr9:21481417 [GRCh38] Chr9:21481416 [GRCh37] Chr9:9p21.3	uncertain significance
GRCh37/hg19 9p23-21.2(chr9:10320113-26205565)x1	copy number loss	Poly (ADP-Ribose) polymerase inhibitor response [RCV000626433]	Chr9:10320113..26205565 [GRCh37] Chr9:9p23-21.2	drug response
GRCh37/hg19 9p24.3-11.2(chr9:204193-44259464)x4	copy number gain	Syndromic hydrocephalus due to diffuse villous hyperplasia of choroid plexus [RCV000677299]	Chr9:204193..44259464 [GRCh37] Chr9:9p24.3-11.2	likely pathogenic
GRCh37/hg19 9p24.3-q21.33(chr9:203861-88189913)x3	copy number gain	See cases [RCV000512431]	Chr9:203861..88189913 [GRCh37] Chr9:9p24.3-q21.33	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:203862-141020389)	copy number gain	See cases [RCV000512392]	Chr9:203862..141020389 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9p24.3-13.1(chr9:203861-38787480)x3	copy number gain	not provided [RCV000683172]	Chr9:203861..38787480 [GRCh37] Chr9:9p24.3-13.1	pathogenic
GRCh37/hg19 9p24.3-q21.12(chr9:203861-72717793)x3	copy number gain	not provided [RCV000683176]	Chr9:203861..72717793 [GRCh37] Chr9:9p24.3-q21.12	pathogenic
GRCh37/hg19 9p24.3-21.2(chr9:203861-26397133)x3	copy number gain	not provided [RCV000683171]	Chr9:203861..26397133 [GRCh37] Chr9:9p24.3-21.2	pathogenic
GRCh37/hg19 9p24.3-q13(chr9:203861-68262804)x3,4	copy number gain	not provided [RCV000683174]	Chr9:203861..68262804 [GRCh37] Chr9:9p24.3-q13	pathogenic
GRCh37/hg19 9p24.3-q13(chr9:203861-67983174)x4	copy number gain	not provided [RCV000683173]	Chr9:203861..67983174 [GRCh37] Chr9:9p24.3-q13	pathogenic
GRCh37/hg19 9p24.3-q21.11(chr9:203861-70985795)x4	copy number gain	not provided [RCV000683175]	Chr9:203861..70985795 [GRCh37] Chr9:9p24.3-q21.11	pathogenic
Single allele	duplication	Schizophrenia [RCV000754362]	Chr9:20655425..24580688 [GRCh38] Chr9:9p21.3	likely pathogenic
GRCh37/hg19 9p21.3(chr9:20834837-22101120)x1	copy number loss	not provided [RCV000748288]	Chr9:20834837..22101120 [GRCh37] Chr9:9p21.3	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:10590-141122247)x3	copy number gain	not provided [RCV000748055]	Chr9:10590..141122247 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:10590-141107672)x3	copy number gain	not provided [RCV000748053]	Chr9:10590..141107672 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9p24.3-21.3(chr9:46587-22012051)x3	copy number gain	not provided [RCV000748062]	Chr9:46587..22012051 [GRCh37] Chr9:9p24.3-21.3	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:46587-141066491)x3	copy number gain	not provided [RCV000748063]	Chr9:46587..141066491 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:10590-141114095)x2	copy number gain	not provided [RCV000748054]	Chr9:10590..141114095 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9p24.2-21.3(chr9:4420767-22195820)x3	copy number gain	not provided [RCV000748122]	Chr9:4420767..22195820 [GRCh37] Chr9:9p24.2-21.3	pathogenic
GRCh37/hg19 9p24.3-13.1(chr9:214309-39156958)	copy number gain	not provided [RCV000767644]	Chr9:214309..39156958 [GRCh37] Chr9:9p24.3-13.1	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:203861-141020388)x3	copy number gain	not provided [RCV000845900]	Chr9:203861..141020388 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9p21.3(chr9:20715401-22136489)	copy number loss	not provided [RCV000767562]	Chr9:20715401..22136489 [GRCh37] Chr9:9p21.3	pathogenic
GRCh37/hg19 9p24.3-13.1(chr9:203861-38472979)x3	copy number gain	not provided [RCV000848175]	Chr9:203861..38472979 [GRCh37] Chr9:9p24.3-13.1	pathogenic
GRCh37/hg19 9p24.3-q13(chr9:203861-67986965)x3	copy number gain	not provided [RCV000845815]	Chr9:203861..67986965 [GRCh37] Chr9:9p24.3-q13	pathogenic
GRCh37/hg19 9p21.3(chr9:20659492-22347440)x3	copy number gain	not provided [RCV002473498]	Chr9:20659492..22347440 [GRCh37] Chr9:9p21.3	uncertain significance
GRCh37/hg19 9p21.3(chr9:20829681-22069144)x3	copy number gain	not provided [RCV001006222]	Chr9:20829681..22069144 [GRCh37] Chr9:9p21.3	uncertain significance
GRCh37/hg19 9p24.3-q21.11(chr9:203861-70984588)x3	copy number gain	not provided [RCV001006167]	Chr9:203861..70984588 [GRCh37] Chr9:9p24.3-q21.11	pathogenic
GRCh37/hg19 9p21.3(chr9:21391297-23423892)x3	copy number gain	not provided [RCV001259527]	Chr9:21391297..23423892 [GRCh37] Chr9:9p21.3	uncertain significance
GRCh37/hg19 9p24.3-q13(chr9:203861-67986965)	copy number gain	Tetrasomy 9p [RCV002280656]	Chr9:203861..67986965 [GRCh37] Chr9:9p24.3-q13	pathogenic
NC_000009.11:g.12246100_101559378inv	inversion	Recurrent spontaneous abortion [RCV000999471]	Chr9:12246100..101559378 [GRCh37] Chr9:9p23-q22.33	likely pathogenic
GRCh37/hg19 9p24.3-13.1(chr9:203861-38787480)	copy number gain	not specified [RCV002053818]	Chr9:203861..38787480 [GRCh37] Chr9:9p24.3-13.1	pathogenic
GRCh37/hg19 9p24.3-q34.3(chr9:353349-141020389)	copy number gain	not specified [RCV002053823]	Chr9:353349..141020389 [GRCh37] Chr9:9p24.3-q34.3	pathogenic
GRCh37/hg19 9p24.3-q21.11(chr9:203861-69002883)	copy number gain	not specified [RCV002053819]	Chr9:203861..69002883 [GRCh37] Chr9:9p24.3-q21.11	pathogenic
GRCh37/hg19 9p24.3-13.3(chr9:676264-33743670)	copy number gain	not specified [RCV002053827]	Chr9:676264..33743670 [GRCh37] Chr9:9p24.3-13.3	pathogenic
GRCh37/hg19 9p24.3-q21.32(chr9:203861-84155399)	copy number gain	not specified [RCV002053820]	Chr9:203861..84155399 [GRCh37] Chr9:9p24.3-q21.32	pathogenic
GRCh37/hg19 9p24.3-q34.11(chr9:203861-131603223)x3	copy number gain	See cases [RCV002292402]	Chr9:203861..131603223 [GRCh37] Chr9:9p24.3-q34.11	pathogenic
GRCh37/hg19 9p24.3-13.1(chr9:48827-39154913)x3	copy number gain	Syndromic anorectal malformation [RCV002286608]	Chr9:48827..39154913 [GRCh37] Chr9:9p24.3-13.1	likely pathogenic
GRCh37/hg19 9p24.3-q13(chr9:203861-68342786)	copy number gain	Bradycardia [RCV002280662]	Chr9:203861..68342786 [GRCh37] Chr9:9p24.3-q13	pathogenic
NM_176891.5(IFNE):c.317C>T (p.Thr106Met)	single nucleotide variant	Inborn genetic diseases [RCV002778464]	Chr9:21481378 [GRCh38] Chr9:21481377 [GRCh37] Chr9:9p21.3	likely benign
NM_176891.5(IFNE):c.328C>G (p.Leu110Val)	single nucleotide variant	Inborn genetic diseases [RCV002804020]	Chr9:21481367 [GRCh38] Chr9:21481366 [GRCh37] Chr9:9p21.3	uncertain significance
NM_176891.5(IFNE):c.445C>G (p.Arg149Gly)	single nucleotide variant	Inborn genetic diseases [RCV002742379]	Chr9:21481250 [GRCh38] Chr9:21481249 [GRCh37] Chr9:9p21.3	uncertain significance
NM_176891.5(IFNE):c.446G>A (p.Arg149Gln)	single nucleotide variant	Inborn genetic diseases [RCV002897764]	Chr9:21481249 [GRCh38] Chr9:21481248 [GRCh37] Chr9:9p21.3	likely benign
NM_176891.5(IFNE):c.253C>T (p.Leu85Phe)	single nucleotide variant	Inborn genetic diseases [RCV002921101]	Chr9:21481442 [GRCh38] Chr9:21481441 [GRCh37] Chr9:9p21.3	uncertain significance
NM_176891.5(IFNE):c.50C>T (p.Thr17Ile)	single nucleotide variant	Inborn genetic diseases [RCV003190199]	Chr9:21481645 [GRCh38] Chr9:21481644 [GRCh37] Chr9:9p21.3	uncertain significance
NM_176891.5(IFNE):c.404T>C (p.Leu135Ser)	single nucleotide variant	Inborn genetic diseases [RCV003173640]	Chr9:21481291 [GRCh38] Chr9:21481290 [GRCh37] Chr9:9p21.3	uncertain significance
NM_176891.5(IFNE):c.310A>G (p.Asn104Asp)	single nucleotide variant	Inborn genetic diseases [RCV003203652]	Chr9:21481385 [GRCh38] Chr9:21481384 [GRCh37] Chr9:9p21.3	uncertain significance
NM_176891.5(IFNE):c.327C>A (p.Phe109Leu)	single nucleotide variant	Inborn genetic diseases [RCV003376058]	Chr9:21481368 [GRCh38] Chr9:21481367 [GRCh37] Chr9:9p21.3	uncertain significance
GRCh37/hg19 9p24.3-13.1(chr9:1475882-38771831)x3	copy number gain	not provided [RCV003484765]	Chr9:1475882..38771831 [GRCh37] Chr9:9p24.3-13.1	pathogenic
NM_176891.5(IFNE):c.435A>T (p.Lys145Asn)	single nucleotide variant	IFNE-related condition [RCV003904015]	Chr9:21481260 [GRCh38] Chr9:21481259 [GRCh37] Chr9:9p21.3	likely benign
NM_176891.5(IFNE):c.391C>A (p.Leu131Ile)	single nucleotide variant	Inborn genetic diseases [RCV003359043]	Chr9:21481304 [GRCh38] Chr9:21481303 [GRCh37] Chr9:9p21.3	uncertain significance

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	95
Count of miRNA genes:	83
Interacting mature miRNAs:	84
Transcripts:	ENST00000448696
Prediction methods:	Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

Markers in Region

IFNT1_2211

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	9	21,480,902 - 21,481,693	UniSTS	GRCh37
Build 36	9	21,470,902 - 21,471,693	RGD	NCBI36
Celera	9	21,419,214 - 21,420,005	RGD
HuRef	9	21,444,300 - 21,445,091	UniSTS

UniSTS:484186

Human Assembly	Chr	Position (strand)	Source	JBrowse
GRCh37	9	21,481,058 - 21,481,699	UniSTS	GRCh37
Celera	9	21,419,370 - 21,420,011	UniSTS
HuRef	9	21,444,456 - 21,445,097	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

alimentary part of gastrointestinal system

circulatory system

endocrine system

exocrine system

hemolymphoid system

hepatobiliary system

integumental system

musculoskeletal system

nervous system

renal system

reproductive system

respiratory system

sensory system

adipose tissue

appendage

entire extraembryonic component

High

Medium

Low

408

684

118

703

127

447

586

Below cutoff

573

627

384

183

313

1069

249

1878

195

637

602

121

490

460

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_176891	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AL353732	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY190045	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AY358570	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC100871	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC100872	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC100873	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CP068269	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENST00000448696 ⟹ ENSP00000418018

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38.p14 Ensembl	9	21,480,839 - 21,482,313 (-)	Ensembl

RefSeq Acc Id:

NM_176891 ⟹ NP_795372

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Human Assembly	Chr	Position (strand)	Source
GRCh38	9	21,480,839 - 21,482,313 (-)	NCBI
GRCh37	9	21,480,838 - 21,482,312 (-)	RGD
Build 36	9	21,470,838 - 21,472,312 (-)	NCBI Archive
Celera	9	21,419,150 - 21,420,624 (-)	RGD
HuRef	9	21,444,236 - 21,445,710 (-)	ENTREZGENE
CHM1_1	9	21,480,654 - 21,482,129 (-)	NCBI
T2T-CHM13v2.0	9	21,495,017 - 21,496,491 (-)	NCBI

Sequence:

show sequence

CTTAGATATTAAACTGATAGGATAAGATATAAAATAATTTAAGATTGCTGATATATGTTTTAAA
ATTAATTATTTGCTCAAGCATTTGTGACAATTTACAGTTCTAATTGAGGTTTTAAATTTAGTAG
TTTGTAGGTATTTTAAGTTTTGCCCCTGAATTCTTTATAGGTGCTGATAAGCCTTTGGTAAGTT
TTACTCCATGAAAGACTATTACTGAAAAAAACGTAATCTCAATAAAAGAACTTTAATAAGCTTG
ACTAAATATTTAGAAAGCACATTGTGTTCAGTGAAACTTTGTATATAATGAATAGAATAATAAA
AGATTATGTTGGATGACTAGTCTGTAATTGCCTCAAGGAAAGCATACAATGAATAAGTTATTTT
GGTACTTCCTCAAAATAGCCAACACAATAGGGAAATGGAGAAAATGTACTCTGAACACCATGAA
AAGGGAACCTGAAAATCTAATGTGTAAACTTGGAGAAATGACATTAGAAAACGAAAGCAACAAA
AGAGAACACTCTCCAAAATAATCTGAGATGCATGAAAGGCAAACATTCACTAGAGCTGGAATTT
CCCTAAGTCTATGCAGGGATAAGTAGCATATTTGACCTTCACCATGATTATCAAGCACTTCTTT
GGAACTGTGTTGGTGCTGCTGGCCTCTACCACTATCTTCTCTCTAGATTTGAAACTGATTATCT
TCCAGCAAAGACAAGTGAATCAAGAAAGTTTAAAACTCTTGAATAAGTTGCAAACCTTGTCAAT
TCAGCAGTGTCTACCACACAGGAAAAACTTTCTGCTTCCTCAGAAGTCTTTGAGTCCTCAGCAG
TACCAAAAAGGACACACTCTGGCCATTCTCCATGAGATGCTTCAGCAGATCTTCAGCCTCTTCA
GGGCAAATATTTCTCTGGATGGTTGGGAGGAAAACCACACGGAGAAATTCCTCATTCAACTTCA
TCAACAGCTAGAATACCTAGAAGCACTCATGGGACTGGAAGCAGAGAAGCTAAGTGGTACTTTG
GGTAGTGATAACCTTAGATTACAAGTTAAAATGTACTTCCGAAGGATCCATGATTACCTGGAAA
ACCAGGACTACAGCACCTGTGCCTGGGCCATTGTCCAAGTAGAAATCAGCCGATGTCTGTTCTT
TGTGTTCAGTCTCACAGAAAAACTGAGCAAACAAGGAAGACCCTTGAACGACATGAAGCAAGAG
CTTACTACAGAGTTTAGAAGCCCGAGGTAGGTGGAGGGACTAGAGGACTTCTCCAGACATGATT
CTTCATAGAGTGGTAATACAATTTATAGTACAATCACATTGCTTTGATTTTGTGTATATATATA
TTTATCTGTGTTTTAAGATTGTGCATATTGACCACAATTGTTTTTATTTTGTAATGTGGCTTTA
TATATTCTATCCATTTTAAATTGTTTGTATGTCAAAATAAATTCATTAATATGGTTGATTCTTC
AAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_795372	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI00872	(Get FASTA)	NCBI Sequence Viewer
	AAI00873	(Get FASTA)	NCBI Sequence Viewer
	AAI00874	(Get FASTA)	NCBI Sequence Viewer
	AAO38686	(Get FASTA)	NCBI Sequence Viewer
	AAQ88933	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSP00000418018
	ENSP00000418018.2
GenBank Protein	Q86WN2	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_795372 ⟸ NM_176891
- Peptide Label:	precursor
- UniProtKB:	Q86WN2 (UniProtKB/Swiss-Prot), A0A7R8GUQ9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MIIKHFFGTVLVLLASTTIFSLDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNFLLPQ KSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEA EKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRP LNDMKQELTTEFRSPR hide sequence

RefSeq Acc Id:

ENSP00000418018 ⟸ ENST00000448696

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-Q86WN2-F1-model_v2	AlphaFold	Q86WN2	1-208	view protein structure

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	HGNC:18163	AgrOrtholog
COSMIC	IFNE	COSMIC
Ensembl Genes	ENSG00000184995	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENST00000448696	ENTREZGENE
	ENST00000448696.4	UniProtKB/Swiss-Prot
Gene3D-CATH	1.20.1250.10	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
GTEx	ENSG00000184995	GTEx
HGNC ID	HGNC:18163	ENTREZGENE
Human Proteome Map	IFNE	Human Proteome Map
InterPro	4_helix_cytokine-like_core	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Interferon_alpha/beta/delta	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	hsa:338376	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
NCBI Gene	338376	ENTREZGENE
OMIM	615223	OMIM
PANTHER	INTERFERON EPSILON	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR11691	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Interferon	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PharmGKB	PA164720874	PharmGKB
PRINTS	INTERFERONAB	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PROSITE	INTERFERON_A_B_D	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
SMART	IFabd	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Superfamily-SCOP	SSF47266	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A7R8GUQ9	ENTREZGENE, UniProtKB/TrEMBL
	IFNE_HUMAN	UniProtKB/Swiss-Prot, ENTREZGENE

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2016-06-21	IFNE	interferon epsilon		interferon, epsilon	Symbol and/or name change	5135510	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

Imported Human Phenotype Annotations - ClinVar

Send us a Message

Imported Disease Annotations - ClinVar

Imported Annotations - KEGG (archival)

Imported Human Phenotype Annotations - ClinVar