Advanced Search (OLGA)

Gene: Rps27l (ribosomal protein S27-like) Rattus norvegicus

Analyze

Symbol:

Rps27l

Name:

ribosomal protein S27-like

RGD ID:

1595396

Description:

Predicted to enable RNA binding activity and translation activator activity. Predicted to be a structural constituent of ribosome. Predicted to be involved in intracellular signal transduction; positive regulation of translation; and ribosomal small subunit assembly. Predicted to be located in nucleus. Predicted to be part of cytosolic small ribosomal subunit. Orthologous to human RPS27L (ribosomal protein S27 like); PARTICIPATES IN ribosome biogenesis pathway; INTERACTS WITH 1,2-dimethylhydrazine; 17beta-estradiol; 2-nitrofluorene.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

40S ribosomal protein S27-like; LOC681429; ribosomal protein S27; ribosomal protein S27-like 1; Rps27l1; similar to 40S ribosomal protein S27-like protein; small ribosomal subunit protein eS27-like

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	RPS27L (ribosomal protein S27 like)	RGD	RGD
Mus musculus (house mouse):	Rps27l (ribosomal protein S27-like)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Rps27l (ribosomal protein S27 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	RPS27L (ribosomal protein S27 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	RPS27L (ribosomal protein S27 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Rps27l (ribosomal protein S27 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	RPS27L (ribosomal protein S27 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	RPS27L (ribosomal protein S27 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Rps27l (ribosomal protein S27 like)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	RPS27 (ribosomal protein S27)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	RPS27L (ribosomal protein S27 like)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Rps27l (ribosomal protein S27-like)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	rps-27	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RPS27A	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	RPS27B	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	RpS27	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	rps27l	Alliance	DIOPT (Ensembl Compara\|OMA\|PANTHER)
Xenopus tropicalis (tropical clawed frog):	rps27l	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector)

Related Pseudogenes:

Rps27-ps9

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	76,443,658 - 76,448,593 (+)	NCBI		GRCr8
mRatBN7.2	8	67,562,483 - 67,567,418 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	28,077,660 - 28,078,131 (-)	Ensembl		mRatBN7.2 Ensembl
mRatBN7.2 Ensembl	2	175,665,853 - 175,666,964 (-)	Ensembl		mRatBN7.2 Ensembl
mRatBN7.2 Ensembl	8	67,562,483 - 67,567,418 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	73,093,976 - 73,098,907 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	71,366,913 - 71,371,844 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	69,204,219 - 69,209,154 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	72,741,155 - 72,746,090 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	72,741,155 - 72,746,090 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	77,073,998 - 77,078,933 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	8	74,137,257 - 74,142,218 (-)	NCBI		Celera
Cytogenetic Map	8	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Imported Disease Annotations - ClinVar

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rps27l	Rat	Bloom syndrome		ISO	RGD:1344574	8554872	ClinVar Annotator: match by term: Bloom syndrome	ClinVar	PMID:28492532
Rps27l	Rat	colorectal cancer		ISO	RGD:1344574	8554872	ClinVar Annotator: match by term: Familial colorectal cancer	ClinVar	PMID:28492532
Rps27l	Rat	hypertrophic cardiomyopathy		ISO	RGD:1344574	8554872	ClinVar Annotator: match by term: Hypertrophic cardiomyopathy	ClinVar	PMID:28492532
Rps27l	Rat	nemaline myopathy 6		ISO	RGD:1344574	8554872	ClinVar Annotator: match by term: Nemaline myopathy 6	ClinVar	PMID:21681106\|PMID:24525055

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rps27l	Rat	(-)-demecolcine	increases expression	ISO	RGD:1344574	6480464	Demecolcine results in increased expression of RPS27L mRNA	CTD	PMID:23649840
Rps27l	Rat	(1->4)-beta-D-glucan	multiple interactions	ISO	RGD:1621531	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of RPS27L mRNA	CTD	PMID:36331819
Rps27l	Rat	1,2-dimethylhydrazine	multiple interactions	EXP		6480464	[APC protein affects the susceptibility to 1,2-Dimethylhydrazine] which results in increased expression of RPS27L mRNA	CTD	PMID:27840820
Rps27l	Rat	1,2-dimethylhydrazine	multiple interactions	ISO	RGD:1621531	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RPS27L mRNA	CTD	PMID:22206623
Rps27l	Rat	17alpha-ethynylestradiol	affects expression	ISO	RGD:1621531	6480464	Ethinyl Estradiol affects the expression of RPS27L mRNA	CTD	PMID:17555576
Rps27l	Rat	17alpha-ethynylestradiol	increases expression	ISO	RGD:1621531	6480464	Ethinyl Estradiol results in increased expression of RPS27L mRNA	CTD	PMID:17942748
Rps27l	Rat	17beta-estradiol	decreases expression	ISO	RGD:1344574	6480464	Estradiol results in decreased expression of RPS27L mRNA	CTD	PMID:23019147
Rps27l	Rat	17beta-estradiol	increases expression	EXP		6480464	Estradiol results in increased expression of RPS27L mRNA	CTD	PMID:32145629
Rps27l	Rat	17beta-hydroxy-17-methylestra-4,9,11-trien-3-one	affects splicing	ISO	RGD:1344574	6480464	Metribolone affects the splicing of RPS27L mRNA	CTD	PMID:17010196
Rps27l	Rat	2,2',4,4'-Tetrabromodiphenyl ether	affects expression	ISO	RGD:1621531	6480464	2,2',4,4'-tetrabromodiphenyl ether affects the expression of RPS27L mRNA	CTD	PMID:30294300
Rps27l	Rat	2,3,7,8-tetrachlorodibenzodioxine	multiple interactions	ISO	RGD:1344574	6480464	[Tetrachlorodibenzodioxin co-treated with Cycloheximide] results in increased expression of RPS27L mRNA	CTD	PMID:19684285
Rps27l	Rat	2,3,7,8-tetrachlorodibenzodioxine	affects expression	ISO	RGD:1621531	6480464	Tetrachlorodibenzodioxin affects the expression of RPS27L mRNA	CTD	PMID:21570461
Rps27l	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1621531	6480464	Tetrachlorodibenzodioxin results in increased expression of RPS27L mRNA	CTD	PMID:17942748
Rps27l	Rat	2,3,7,8-tetrachlorodibenzodioxine	increases expression	ISO	RGD:1344574	6480464	Tetrachlorodibenzodioxin results in increased expression of RPS27L mRNA	CTD	PMID:19684285
Rps27l	Rat	2,4-dibromophenyl 2,4,5-tribromophenyl ether	affects expression	ISO	RGD:1621531	6480464	2,2',4,4',5-brominated diphenyl ether affects the expression of RPS27L mRNA	CTD	PMID:38648751
Rps27l	Rat	2-acetamidofluorene	increases expression	ISO	RGD:1621531	6480464	2-Acetylaminofluorene results in increased expression of RPS27L mRNA	CTD	PMID:17317680
Rps27l	Rat	2-bromohexadecanoic acid	multiple interactions	ISO	RGD:1344574	6480464	2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ...	CTD	PMID:38195004
Rps27l	Rat	2-hydroxypropanoic acid	increases expression	ISO	RGD:1344574	6480464	Lactic Acid results in increased expression of RPS27L mRNA	CTD	PMID:30851411
Rps27l	Rat	2-methylcholine	affects expression	ISO	RGD:1344574	6480464	beta-methylcholine affects the expression of RPS27L mRNA	CTD	PMID:21179406
Rps27l	Rat	2-nitrofluorene	increases expression	EXP		6480464	2-nitrofluorene results in increased expression of RPS27L mRNA	CTD	PMID:15890375
Rps27l	Rat	4,4'-diaminodiphenylmethane	decreases expression	ISO	RGD:1621531	6480464	4,4'-diaminodiphenylmethane results in decreased expression of RPS27L mRNA	CTD	PMID:18648102
Rps27l	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1621531	6480464	bisphenol S results in increased expression of RPS27L mRNA	CTD	PMID:39298647
Rps27l	Rat	4,4'-sulfonyldiphenol	increases expression	ISO	RGD:1344574	6480464	bisphenol S results in increased expression of RPS27L protein	CTD	PMID:34186270
Rps27l	Rat	4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one	increases expression	EXP		6480464	4-(N-methyl-N-nitrosamino)-1-(3-pyridyl)-1-butanone results in increased expression of RPS27L mRNA	CTD	PMID:15890375
Rps27l	Rat	4-hydroxyphenyl retinamide	increases expression	ISO	RGD:1621531	6480464	Fenretinide results in increased expression of RPS27L mRNA	CTD	PMID:28973697
Rps27l	Rat	5-aza-2'-deoxycytidine	affects expression	ISO	RGD:1344574	6480464	Decitabine affects the expression of RPS27L mRNA	CTD	PMID:23300844
Rps27l	Rat	5-fluorouracil	multiple interactions	ISO	RGD:1344574	6480464	TP53 protein affects the reaction [Fluorouracil results in increased expression of RPS27L mRNA]	CTD	PMID:15016801
Rps27l	Rat	5-fluorouracil	decreases expression	ISO	RGD:1344574	6480464	Fluorouracil results in decreased expression of RPS27L protein	CTD	PMID:18056458
Rps27l	Rat	5-fluorouracil	increases expression	ISO	RGD:1344574	6480464	Fluorouracil results in increased expression of RPS27L mRNA	CTD	PMID:16557594
Rps27l	Rat	6-propyl-2-thiouracil	increases expression	EXP		6480464	Propylthiouracil results in increased expression of RPS27L mRNA	CTD	PMID:30047161
Rps27l	Rat	acrolein	multiple interactions	ISO	RGD:1344574	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of more ...	CTD	PMID:32699268
Rps27l	Rat	adefovir pivoxil	increases expression	ISO	RGD:1344574	6480464	adefovir dipivoxil results in increased expression of RPS27L mRNA	CTD	PMID:25596134
Rps27l	Rat	aflatoxin B1	increases expression	EXP		6480464	Aflatoxin B1 results in increased expression of RPS27L mRNA	CTD	PMID:15890375\|PMID:25378103\|PMID:33354967
Rps27l	Rat	aflatoxin B1	increases expression	ISO	RGD:1344574	6480464	Aflatoxin B1 results in increased expression of RPS27L mRNA	CTD	PMID:22100608
Rps27l	Rat	alpha-pinene	multiple interactions	ISO	RGD:1344574	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of more ...	CTD	PMID:32699268
Rps27l	Rat	alpha-Zearalanol	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] affects the expression of RPS27L mRNA	CTD	PMID:35163327
Rps27l	Rat	amitrole	increases expression	EXP		6480464	Amitrole results in increased expression of RPS27L mRNA	CTD	PMID:30047161
Rps27l	Rat	ammonium chloride	affects expression	EXP		6480464	Ammonium Chloride affects the expression of RPS27L mRNA	CTD	PMID:16483693
Rps27l	Rat	ampicillin	multiple interactions	EXP		6480464	[Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in more ...	CTD	PMID:30545405
Rps27l	Rat	aristolochic acid A	decreases expression	ISO	RGD:1344574	6480464	aristolochic acid I results in decreased expression of RPS27L protein	CTD	PMID:33212167
Rps27l	Rat	arsenite(3-)	multiple interactions	ISO	RGD:1344574	6480464	arsenite promotes the reaction [G3BP1 protein binds to RPS27L mRNA]	CTD	PMID:32406909
Rps27l	Rat	azoxystrobin	increases expression	ISO	RGD:1344574	6480464	azoxystrobin results in increased expression of RPS27L mRNA	CTD	PMID:33512557
Rps27l	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1344574	6480464	Benzo(a)pyrene results in increased expression of RPS27L mRNA	CTD	PMID:20106945\|PMID:21632981\|PMID:22316170
Rps27l	Rat	benzo[a]pyrene	multiple interactions	ISO	RGD:1621531	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ...	CTD	PMID:27858113
Rps27l	Rat	benzo[a]pyrene	increases expression	ISO	RGD:1621531	6480464	Benzo(a)pyrene results in increased expression of RPS27L mRNA	CTD	PMID:19770486\|PMID:21964900\|PMID:22610609
Rps27l	Rat	benzo[a]pyrene diol epoxide I	increases expression	ISO	RGD:1344574	6480464	7,8-Dihydro-7,8-dihydroxybenzo(a)pyrene 9,10-oxide results in increased expression of RPS27L mRNA	CTD	PMID:19150397
Rps27l	Rat	benzo[b]fluoranthene	increases expression	ISO	RGD:1621531	6480464	benzo(b)fluoranthene results in increased expression of RPS27L mRNA	CTD	PMID:26377693
Rps27l	Rat	benzo[b]fluoranthene	multiple interactions	ISO	RGD:1621531	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ...	CTD	PMID:27858113
Rps27l	Rat	beta-lapachone	increases expression	ISO	RGD:1344574	6480464	beta-lapachone results in increased expression of RPS27L mRNA	CTD	PMID:38218311
Rps27l	Rat	bis(2-chloroethyl) sulfide	increases expression	ISO	RGD:1344574	6480464	Mustard Gas results in increased expression of RPS27L mRNA	CTD	PMID:25102026
Rps27l	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	RGD:1344574	6480464	Diethylhexyl Phthalate results in increased expression of RPS27L mRNA	CTD	PMID:31163220
Rps27l	Rat	bis(2-ethylhexyl) phthalate	increases expression	ISO	RGD:1621531	6480464	Diethylhexyl Phthalate results in increased expression of RPS27L mRNA	CTD	PMID:33754040
Rps27l	Rat	bis(2-ethylhexyl) phthalate	decreases expression	ISO	RGD:1621531	6480464	Diethylhexyl Phthalate results in decreased expression of RPS27L mRNA	CTD	PMID:35550907
Rps27l	Rat	bisphenol A	increases expression	ISO	RGD:1344574	6480464	bisphenol A results in increased expression of RPS27L mRNA	CTD	PMID:20678512\|PMID:33670352
Rps27l	Rat	bisphenol A	increases expression	ISO	RGD:1621531	6480464	bisphenol A results in increased expression of RPS27L mRNA	CTD	PMID:32156529\|PMID:38074096
Rps27l	Rat	bisphenol A	decreases expression	ISO	RGD:1344574	6480464	bisphenol A results in decreased expression of RPS27L protein	CTD	PMID:33376534
Rps27l	Rat	bisphenol A	affects expression	ISO	RGD:1344574	6480464	bisphenol A affects the expression of RPS27L mRNA	CTD	PMID:30903817
Rps27l	Rat	bisphenol A	increases expression	EXP		6480464	bisphenol A results in increased expression of RPS27L mRNA	CTD	PMID:25181051\|PMID:32145629
Rps27l	Rat	bisphenol AF	increases expression	ISO	RGD:1344574	6480464	bisphenol AF results in increased expression of RPS27L protein	CTD	PMID:34186270
Rps27l	Rat	Bisphenol B	increases expression	ISO	RGD:1344574	6480464	bisphenol B results in increased expression of RPS27L protein	CTD	PMID:34186270
Rps27l	Rat	bisphenol F	increases expression	ISO	RGD:1344574	6480464	bisphenol F results in increased expression of RPS27L protein	CTD	PMID:34186270
Rps27l	Rat	cadmium atom	multiple interactions	ISO	RGD:1344574	6480464	2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ...	CTD	PMID:35301059\|PMID:38195004
Rps27l	Rat	cadmium dichloride	affects expression	ISO	RGD:1344574	6480464	Cadmium Chloride affects the expression of RPS27L mRNA	CTD	PMID:25596134
Rps27l	Rat	cadmium dichloride	multiple interactions	ISO	RGD:1344574	6480464	2-bromopalmitate inhibits the reaction [[Cadmium Chloride results in increased abundance of Cadmium] which results in more ...	CTD	PMID:35301059\|PMID:38195004
Rps27l	Rat	carbamazepine	affects expression	ISO	RGD:1344574	6480464	Carbamazepine affects the expression of RPS27L mRNA	CTD	PMID:25979313
Rps27l	Rat	carbon nanotube	increases expression	ISO	RGD:1621531	6480464	Nanotubes, Carbon results in increased expression of RPS27L mRNA	CTD	PMID:25554681
Rps27l	Rat	chloroacetaldehyde	affects expression	ISO	RGD:1344574	6480464	chloroacetaldehyde affects the expression of RPS27L mRNA	CTD	PMID:25596134
Rps27l	Rat	chloropicrin	increases expression	ISO	RGD:1344574	6480464	chloropicrin results in increased expression of RPS27L mRNA	CTD	PMID:26352163
Rps27l	Rat	chrysene	multiple interactions	ISO	RGD:1621531	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ...	CTD	PMID:27858113
Rps27l	Rat	cidofovir anhydrous	increases expression	ISO	RGD:1344574	6480464	Cidofovir results in increased expression of RPS27L mRNA	CTD	PMID:25596134
Rps27l	Rat	cisplatin	affects expression	ISO	RGD:1344574	6480464	Cisplatin affects the expression of RPS27L mRNA	CTD	PMID:23300844
Rps27l	Rat	cisplatin	increases expression	ISO	RGD:1344574	6480464	Cisplatin results in increased expression of RPS27L mRNA	CTD	PMID:21532991\|PMID:25596134\|PMID:27392435
Rps27l	Rat	clobetasol	increases expression	ISO	RGD:1621531	6480464	Clobetasol results in increased expression of RPS27L mRNA	CTD	PMID:27462272
Rps27l	Rat	clotrimazole	increases expression	EXP		6480464	Clotrimazole results in increased expression of RPS27L mRNA	CTD	PMID:30047161
Rps27l	Rat	copper(II) sulfate	decreases expression	ISO	RGD:1344574	6480464	Copper Sulfate results in decreased expression of RPS27L mRNA	CTD	PMID:19549813
Rps27l	Rat	crocidolite asbestos	increases expression	ISO	RGD:1344574	6480464	Asbestos, Crocidolite results in increased expression of RPS27L mRNA	CTD	PMID:29523930
Rps27l	Rat	Cuprizon	increases expression	EXP		6480464	Cuprizone results in increased expression of RPS27L mRNA	CTD	PMID:27523638
Rps27l	Rat	cycloheximide	multiple interactions	ISO	RGD:1344574	6480464	[Tetrachlorodibenzodioxin co-treated with Cycloheximide] results in increased expression of RPS27L mRNA	CTD	PMID:19684285
Rps27l	Rat	cyclosporin A	increases expression	ISO	RGD:1344574	6480464	Cyclosporine results in increased expression of RPS27L mRNA	CTD	PMID:25596134
Rps27l	Rat	cyclosporin A	decreases expression	ISO	RGD:1344574	6480464	Cyclosporine results in decreased expression of RPS27L mRNA	CTD	PMID:25562108
Rps27l	Rat	dibenz[a,h]anthracene	increases expression	ISO	RGD:1621531	6480464	1,2,5,6-dibenzanthracene results in increased expression of RPS27L mRNA	CTD	PMID:26377693
Rps27l	Rat	dibutyl phthalate	decreases expression	ISO	RGD:1621531	6480464	Dibutyl Phthalate results in decreased expression of RPS27L mRNA	CTD	PMID:21266533
Rps27l	Rat	dicrotophos	decreases expression	ISO	RGD:1344574	6480464	dicrotophos results in decreased expression of RPS27L mRNA	CTD	PMID:28302478
Rps27l	Rat	diethylstilbestrol	increases expression	EXP		6480464	Diethylstilbestrol results in increased expression of RPS27L mRNA	CTD	PMID:15890375
Rps27l	Rat	dioxygen	increases expression	EXP		6480464	Oxygen results in increased expression of RPS27L mRNA	CTD	PMID:22911455
Rps27l	Rat	dioxygen	multiple interactions	ISO	RGD:1621531	6480464	[NFE2L2 protein affects the susceptibility to Oxygen] which affects the expression of RPS27L mRNA	CTD	PMID:30529165
Rps27l	Rat	dioxygen	decreases expression	ISO	RGD:1344574	6480464	Oxygen deficiency results in decreased expression of RPS27L mRNA	CTD	PMID:25596134
Rps27l	Rat	diuron	decreases expression	ISO	RGD:1344574	6480464	Diuron results in decreased expression of RPS27L mRNA	CTD	PMID:35967413
Rps27l	Rat	dorsomorphin	multiple interactions	ISO	RGD:1344574	6480464	[NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Rps27l	Rat	doxorubicin	increases expression	ISO	RGD:1344574	6480464	Doxorubicin results in increased expression of RPS27L protein	CTD	PMID:18056458
Rps27l	Rat	doxorubicin	affects expression	ISO	RGD:1344574	6480464	Doxorubicin affects the expression of RPS27L mRNA	CTD	PMID:25529476
Rps27l	Rat	doxorubicin	increases expression	ISO	RGD:1621531	6480464	Doxorubicin results in increased expression of RPS27L mRNA	CTD	PMID:19277126
Rps27l	Rat	elemental selenium	decreases expression	ISO	RGD:1344574	6480464	Selenium results in decreased expression of RPS27L mRNA	CTD	PMID:19244175
Rps27l	Rat	epoxiconazole	increases expression	ISO	RGD:1621531	6480464	epoxiconazole results in increased expression of RPS27L mRNA	CTD	PMID:35436446
Rps27l	Rat	ethyl methanesulfonate	increases expression	ISO	RGD:1344574	6480464	Ethyl Methanesulfonate results in increased expression of RPS27L mRNA	CTD	PMID:23649840
Rps27l	Rat	etoposide	increases expression	ISO	RGD:1344574	6480464	Etoposide results in increased expression of RPS27L protein	CTD	PMID:18056458
Rps27l	Rat	fenthion	increases expression	ISO	RGD:1621531	6480464	Fenthion results in increased expression of RPS27L mRNA	CTD	PMID:34813904
Rps27l	Rat	fipronil	decreases expression	EXP		6480464	fipronil results in decreased expression of RPS27L mRNA	CTD	PMID:34044035
Rps27l	Rat	folic acid	multiple interactions	ISO	RGD:1621531	6480464	[1,2-Dimethylhydrazine co-treated with Folic Acid] results in decreased expression of RPS27L mRNA	CTD	PMID:22206623
Rps27l	Rat	formaldehyde	increases expression	ISO	RGD:1344574	6480464	Formaldehyde results in increased expression of RPS27L mRNA	CTD	PMID:23649840
Rps27l	Rat	gentamycin	multiple interactions	EXP		6480464	[Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in more ...	CTD	PMID:30545405
Rps27l	Rat	glyphosate	increases expression	ISO	RGD:1621531	6480464	Glyphosate results in increased expression of RPS27L protein	CTD	PMID:36173347
Rps27l	Rat	gold atom	decreases expression	ISO	RGD:1344574	6480464	Gold results in decreased expression of RPS27L mRNA	CTD	PMID:25523186
Rps27l	Rat	gold(0)	decreases expression	ISO	RGD:1344574	6480464	Gold results in decreased expression of RPS27L mRNA	CTD	PMID:25523186
Rps27l	Rat	ifosfamide	increases expression	ISO	RGD:1344574	6480464	Ifosfamide results in increased expression of RPS27L mRNA	CTD	PMID:25596134
Rps27l	Rat	ivermectin	decreases expression	ISO	RGD:1344574	6480464	Ivermectin results in decreased expression of RPS27L protein	CTD	PMID:32959892
Rps27l	Rat	mercury dibromide	increases expression	ISO	RGD:1344574	6480464	mercuric bromide results in increased expression of RPS27L mRNA	CTD	PMID:26272509
Rps27l	Rat	mercury dibromide	multiple interactions	ISO	RGD:1344574	6480464	[NOG protein co-treated with mercuric bromide co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Rps27l	Rat	methapyrilene	increases expression	EXP		6480464	Methapyrilene results in increased expression of RPS27L mRNA	CTD	PMID:15890375
Rps27l	Rat	methidathion	increases expression	ISO	RGD:1621531	6480464	methidathion results in increased expression of RPS27L mRNA	CTD	PMID:34813904
Rps27l	Rat	methimazole	increases expression	EXP		6480464	Methimazole results in increased expression of RPS27L mRNA	CTD	PMID:30047161
Rps27l	Rat	methyl methanesulfonate	increases expression	ISO	RGD:1344574	6480464	Methyl Methanesulfonate results in increased expression of RPS27L mRNA	CTD	PMID:23649840
Rps27l	Rat	metronidazole	multiple interactions	EXP		6480464	[Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in more ...	CTD	PMID:30545405
Rps27l	Rat	monosodium L-glutamate	multiple interactions	ISO	RGD:1621531	6480464	[Trans Fatty Acids co-treated with Sodium Glutamate] results in increased expression of RPS27L mRNA	CTD	PMID:22078008
Rps27l	Rat	N-nitrosodiethylamine	increases expression	EXP		6480464	Diethylnitrosamine results in increased expression of RPS27L mRNA	CTD	PMID:20360939
Rps27l	Rat	N-nitrosodimethylamine	increases expression	EXP		6480464	Dimethylnitrosamine results in increased expression of RPS27L mRNA	CTD	PMID:15890375
Rps27l	Rat	neomycin	multiple interactions	EXP		6480464	[Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in more ...	CTD	PMID:30545405
Rps27l	Rat	nitrates	multiple interactions	ISO	RGD:1621531	6480464	[Particulate Matter results in increased abundance of Nitrates] which results in increased expression of RPS27L more ...	CTD	PMID:35964746
Rps27l	Rat	ozone	multiple interactions	ISO	RGD:1344574	6480464	[Acrolein co-treated with methacrylaldehyde co-treated with alpha-pinene co-treated with Ozone] results in increased expression of more ...	CTD	PMID:32699268
Rps27l	Rat	ozone	multiple interactions	ISO	RGD:1621531	6480464	[Air Pollutants results in increased abundance of [Ozone co-treated with Soot]] which results in increased more ...	CTD	PMID:34911549
Rps27l	Rat	paracetamol	decreases expression	ISO	RGD:1344574	6480464	Acetaminophen results in decreased expression of RPS27L mRNA	CTD	PMID:21420995
Rps27l	Rat	paraquat	increases expression	EXP		6480464	Paraquat results in increased expression of RPS27L mRNA	CTD	PMID:32680482
Rps27l	Rat	perfluorooctane-1-sulfonic acid	multiple interactions	ISO	RGD:1621531	6480464	[perfluorooctane sulfonic acid co-treated with Cellulose] results in increased expression of RPS27L mRNA; [perfluorooctane sulfonic more ...	CTD	PMID:36331819
Rps27l	Rat	perfluorooctanoic acid	multiple interactions	EXP		6480464	[Zeranol co-treated with perfluorooctanoic acid] affects the expression of RPS27L mRNA	CTD	PMID:35163327
Rps27l	Rat	phenobarbital	affects expression	ISO	RGD:1344574	6480464	Phenobarbital affects the expression of RPS27L mRNA	CTD	PMID:19159669
Rps27l	Rat	phenylmercury acetate	increases expression	ISO	RGD:1344574	6480464	Phenylmercuric Acetate results in increased expression of RPS27L mRNA	CTD	PMID:26272509
Rps27l	Rat	phenylmercury acetate	multiple interactions	ISO	RGD:1344574	6480464	[NOG protein co-treated with Phenylmercuric Acetate co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Rps27l	Rat	picoxystrobin	increases expression	ISO	RGD:1344574	6480464	picoxystrobin results in increased expression of RPS27L mRNA	CTD	PMID:33512557
Rps27l	Rat	piperonyl butoxide	increases expression	EXP		6480464	Piperonyl Butoxide results in increased expression of RPS27L mRNA	CTD	PMID:15890375
Rps27l	Rat	pirinixic acid	increases expression	EXP		6480464	pirinixic acid results in increased expression of RPS27L mRNA	CTD	PMID:15890375
Rps27l	Rat	potassium bromate	increases expression	ISO	RGD:1344574	6480464	potassium bromate results in increased expression of RPS27L mRNA	CTD	PMID:30559759
Rps27l	Rat	propiconazole	increases expression	ISO	RGD:1621531	6480464	propiconazole results in increased expression of RPS27L mRNA	CTD	PMID:21278054
Rps27l	Rat	pyrimidifen	increases expression	ISO	RGD:1344574	6480464	pyrimidifen results in increased expression of RPS27L mRNA	CTD	PMID:33512557
Rps27l	Rat	rac-lactic acid	increases expression	ISO	RGD:1344574	6480464	Lactic Acid results in increased expression of RPS27L mRNA	CTD	PMID:30851411
Rps27l	Rat	rotenone	increases expression	ISO	RGD:1344574	6480464	Rotenone results in increased expression of RPS27L mRNA	CTD	PMID:33512557
Rps27l	Rat	SB 431542	multiple interactions	ISO	RGD:1344574	6480464	[LDN 193189 co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide co-treated with FGF2 protein] results in increased expression of RPS27L more ...	CTD	PMID:27188386\|PMID:37664457
Rps27l	Rat	selenium atom	decreases expression	ISO	RGD:1344574	6480464	Selenium results in decreased expression of RPS27L mRNA	CTD	PMID:19244175
Rps27l	Rat	sirolimus	multiple interactions	ISO	RGD:1344574	6480464	Sirolimus promotes the reaction [TP73 protein binds to RPS27L promoter]	CTD	PMID:21245298
Rps27l	Rat	sodium arsenite	increases expression	ISO	RGD:1344574	6480464	sodium arsenite results in increased expression of RPS27L mRNA	CTD	PMID:38568856
Rps27l	Rat	sodium arsenite	decreases expression	ISO	RGD:1344574	6480464	sodium arsenite results in decreased expression of RPS27L protein	CTD	PMID:30528433
Rps27l	Rat	succimer	multiple interactions	ISO	RGD:1344574	6480464	[Succimer co-treated with Magnetite Nanoparticles] affects the expression of RPS27L mRNA	CTD	PMID:26378955
Rps27l	Rat	sulfadimethoxine	increases expression	EXP		6480464	Sulfadimethoxine results in increased expression of RPS27L mRNA	CTD	PMID:30047161
Rps27l	Rat	sunitinib	increases expression	ISO	RGD:1344574	6480464	Sunitinib results in increased expression of RPS27L mRNA	CTD	PMID:31533062
Rps27l	Rat	tamoxifen	affects expression	ISO	RGD:1621531	6480464	Tamoxifen affects the expression of RPS27L mRNA	CTD	PMID:17555576
Rps27l	Rat	tert-butyl hydroperoxide	increases expression	ISO	RGD:1344574	6480464	tert-Butylhydroperoxide results in increased expression of RPS27L mRNA	CTD	PMID:15336504
Rps27l	Rat	testosterone	decreases expression	ISO	RGD:1344574	6480464	Testosterone results in decreased expression of RPS27L mRNA	CTD	PMID:33359661
Rps27l	Rat	tetrachloromethane	decreases expression	EXP		6480464	Carbon Tetrachloride results in decreased expression of RPS27L mRNA	CTD	PMID:33387578
Rps27l	Rat	tetraphene	multiple interactions	ISO	RGD:1621531	6480464	[Benzo(a)pyrene co-treated with benz(a)anthracene co-treated with benzo(b)fluoranthene co-treated with chrysene] results in increased expression of more ...	CTD	PMID:27858113
Rps27l	Rat	thapsigargin	increases expression	ISO	RGD:1344574	6480464	Thapsigargin results in increased expression of RPS27L mRNA	CTD	PMID:22378314
Rps27l	Rat	thimerosal	increases expression	ISO	RGD:1344574	6480464	Thimerosal results in increased expression of RPS27L mRNA	CTD	PMID:27188386
Rps27l	Rat	thioacetamide	increases expression	EXP		6480464	Thioacetamide results in increased expression of RPS27L mRNA	CTD	PMID:34492290
Rps27l	Rat	titanium dioxide	affects expression	ISO	RGD:1621531	6480464	titanium dioxide affects the expression of RPS27L mRNA	CTD	PMID:17656681
Rps27l	Rat	titanium dioxide	increases methylation	ISO	RGD:1621531	6480464	titanium dioxide results in increased methylation of RPS27L gene	CTD	PMID:35295148
Rps27l	Rat	titanium dioxide	decreases methylation	ISO	RGD:1621531	6480464	titanium dioxide results in decreased methylation of RPS27L promoter	CTD	PMID:35295148
Rps27l	Rat	triptonide	decreases expression	ISO	RGD:1621531	6480464	triptonide results in decreased expression of RPS27L mRNA	CTD	PMID:33045310
Rps27l	Rat	trovafloxacin	increases expression	ISO	RGD:1621531	6480464	trovafloxacin results in increased expression of RPS27L mRNA	CTD	PMID:35537566
Rps27l	Rat	tungsten	increases expression	ISO	RGD:1621531	6480464	Tungsten results in increased expression of RPS27L mRNA	CTD	PMID:30912803
Rps27l	Rat	tunicamycin	increases expression	ISO	RGD:1344574	6480464	Tunicamycin results in increased expression of RPS27L mRNA	CTD	PMID:22378314
Rps27l	Rat	urethane	decreases expression	ISO	RGD:1344574	6480464	Urethane results in decreased expression of RPS27L mRNA	CTD	PMID:28818685
Rps27l	Rat	ursodeoxycholic acid	affects expression	ISO	RGD:1344574	6480464	Ursodeoxycholic Acid affects the expression of RPS27L mRNA	CTD	PMID:18422935
Rps27l	Rat	valproic acid	affects expression	ISO	RGD:1344574	6480464	Valproic Acid affects the expression of RPS27L mRNA	CTD	PMID:25979313
Rps27l	Rat	valproic acid	increases expression	ISO	RGD:1344574	6480464	Valproic Acid results in increased expression of RPS27L mRNA	CTD	PMID:19101580\|PMID:23179753\|PMID:24935251\|PMID:26272509\|PMID:27188386
Rps27l	Rat	valproic acid	multiple interactions	ISO	RGD:1344574	6480464	[NOG protein co-treated with Valproic Acid co-treated with dorsomorphin co-treated with 4-(5-benzo(1,3)dioxol-5-yl-4-pyridin-2-yl-1H-imidazol-2-yl)benzamide] results in increased more ...	CTD	PMID:27188386
Rps27l	Rat	vancomycin	multiple interactions	EXP		6480464	[Ampicillin co-treated with Neomycin co-treated with Gentamicins co-treated with Metronidazole co-treated with Vancomycin] results in more ...	CTD	PMID:30545405
Rps27l	Rat	vincristine	increases expression	ISO	RGD:1344574	6480464	Vincristine results in increased expression of RPS27L mRNA	CTD	PMID:23649840
Rps27l	Rat	vorinostat	increases expression	ISO	RGD:1344574	6480464	vorinostat results in increased expression of RPS27L mRNA	CTD	PMID:27188386

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rps27l	Rat	biological_process		ND		1598407	03/2016: no relevant rat data	RGD
Rps27l	Rat	DNA damage response, signal transduction by p53 class mediator	involved_in	ISO	RGD:1344574	1624291	PMID:18056458	RGD	PMID:18056458
Rps27l	Rat	DNA damage response, signal transduction by p53 class mediator	involved_in	IEA	UniProtKB:Q71UM5\|ensembl:ENSP00000331019	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rps27l	Rat	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	involved_in	ISO	RGD:1344574	1624291	PMID:17057733, PMID:18056458	RGD	PMID:17057733\|PMID:18056458
Rps27l	Rat	intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	involved_in	IEA	UniProtKB:Q71UM5\|ensembl:ENSP00000331019	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rps27l	Rat	mitotic G1 DNA damage checkpoint signaling	involved_in	ISO	RGD:1344574	1624291	PMID:18056458	RGD	PMID:18056458
Rps27l	Rat	mitotic G1 DNA damage checkpoint signaling	involved_in	IEA	UniProtKB:Q71UM5\|ensembl:ENSP00000331019	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rps27l	Rat	positive regulation of translation	involved_in	ISO	RGD:1344574	1624291	PMID:18056458	RGD	PMID:18056458
Rps27l	Rat	positive regulation of translation	involved_in	IEA	UniProtKB:Q71UM5\|ensembl:ENSP00000331019	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rps27l	Rat	ribosomal small subunit assembly	involved_in	IBA	PANTHER:PTN000174285\|SGD:S000001063\|SGD:S000001639	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Rps27l	Rat	translation	involved_in	IEA	InterPro:IPR000592\|InterPro:IPR011332	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Cellular Component

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rps27l	Rat	cytosol	located_in	IEA	ARBA:ARBA00029243	1600115	GO_REF:0000117	UniProt	GO_REF:0000117
Rps27l	Rat	cytosolic small ribosomal subunit	part_of	IBA	MGI:1888676\|PANTHER:PTN000174285\|RGD:621045\|SGD:S000001063\|SGD:S000001639\|UniProtKB:P42677\|UniProtKB:Q8IEN2	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Rps27l	Rat	nucleus	located_in	IEA	UniProtKB:Q71UM5\|ensembl:ENSP00000331019	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rps27l	Rat	nucleus	located_in	ISO	RGD:1344574	1624291	PMID:18056458	RGD	PMID:18056458
Rps27l	Rat	ribonucleoprotein complex	part_of	IEA	UniProtKB-KW:KW-0687	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Rps27l	Rat	ribosome	located_in	IEA	UniProtKB-KW:KW-0689	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Rps27l	Rat	ribosome	located_in	IEA	InterPro:IPR000592	1600115	GO_REF:0000002	InterPro	GO_REF:0000002

Molecular Function

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rps27l	Rat	metal ion binding	enables	IEA	UniProtKB-KW:KW-0479	1600115	GO_REF:0000043	UniProt	GO_REF:0000043
Rps27l	Rat	protein binding	enables	ISO	RGD:1344574	1624291	UniProtKB:Q00987 PMID:21170087	RGD	PMID:21170087
Rps27l	Rat	RNA binding	enables	IBA	PANTHER:PTN000174285\|TAIR:locus:2050756\|TAIR:locus:2098821\|TAIR:locus:2152773	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Rps27l	Rat	structural constituent of ribosome	enables	IEA	InterPro:IPR000592	1600115	GO_REF:0000002	InterPro	GO_REF:0000002
Rps27l	Rat	structural constituent of ribosome	enables	IBA	FB:FBgn0039300\|MGI:1888676\|PANTHER:PTN000174285\|SGD:S000001063\|SGD:S000001639\|UniProtKB:P42677\|UniProtKB:Q8IEN2	1600115	GO_REF:0000033	GO_Central	GO_REF:0000033
Rps27l	Rat	translation activator activity	enables	ISO	RGD:1344574	1624291	PMID:18056458	RGD	PMID:18056458
Rps27l	Rat	translation activator activity	enables	IEA	UniProtKB:Q71UM5\|ensembl:ENSP00000331019	1600115	GO_REF:0000107	Ensembl	GO_REF:0000107
Rps27l	Rat	zinc ion binding	enables	IEA	UniProtKB-KW:KW-0863	1600115	GO_REF:0000043	UniProt	GO_REF:0000043

Molecular Pathway Annotations Click to see Annotation Detail View

RGD Manual Annotations

Only show annotations with direct experimental evidence (0 objects hidden)

Object Symbol	Species	Term	Qualifier	Evidence	With	Reference	Notes	Source	Original Reference(s)
Rps27l	Rat	ribosome biogenesis pathway		ISO	RGD:1344574	10002730		RGD

Disease Annotations Click to see Annotation Detail View

Bloom syndrome (ISO)

colorectal cancer (ISO)

hypertrophic cardiomyopathy (ISO)

nemaline myopathy 6 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-demecolcine (ISO)

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (EXP,ISO)

17alpha-ethynylestradiol (ISO)

17beta-estradiol (EXP,ISO)

17beta-hydroxy-17-methylestra-4,9,11-trien-3-one (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (ISO)

2,4-dibromophenyl 2,4,5-tribromophenyl ether (ISO)

2-acetamidofluorene (ISO)

2-bromohexadecanoic acid (ISO)

2-hydroxypropanoic acid (ISO)

2-methylcholine (ISO)

2-nitrofluorene (EXP)

4,4'-diaminodiphenylmethane (ISO)

4,4'-sulfonyldiphenol (ISO)

4-(N-nitrosomethylamino)-1-(3-pyridyl)butan-1-one (EXP)

4-hydroxyphenyl retinamide (ISO)

5-aza-2'-deoxycytidine (ISO)

5-fluorouracil (ISO)

6-propyl-2-thiouracil (EXP)

acrolein (ISO)

adefovir pivoxil (ISO)

aflatoxin B1 (EXP,ISO)

alpha-pinene (ISO)

alpha-Zearalanol (EXP)

amitrole (EXP)

ammonium chloride (EXP)

ampicillin (EXP)

aristolochic acid A (ISO)

arsenite(3-) (ISO)

azoxystrobin (ISO)

benzo[a]pyrene (ISO)

benzo[a]pyrene diol epoxide I (ISO)

benzo[b]fluoranthene (ISO)

beta-lapachone (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol AF (ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

cadmium atom (ISO)

cadmium dichloride (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chloroacetaldehyde (ISO)

chloropicrin (ISO)

chrysene (ISO)

cidofovir anhydrous (ISO)

cisplatin (ISO)

clobetasol (ISO)

clotrimazole (EXP)

copper(II) sulfate (ISO)

crocidolite asbestos (ISO)

Cuprizon (EXP)

cycloheximide (ISO)

cyclosporin A (ISO)

dibenz[a,h]anthracene (ISO)

dibutyl phthalate (ISO)

dicrotophos (ISO)

diethylstilbestrol (EXP)

dioxygen (EXP,ISO)

diuron (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

elemental selenium (ISO)

epoxiconazole (ISO)

ethyl methanesulfonate (ISO)

etoposide (ISO)

fenthion (ISO)

fipronil (EXP)

folic acid (ISO)

formaldehyde (ISO)

gentamycin (EXP)

glyphosate (ISO)

gold atom (ISO)

gold(0) (ISO)

ifosfamide (ISO)

ivermectin (ISO)

mercury dibromide (ISO)

methapyrilene (EXP)

methidathion (ISO)

methimazole (EXP)

methyl methanesulfonate (ISO)

metronidazole (EXP)

monosodium L-glutamate (ISO)

N-nitrosodiethylamine (EXP)

N-nitrosodimethylamine (EXP)

neomycin (EXP)

nitrates (ISO)

ozone (ISO)

paracetamol (ISO)

paraquat (EXP)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenobarbital (ISO)

phenylmercury acetate (ISO)

picoxystrobin (ISO)

piperonyl butoxide (EXP)

pirinixic acid (EXP)

potassium bromate (ISO)

propiconazole (ISO)

pyrimidifen (ISO)

rac-lactic acid (ISO)

rotenone (ISO)

SB 431542 (ISO)

selenium atom (ISO)

sirolimus (ISO)

sodium arsenite (ISO)

succimer (ISO)

sulfadimethoxine (EXP)

sunitinib (ISO)

tamoxifen (ISO)

tert-butyl hydroperoxide (ISO)

testosterone (ISO)

tetrachloromethane (EXP)

tetraphene (ISO)

thapsigargin (ISO)

thimerosal (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

triptonide (ISO)

trovafloxacin (ISO)

tungsten (ISO)

tunicamycin (ISO)

urethane (ISO)

ursodeoxycholic acid (ISO)

valproic acid (ISO)

vancomycin (EXP)

vincristine (ISO)

vorinostat (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

biological_process (ND)

DNA damage response, signal transduction by p53 class mediator (IEA,ISO)

intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator (IEA,ISO)

mitotic G1 DNA damage checkpoint signaling (IEA,ISO)

positive regulation of translation (IEA,ISO)

ribosomal small subunit assembly (IBA)

translation (IEA)

Cellular Component

cytosol (IEA)

cytosolic small ribosomal subunit (IBA)

nucleus (IEA,ISO)

ribonucleoprotein complex (IEA)

ribosome (IEA)

Molecular Function

metal ion binding (IEA)

protein binding (ISO)

RNA binding (IBA)

structural constituent of ribosome (IBA,IEA)

translation activator activity (IEA,ISO)

zinc ion binding (IEA)

Molecular Pathway Annotations Click to see Annotation Detail View

ribosome biogenesis pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Functional dichotomy of ribosomal proteins during the synthesis of mammalian 40S ribosomal subunits.	O'Donohue MF, etal., J Cell Biol. 2010 Sep 6;190(5):853-66. doi: 10.1083/jcb.201005117.
3.	GOA pipeline	RGD automated data pipeline
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
5.	Comprehensive gene review and curation	RGD comprehensive gene curation

Additional References at PubMed

PMID:8441676	PMID:10820185	PMID:17057733	PMID:18056458	PMID:22681889	PMID:29351317	PMID:30053369

Genomics

Comparative Map Data

Rps27l
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	8	76,443,658 - 76,448,593 (+)	NCBI		GRCr8
mRatBN7.2	8	67,562,483 - 67,567,418 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	12	28,077,660 - 28,078,131 (-)	Ensembl		mRatBN7.2 Ensembl
mRatBN7.2 Ensembl	2	175,665,853 - 175,666,964 (-)	Ensembl		mRatBN7.2 Ensembl
mRatBN7.2 Ensembl	8	67,562,483 - 67,567,418 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	8	73,093,976 - 73,098,907 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	8	71,366,913 - 71,371,844 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	8	69,204,219 - 69,209,154 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	8	72,741,155 - 72,746,090 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	8	72,741,155 - 72,746,090 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	8	77,073,998 - 77,078,933 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	8	74,137,257 - 74,142,218 (-)	NCBI		Celera
Cytogenetic Map	8	q24	NCBI

RPS27L
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	15	63,148,249 - 63,157,477 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	15	63,125,872 - 63,158,021 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	15	63,440,448 - 63,449,676 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	15	61,232,592 - 61,236,794 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	15	61,233,107 - 61,236,729	NCBI
Celera	15	40,325,147 - 40,329,349 (-)	NCBI		Celera
Cytogenetic Map	15	q22.2	NCBI
HuRef	15	40,268,657 - 40,272,853 (-)	NCBI		HuRef
CHM1_1	15	63,564,673 - 63,568,874 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	15	60,953,106 - 60,962,258 (-)	NCBI		T2T-CHM13v2.0

Rps27l
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	9	66,851,906 - 66,856,804 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	9	66,853,368 - 66,856,798 (+)	Ensembl		GRCm39 Ensembl
GRCm38	9	66,944,624 - 66,949,522 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	9	66,946,086 - 66,949,516 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	9	66,793,925 - 66,797,316 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	9	66,745,262 - 66,748,655 (+)	NCBI		MGSCv36	mm8
Celera	9	64,180,409 - 64,183,785 (+)	NCBI		Celera
Cytogenetic Map	9	C	NCBI
cM Map	9	36.23	NCBI

Rps27l
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955450	12,122,921 - 12,128,101 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955450	12,122,948 - 12,126,167 (+)	NCBI	ChiLan1.0	ChiLan1.0

RPS27L
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	16	52,402,601 - 52,407,717 (-)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	15	56,578,703 - 56,582,602 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	15	42,101,137 - 42,105,019 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	15	60,396,958 - 60,400,643 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	15	60,397,131 - 60,400,643 (-)	Ensembl	panpan1.1		panPan2

RPS27L
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	30	27,749,297 - 27,753,226 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
Dog10K_Boxer_Tasha	30	27,668,372 - 27,672,404 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	30	27,920,981 - 27,924,986 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	30	27,920,981 - 27,924,817 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	30	27,858,338 - 27,862,334 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	30	27,920,185 - 27,924,108 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	30	28,164,299 - 28,168,322 (-)	NCBI		UU_Cfam_GSD_1.0

Rps27l
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	105,890,833 - 105,894,159 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936471	23,738,823 - 23,745,382 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936471	23,738,896 - 23,742,355 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

RPS27L
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	108,881,552 - 108,890,283 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	108,881,330 - 108,886,334 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	120,104,580 - 120,109,584 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

RPS27L
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	26	20,385,684 - 20,389,351 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
Vero_WHO_p1.0	NW_023666048	121,010,771 - 121,014,944 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Rps27l
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624781	9,347,790 - 9,352,368 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624781	9,348,549 - 9,351,631 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Rps27l
39 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	12
Count of miRNA genes:	11
Interacting mature miRNAs:	12
Transcripts:	ENSRNOT00000072573
Prediction methods:	Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1298065	Scl16	Serum cholesterol level QTL 16	3.8		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30856404	75856404	Rat
1554321	Bmd3	Bone mineral density QTL 3	7.9	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	8	40952565	123900184	Rat
1578769	Uae31	Urinary albumin excretion QTL 31	3.3	0.001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	30848154	101699754	Rat
1298079	Activ2	Activity QTL 2	9.5	0.000001	voluntary movement trait (VT:0003491)	rearing measurement (CMO:0001515)	8	41866876	86866876	Rat
70161	Bp62	Blood pressure QTL 62	2.9	0.001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	42692684	90165460	Rat
1578765	Klgr1	Kidney lesion grade QTL 1	3.3	0.0001	kidney morphology trait (VT:0002135)	organ lesion measurement (CMO:0000677)	8	30848154	101699754	Rat
1582222	Epfw2	Epididymal fat weight QTL 2	3.2	0.0005	epididymal fat pad mass (VT:0010421)	epididymal fat pad weight to body weight ratio (CMO:0000658)	8	31737729	76737729	Rat
61464	Niddm11	Non-insulin dependent diabetes mellitus QTL 11	3.1	0.001	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	35582032	80582032	Rat
4889938	Bss89	Bone structure and strength QTL 89	3.8		tibia size trait (VT:0100001)	tibia cortical bone volume (CMO:0001725)	8	50095249	82460899	Rat
1578755	Pur5	Proteinuria QTL 5	3.3	0.0001	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	8	30848154	101699754	Rat
1300146	Rf17	Renal function QTL 17	2.9		renal blood flow trait (VT:2000006)	absolute change in renal blood flow rate (CMO:0001168)	8	28242912	73242912	Rat
8662823	Vetf5	Vascular elastic tissue fragility QTL 5	1.9		artery integrity trait (VT:0010639)	patent ductus arteriosus score (CMO:0002566)	8	28242912	99525068	Rat
2313088	Bss75	Bone structure and strength QTL 75	3.1	0.0001	body length (VT:0001256)	body length, nose to rump (CMO:0000079)	8	30848154	82460899	Rat
1358896	Bp262	Blood pressure QTL 262	2.89		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	27205715	99103503	Rat
731182	Uae24	Urinary albumin excretion QTL 24	6.4		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	19331152	93965294	Rat
724514	Uae15	Urinary albumin excretion QTL 15	2.9		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	8	29502665	70386295	Rat
631842	Inf1	Infertility severity QTL 1	4.1	0.001	seminal gland mass (VT:0010524)	seminal vesicle wet weight (CMO:0001603)	8	22662330	67662330	Rat
737824	Hcar10	Hepatocarcinoma resistance QTL 10	2.9		liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	8	40713066	82925667	Rat
1331769	Rf39	Renal function QTL 39	3.871		urine output (VT:0003620)	timed urine volume (CMO:0000260)	8	41866876	75097878	Rat
61358	Bp39	Blood pressure QTL 39	2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	35551938	80551938	Rat
1358906	Bp253	Blood pressure QTL 253	4	0.0004	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	40713066	93965294	Rat
1358907	Cm40	Cardiac mass QTL 40	1.89		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	27205715	99103503	Rat
70197	BpQTLcluster8	Blood pressure QTL cluster 8	3.482		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	46531639	119088626	Rat
2316950	Scl66	Serum cholesterol level QTL 66	4.1		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	8	30848259	105647037	Rat
1582254	Kidm31	Kidney mass QTL 31	3		kidney mass (VT:0002707)	both kidneys wet weight (CMO:0000085)	8	54237644	85365202	Rat
10402857	Bp380	Blood pressure QTL 380		0.95	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
1358892	Kidm26	Kidney mass QTL 26	3.69		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	27205715	99103503	Rat
631216	Stl9	Serum triglyceride level QTL 9	4.71	0.0001	blood triglyceride amount (VT:0002644)	serum triglyceride level (CMO:0000360)	8	41867010	70386132	Rat
5684973	Bss100	Bone structure and strength QTL 100	4.7		tibia area (VT:1000281)	tibia area measurement (CMO:0001382)	8	50095249	82460899	Rat
1582243	Bw66	Body weight QTL 66	3.4	0.0048	body mass (VT:0001259)	body weight (CMO:0000012)	8	54237644	85365202	Rat
2313057	Bss76	Bone structure and strength QTL 76	3	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	8	30848154	82460899	Rat
12879878	Bw183	Body weight QTL 183		0.001	body mass (VT:0001259)	body weight (CMO:0000012)	8	43296169	98968765	Rat
1300177	Cm2	Cardiac mass QTL 2	3.65		heart mass (VT:0007028)	heart weight (CMO:0000017)	8	54259986	100382532	Rat
1549908	Neudeg1	Neurodegradation QTL 1	5.5	0	nervous system integrity trait (VT:0010566)	logarithm of the ratio of the lesioned side motor neuron count to contralateral side motor neuron count (CMO:0001986)	8	30188867	94457446	Rat
12879879	Cm99	Cardiac mass QTL 99		0.001	heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	8	43296169	98968765	Rat
2313067	Bss77	Bone structure and strength QTL 77	3.1	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	8	30848154	82460899	Rat
12879880	Cm100	Cardiac mass QTL 100		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	8	43296169	98968765	Rat
12879881	Cm101	Cardiac mass QTL 101		0.001	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	8	43296169	98968765	Rat
12879882	Am8	Aortic mass QTL 8		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	8	43296169	98968765	Rat
12879883	Kidm65	Kidney mass QTL 65		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	8	43296169	98968765	Rat
1358912	Bw51	Body weight QTL 51	2.95		body mass (VT:0001259)	body weight (CMO:0000012)	8	51351728	107062046	Rat
2313086	Bss60	Bone structure and strength QTL 60	4.1	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	8	50095249	82460899	Rat
2303171	Bp331	Blood pressure QTL 331	5.57	0.005	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	61290298	119084929	Rat
2293697	Bmd39	Bone mineral density QTL 39			femur strength trait (VT:0010010)	femur total energy absorbed before break (CMO:0001677)	8	54043744	98968765	Rat
1331837	Bw23	Body weight QTL 23	4.19	0.00007	body mass (VT:0001259)	body weight (CMO:0000012)	8	46531722	99083736	Rat
1331838	Niddm61	Non-insulin dependent diabetes mellitus QTL 61	3.53	0.0004	blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	8	36469535	99083736	Rat
631650	Stl6	Serum triglyceride level QTL 6	4	0.0019	blood triglyceride amount (VT:0002644)	plasma triglyceride level (CMO:0000548)	8	10378157	112202585	Rat
631653	Bp125	Blood pressure QTL 125	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	8	66142385	111142385	Rat
1581557	Eae16	Experimental allergic encephalomyelitis QTL 16	3.8		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	8	8462195	110921472	Rat
631271	Lecl1	Lens clarity QTL 1		0.001	lens clarity trait (VT:0001304)	age of onset/diagnosis of cataract (CMO:0001584)	8	18984168	84531599	Rat
2303564	Gluco43	Glucose level QTL 43	3		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	26130187	71130187	Rat
2303570	Gluco48	Glucose level QTL 48	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	8	49805831	94805831	Rat
2313046	Bss78	Bone structure and strength QTL 78	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	8	30848154	82460899	Rat
2303572	Insul13	Insulin level QTL 13	2		blood insulin amount (VT:0001560)	blood insulin level (CMO:0000349)	8	26130187	71130187	Rat
2301402	Bp316	Blood pressure QTL 316		0.005	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	8	53968765	98968765	Rat
631664	Hcar3	Hepatocarcinoma resistance QTL 3	2.9	0.0005	liver integrity trait (VT:0010547)	volume of individual liver tumorous lesion (CMO:0001078)	8	54237644	99103503	Rat

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001276477	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039082149	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266130	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063266131	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CB712651	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474041	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ109437	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ209888	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ216558	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000008	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MF150148	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	MF150149	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000022897 ⟹ ENSRNOP00000022897

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	175,665,853 - 175,666,963 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000072573 ⟹ ENSRNOP00000067129

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	8	72,743,426 - 72,745,926 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000090977 ⟹ ENSRNOP00000071243

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	67,562,483 - 67,567,418 (+)	Ensembl
Rnor_6.0 Ensembl	8	72,741,155 - 72,746,090 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000094707 ⟹ ENSRNOP00000082651

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	8	67,564,450 - 67,567,418 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000096946 ⟹ ENSRNOP00000097240

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	175,666,144 - 175,666,964 (-)	Ensembl

Ensembl Acc Id:

ENSRNOT00000110635 ⟹ ENSRNOP00000097453

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	2	175,665,861 - 175,666,964 (-)	Ensembl

RefSeq Acc Id:

NM_001276477 ⟹ NP_001263406

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	76,443,658 - 76,448,593 (+)	NCBI
mRatBN7.2	8	67,562,483 - 67,567,418 (+)	NCBI
Rnor_6.0	8	72,741,155 - 72,746,090 (+)	NCBI
Rnor_5.0	8	77,073,998 - 77,078,933 (+)	NCBI
Celera	8	74,137,257 - 74,142,218 (-)	NCBI

Sequence:

show sequence

ATTATTTGTGGTGTCCAGAGATGGTCTCATGTGGGACTTCAAGCCTGGCCGGGGTCAAGGGCGG
AGTCGGAGCTTAAGCTGTTTAGACCTTCCAGGGTCTTGGACCGGCATTCCGGGAGGGAGTCGTA
CCACAGAGACGGCAGCCTAGAGCGGCCACTCCCGCCCCCATTCCCCTCCACTCCGCCCCGCCGC
CTCTATCCCGGAAGTTGCTGCTAGGCGCTCGAAAGCGAGCACCTCATCTCAGAGATCTGGAGCG
GCCGCGCTTGCGGAGCTGTCACCATGCCTCTGGCTAGAGATCTATTACACCCTTCCTTGGAAGA
GGAAAAGAAAAAACATAAGAAGAAACGGCTGGTTCAGAGCCCAAATTCTTACTTCATGGATGTG
AAATGTCCAGGTTGCTACAAGATTACTACAGTTTTCAGCCATGCTCAGACAGTGGTTCTTTGTG
TGGGTTGTTCAACCGTGCTGTGCCAGCCCACAGGAGGGAAAGCCAGGCTCACAGAAGGCTGTTC
ATTTAGAAGAAAGCAACACTAATCATCTATACAAGTTCCTGAATTCGTGTTTTTCACAGAAAGC
CTTATCAACTTTAGTTACTCTACCAAGACAATGTAATTATTGTTTGATTTTATAAAGTCTACAA
CAATGATCTCCTATTTTGGTGTCAGTTTTTCAATAAAGTTTTACTTATGAACAAGTTC

hide sequence

RefSeq Acc Id:

XM_039082149 ⟹ XP_038938077

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	76,444,979 - 76,448,589 (+)	NCBI
mRatBN7.2	8	67,563,842 - 67,567,417 (+)	NCBI

RefSeq Acc Id:

XM_063266130 ⟹ XP_063122200

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	76,445,043 - 76,448,589 (+)	NCBI

RefSeq Acc Id:

XM_063266131 ⟹ XP_063122201

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	8	76,445,443 - 76,448,589 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001263406	(Get FASTA)	NCBI Sequence Viewer
	XP_038938077	(Get FASTA)	NCBI Sequence Viewer
	XP_063122200	(Get FASTA)	NCBI Sequence Viewer
	XP_063122201	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL84250	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000071243
	ENSRNOP00000071243.1
GenBank Protein	P24051	(Get FASTA)	NCBI Sequence Viewer

RefSeq Acc Id:	NP_001263406 ⟸ NM_001276477
- UniProtKB:	P24051 (UniProtKB/Swiss-Prot), A6KEZ8 (UniProtKB/TrEMBL), A0A8L2QXZ3 (UniProtKB/TrEMBL)
- Sequence:	show sequence MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLC QPTGGKARLTEGCSFRRKQH hide sequence

Ensembl Acc Id:

ENSRNOP00000067129 ⟸ ENSRNOT00000072573

Ensembl Acc Id:

ENSRNOP00000071243 ⟸ ENSRNOT00000090977

RefSeq Acc Id:	XP_038938077 ⟸ XM_039082149
- Peptide Label:	isoform X2
- UniProtKB:	P24051 (UniProtKB/Swiss-Prot), A6KEZ8 (UniProtKB/TrEMBL), A0A8L2QXZ3 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000082651 ⟸ ENSRNOT00000094707

RefSeq Acc Id:	XP_063122200 ⟸ XM_063266130
- Peptide Label:	isoform X1
- UniProtKB:	A0A8L2QXZ3 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063122201 ⟸ XM_063266131
- Peptide Label:	isoform X3
- UniProtKB:	A0A8I6AWD8 (UniProtKB/TrEMBL), A6J6K5 (UniProtKB/TrEMBL)

Ensembl Acc Id:

ENSRNOP00000097240 ⟸ ENSRNOT00000096946

Ensembl Acc Id:

ENSRNOP00000022897 ⟸ ENSRNOT00000022897

Ensembl Acc Id:

ENSRNOP00000097453 ⟸ ENSRNOT00000110635

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-P24051-F1-model_v2	AlphaFold	P24051	1-84	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13696092

Promoter ID:

EPDNEW_R6617

Type:

initiation region

Name:

Rps27l_1

Description:

ribosomal protein S27-like

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	8	72,742,772 - 72,742,832	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1595396	AgrOrtholog
BioCyc Gene	G2FUF-30002	BioCyc
Ensembl Genes	ENSRNOG00000016961	Ensembl
	ENSRNOG00000050473	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
	ENSRNOG00000066445	Ensembl
Ensembl Transcript	ENSRNOT00000090977	ENTREZGENE
	ENSRNOT00000090977.2	UniProtKB/Swiss-Prot
Gene3D-CATH	2.20.25.100	UniProtKB/Swiss-Prot
InterPro	Ribosomal_S27_Zn-bd_dom_sf	UniProtKB/Swiss-Prot
	Ribosomal_S27e	UniProtKB/Swiss-Prot
	Ribosomal_zn-bd	UniProtKB/Swiss-Prot
KEGG Report	rno:681429	UniProtKB/Swiss-Prot
NCBI Gene	681429	ENTREZGENE
PANTHER	PTHR11594	UniProtKB/Swiss-Prot
Pfam	Ribosomal_S27e	UniProtKB/Swiss-Prot
PhenoGen	Rps27l	PhenoGen
PROSITE	RIBOSOMAL_S27E	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000016961	RatGTEx
	ENSRNOG00000050473	RatGTEx
	ENSRNOG00000066445	RatGTEx
Superfamily-SCOP	SSF57829	UniProtKB/Swiss-Prot
UniProt	A0A8I6AWD8	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6G7P2_RAT	UniProtKB/TrEMBL
	A0A8L2QXZ3	ENTREZGENE, UniProtKB/TrEMBL
	A6J6K5	ENTREZGENE, UniProtKB/TrEMBL
	A6KEZ8	ENTREZGENE, UniProtKB/TrEMBL
	P24051	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2008-10-07	Rps27l	ribosomal protein S27-like	LOC681429	similar to 40S ribosomal protein S27-like protein	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC681429	similar to 40S ribosomal protein S27-like protein			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar

RGD Manual Annotations