Tyrp1 (tyrosinase-related protein 1)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes Community Projects (beta) QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease Coronavirus Disease Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Tyrp1 (tyrosinase-related protein 1) Rattus norvegicus

Analyze

Symbol:

Tyrp1

Name:

tyrosinase-related protein 1

RGD ID:

1593266

Description:

Predicted to enable protein homodimerization activity and tyrosinase activity. Predicted to be involved in positive regulation of melanin biosynthetic process. Predicted to act upstream of or within several processes, including acetoacetic acid metabolic process; melanocyte differentiation; and melanosome organization. Predicted to be located in clathrin-coated endocytic vesicle membrane; endosome membrane; and melanosome membrane. Human ortholog(s) of this gene implicated in oculocutaneous albinism; oculocutaneous albinism type III; and pigmentation disease. Orthologous to human TYRP1 (tyrosinase related protein 1); PARTICIPATES IN tyrosine metabolic pathway; INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; cocaine.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

5,6-dihydroxyindole-2-carboxylic acid oxidase; B; tyrosinase-related protein 1 (mapped); tyrosine phosphatase 1, same as B (Brown); Tyrp1_mapped

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	TYRP1 (tyrosinase related protein 1)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, Treefam
Mus musculus (house mouse):	Tyrp1 (tyrosinase-related protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Tyrp1 (tyrosinase related protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	TYRP1 (tyrosinase related protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	TYRP1 (tyrosinase related protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Tyrp1 (tyrosinase related protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	TYRP1 (tyrosinase related protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	TYRP1 (tyrosinase related protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Tyrp1 (tyrosinase related protein 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	CFAP161 (cilia and flagella associated protein 161)	HGNC	OMA
Alliance orthologs ³
Mus musculus (house mouse):	Tyrp1 (tyrosinase-related protein 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Homo sapiens (human):	TYRP1 (tyrosinase related protein 1)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tyrp1a (tyrosinase-related protein 1a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	tyrp1b (tyrosinase-related protein 1b)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tyr-1	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tyr-2	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tyr-3	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tyr-5	Alliance	DIOPT (OrthoFinder\|OrthoInspector\|PANTHER)
Caenorhabditis elegans (roundworm):	tyr-4	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	tyr-6	Alliance	DIOPT (Ensembl Compara\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	tyrp1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	95,280,982 - 95,299,516 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	95,280,982 - 95,299,516 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	97,659,552 - 97,678,085 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	99,480,692 - 99,499,221 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	99,470,354 - 99,488,887 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	98,387,291 - 98,406,083 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	98,387,291 - 98,406,083 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	102,430,674 - 102,449,645 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	99,518,306 - 99,537,289 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	93,854,189 - 93,872,732 (+)	NCBI		Celera
Cytogenetic Map	5	q31	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

adenocarcinoma (ISO)

Albinism (ISO)

genetic disease (ISO)

Lung Neoplasms (ISO)

melanoma (ISO)

Nonsyndromic Oculocutaneous Albinism (ISO)

ocular albinism 1 (ISO)

oculocutaneous albinism (ISO)

oculocutaneous albinism type II (ISO)

oculocutaneous albinism type III (ISO)

Skin/Hair/Eye Pigmentation, Variation In, 11 (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-artemisinic acid (ISO)

(-)-epigallocatechin 3-gallate (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-sulfonyldiphenol (ISO)

4-tert-butylphenol (ISO)

5-fluorouracil (ISO)

acrylamide (ISO)

aflatoxin B1 (ISO)

afzelin (ISO)

all-trans-retinoic acid (ISO)

alpha-melanocyte stimulating hormone (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bis(2-chloroethyl) sulfide (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

cannabidiol (ISO)

CGP 52608 (ISO)

chaetocin (ISO)

chlorambucil (ISO)

chlorogenic acid (ISO)

cocaine (EXP)

colforsin daropate hydrochloride (ISO)

copper atom (ISO)

copper(0) (ISO)

decabromodiphenyl ether (EXP)

dioxygen (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

emodin (ISO)

etoposide (ISO)

formaldehyde (ISO)

gemcitabine (ISO)

genistein (ISO)

isorhamnetin (ISO)

kojic acid (ISO)

lamivudine (ISO)

Lasiocarpine (ISO)

LY294002 (ISO)

manganese atom (EXP,ISO)

manganese(0) (EXP,ISO)

manganese(II) chloride (EXP,ISO)

N-ethyl-N-nitrosourea (ISO)

N-methyl-N-nitrosourea (ISO)

N-Nitrosopyrrolidine (ISO)

nickel sulfate (ISO)

nonanedioic acid (ISO)

O-methyleugenol (ISO)

phytol (ISO)

Pomiferin (ISO)

puerarin (ISO)

quercetin (ISO)

resorcinol (ISO)

resveratrol (ISO)

Rosavin (ISO)

rotenone (ISO)

SB 203580 (ISO)

SB 431542 (ISO)

scoparone (ISO)

Sweroside (ISO)

taurine (ISO)

testosterone enanthate (ISO)

theophylline (ISO)

triclosan (ISO)

valproic acid (ISO)

vemurafenib (ISO)

vorinostat (ISO)

zidovudine (ISO)

zinc atom (ISO)

zinc(0) (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

acetoacetic acid metabolic process (ISO)

biological_process (ND)

melanin biosynthetic process (IEA)

melanin metabolic process (ISO)

melanocyte differentiation (IBA,ISO)

melanosome organization (IBA,ISO)

pigmentation (ISO)

positive regulation of melanin biosynthetic process (ISO)

Cellular Component

clathrin-coated endocytic vesicle membrane (ISO)

cytoplasm (ISO)

endosome membrane (ISO)

intracellular vesicle (ISO)

melanosome (IBA,ISO)

melanosome membrane (ISO)

Molecular Function

identical protein binding (ISO)

protein binding (ISO)

protein homodimerization activity (ISO)

tyrosinase activity (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

tyrosine metabolic pathway (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Mutation in and lack of expression of tyrosinase-related protein-1 (TRP-1) in melanocytes from an individual with brown oculocutaneous albinism: a new subtype of albinism classified as "OCA3".	Boissy RE, etal., Am J Hum Genet. 1996 Jun;58(6):1145-56.
2.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
3.	OMIM Disease Annotation Pipeline	OMIM Disease Annotation Pipeline
4.	KEGG Annotation Import Pipeline	Pipeline to import KEGG annotations from KEGG into RGD
5.	GOA pipeline	RGD automated data pipeline
6.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
7.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
8.	Comprehensive gene review and curation	RGD comprehensive gene curation
9.	Information Derived from GenBank Report	RGD, Sept. 2003
10.	Regulation of tyrosinase processing and trafficking by organellar pH and by proteasome activity.	Watabe H, etal., J Biol Chem 2004 Feb 27;279(9):7971-81. Epub 2003 Nov 21.

Additional References at PubMed

PMID:2379821	PMID:7665913	PMID:9548375	PMID:9918801	PMID:13880466	PMID:17182842	PMID:17247639	PMID:19841138	PMID:21291857	PMID:21949658	PMID:21996312	PMID:22275436
PMID:26620560	PMID:27390154	PMID:35708352

Genomics

Comparative Map Data

Tyrp1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	5	95,280,982 - 95,299,516 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	5	95,280,982 - 95,299,516 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	5	97,659,552 - 97,678,085 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	5	99,480,692 - 99,499,221 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	5	99,470,354 - 99,488,887 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	5	98,387,291 - 98,406,083 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	5	98,387,291 - 98,406,083 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	5	102,430,674 - 102,449,645 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	5	99,518,306 - 99,537,289 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	5	93,854,189 - 93,872,732 (+)	NCBI		Celera
Cytogenetic Map	5	q31	NCBI

TYRP1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	9	12,693,385 - 12,710,285 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	9	12,685,439 - 12,710,285 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	9	12,693,385 - 12,710,285 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	9	12,683,449 - 12,700,258 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	9	12,683,448 - 12,700,258	NCBI
Celera	9	12,625,996 - 12,642,868 (+)	NCBI		Celera
Cytogenetic Map	9	p23	NCBI
HuRef	9	12,658,087 - 12,674,962 (+)	NCBI		HuRef
CHM1_1	9	12,693,770 - 12,710,634 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	9	12,702,721 - 12,719,618 (+)	NCBI		T2T-CHM13v2.0

Tyrp1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	4	80,752,360 - 80,769,973 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	4	80,752,360 - 80,769,956 (+)	Ensembl		GRCm39 Ensembl
GRCm38	4	80,834,123 - 80,851,736 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	4	80,834,123 - 80,851,719 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	4	80,480,134 - 80,497,622 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	4	80,305,461 - 80,322,949 (+)	NCBI		MGSCv36	mm8
Celera	4	79,387,103 - 79,404,579 (+)	NCBI		Celera
Cytogenetic Map	4	C3	NCBI
cM Map	4	37.89	NCBI

Tyrp1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955434	15,913,968 - 15,931,740 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955434	15,913,208 - 15,932,193 (+)	NCBI	ChiLan1.0	ChiLan1.0

TYRP1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	9	111,831,122 - 113,001,599 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	9	12,502,610 - 12,550,203 (+)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	9	12,950,831 - 12,996,808 (+)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	9	12,950,831 - 12,996,799 (+)	Ensembl	panpan1.1		panPan2

TYRP1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	11	33,317,084 - 33,336,029 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	11	33,317,121 - 33,335,498 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	11	32,027,482 - 32,045,312 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	11	34,222,689 - 34,240,515 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	11	34,222,689 - 34,240,515 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	11	32,928,733 - 32,946,547 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	11	32,713,987 - 32,731,848 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	11	33,376,152 - 33,394,014 (+)	NCBI		UU_Cfam_GSD_1.0

Tyrp1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404947	148,084,995 - 148,102,753 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936539	6,537,509 - 6,556,513 (+)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936539	6,537,448 - 6,555,440 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TYRP1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	1	209,725,638 - 209,745,705 (-)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	1	209,725,698 - 209,745,141 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	1	233,661,356 - 233,680,103 (-)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

TYRP1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	12	66,841,867 - 66,861,730 (-)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	12	66,842,926 - 66,859,842 (-)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	55,076,959 - 55,095,761 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tyrp1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624736	17,011,115 - 17,029,322 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624736	17,011,092 - 17,028,689 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Tyrp1
82 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	333
Count of miRNA genes:	198
Interacting mature miRNAs:	229
Transcripts:	ENSRNOT00000046503
Prediction methods:	Microtar, Miranda, Rnahybrid, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
70212	Niddm25	Non-insulin dependent diabetes mellitus QTL 25	3.54		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	1	131345958	Rat
1576314	Eutr1	Estrogen induced uterine response QTL 1			uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	2138965	166875058	Rat
7394712	Emca13	Estrogen-induced mammary cancer QTL 13			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	9823266	99753708	Rat
634305	Mamtr1	Mammary tumor resistance QTL 1		0.0001	mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	12789751	113558310	Rat
2290448	Scl54	Serum cholesterol level QTL 54	2.93		blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	31663789	131345958	Rat
1576317	Eutr2	Estrogen induced uterine response QTL 2		0.01	uterus integrity trait (VT:0010575)	pyometritis severity score (CMO:0002009)	5	34730116	104251008	Rat
2316959	Gluco59	Glucose level QTL 59	4.7		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	34944474	113558310	Rat
1641912	Alcrsp18	Alcohol response QTL 18			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	5	35189153	141643988	Rat
1549845	Scl44	Serum cholesterol level QTL 44	6		blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	40128307	148607290	Rat
1331801	Rf33	Renal function QTL 33	4.149		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal vascular resistance (CMO:0001900)	5	43726656	129132602	Rat
1578766	Tcas11	Tongue tumor susceptibility QTL 11	4.12		tongue integrity trait (VT:0010553)	number of squamous cell tumors of the tongue with diameter greater than 3 mm (CMO:0001950)	5	46711509	161317411	Rat
1576312	Emca8	Estrogen-induced mammary cancer QTL 8	4.1		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	50328551	141643988	Rat
2303615	Vencon7	Ventilatory control QTL 7		0.001	respiration trait (VT:0001943)	respiration rate (CMO:0000289)	5	50983895	95983895	Rat
2303574	Gluco42	Glucose level QTL 42	2		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	5	53496719	98496719	Rat
61359	Eaex	Experimental allergic encephalomyelitis QTL x	3		nervous system integrity trait (VT:0010566)	post-insult time to onset of experimental autoimmune encephalomyelitis (CMO:0001422)	5	55715622	100715622	Rat
70189	Mcs5	Mammary carcinoma susceptibility QTL 5	10.51		mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	55805606	132207589	Rat
1358895	Bp254	Blood pressure QTL 254	3.6	0.0003	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	58829236	128034027	Rat
61426	Scl2	Serum cholesterol level QTL 2	7.3	0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	59793399	143070159	Rat
2316957	Pur21	Proteinuria QTL 21	6.2		urine protein amount (VT:0005160)	urine protein level (CMO:0000591)	5	59793528	113558156	Rat
61386	Bp49	Blood pressure QTL 49	16.6		cerebrum integrity trait (VT:0010549)	brain infarction volume (CMO:0001013)	5	60293434	98603051	Rat
61393	Bp7	Blood pressure QTL 7	4.5	0.0001	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	60293434	161481680	Rat
2290005	Mcs24	Mammary carcinoma susceptibility QTL 24			mammary gland integrity trait (VT:0010552)	mammary tumor number (CMO:0000343)	5	64719390	109719390	Rat
2306971	Anxrr21	Anxiety related response QTL 21	9.47		fear/anxiety-related behavior trait (VT:1000241)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	5	66174080	124160948	Rat
2312671	Scl64	Serum cholesterol level QTL 64		0.001	blood cholesterol amount (VT:0000180)	serum total cholesterol level (CMO:0000363)	5	68984307	104251008	Rat
61380	Edpm5	Estrogen-dependent pituitary mass QTL 5	4.5	0.92	pituitary gland mass (VT:0010496)	pituitary gland wet weight (CMO:0000853)	5	68984307	104251008	Rat
1357396	Bw44	Body weight QTL 44	4.19		body mass (VT:0001259)	body weight (CMO:0000012)	5	68984307	104251008	Rat
1357402	Bw46	Body weight QTL 46	4.47		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	5	68984307	104251008	Rat
2302381	Bw84	Body weight QTL 84	4.47		body mass (VT:0001259)	body mass index (BMI) (CMO:0000105)	5	68984307	104251008	Rat
1354598	Srn6	Serum renin concentration QTL 6	3.8		blood renin amount (VT:0003349)	plasma renin activity level (CMO:0000116)	5	69540295	151018848	Rat
1298070	Scl18	Serum cholesterol level QTL 18	3.7		blood LDL cholesterol amount (VT:0000181)	calculated plasma low density lipoprotein cholesterol level (CMO:0001245)	5	79584860	124584860	Rat
1598846	Bp293	Blood pressure QTL 293	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	79584860	124584860	Rat
1598859	Cm66	Cardiac mass QTL 66	2		heart mass (VT:0007028)	heart weight to body weight ratio (CMO:0000074)	5	79584860	124584860	Rat
1302790	Scl20	Serum cholesterol level QTL 20	6.4	0.0001	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	5	82394392	166664054	Rat
1331782	Rf36	Renal function QTL 36	3.296		kidney blood vessel physiology trait (VT:0100012)	absolute change in renal blood flow rate (CMO:0001168)	5	83840598	97059958	Rat
1298086	Bp156	Blood pressure QTL 156			arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	5	84132602	129132602	Rat
7411601	Foco12	Food consumption QTL 12	19.7	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	87468046	132468046	Rat
7411564	Bw135	Body weight QTL 135		0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	5	87468046	132468046	Rat
7411582	Foco3	Food consumption QTL 3	7.5	0.001	eating behavior trait (VT:0001431)	feed conversion ratio (CMO:0001312)	5	87468046	132468046	Rat
6903316	Bw113	Body weight QTL 113	2	0.0103	body mass (VT:0001259)	body weight (CMO:0000012)	5	87765973	132765973	Rat
1358889	Bp261	Blood pressure QTL 261	2.86		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	5	90067849	128034027	Rat
1358909	Kidm25	Kidney mass QTL 25	1.87		kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	5	90067849	128034027	Rat
631527	Tls1	T-lymphoma susceptibility QTL 1	0	0.001	thymus integrity trait (VT:0010555)	post-insult time to onset of T-cell lymphoma (CMO:0001907)	5	90450144	135450144	Rat
61452	Ciaa5	CIA Autoantibody QTL 5	3.5		blood autoantibody amount (VT:0003725)	calculated serum anti-rat type 2 collagen autoantibody titer (CMO:0001281)	5	94858972	143070159	Rat

Markers in Region

D5Rat88

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	95,288,293 - 95,288,541 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	98,394,603 - 98,394,850	NCBI	Rnor6.0
Rnor_5.0	5	102,437,986 - 102,438,233	UniSTS	Rnor5.0
RGSC_v3.4	5	99,525,263 - 99,525,679	RGD	RGSC3.4
RGSC_v3.4	5	99,525,392 - 99,525,639	UniSTS	RGSC3.4
RGSC_v3.1	5	99,530,489 - 99,530,905	RGD
Celera	5	93,861,504 - 93,861,751	UniSTS
RH 3.4 Map	5	748.8	RGD
RH 3.4 Map	5	748.8	UniSTS
RH 2.0 Map	5	601.4	RGD
SHRSP x BN Map	5	53.5899	RGD
Cytogenetic Map	5	q31	UniSTS

RH134304

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	5	95,299,282 - 95,299,476 (+)	MAPPER	mRatBN7.2
Rnor_6.0	5	98,405,850 - 98,406,043	NCBI	Rnor6.0
Rnor_5.0	5	102,449,412 - 102,449,605	UniSTS	Rnor5.0
RGSC_v3.4	5	99,537,056 - 99,537,249	UniSTS	RGSC3.4
Celera	5	93,872,499 - 93,872,692	UniSTS
RH 3.4 Map	5	749.49	UniSTS
Cytogenetic Map	5	q31	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	hemolymphoid system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium
Low				6	3	16
Below cutoff	6	1	1	59	8	14	3	1

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001106664	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH473978	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000162	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000046503 ⟹ ENSRNOP00000041764

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	5	95,280,982 - 95,299,516 (+)	Ensembl
Rnor_6.0 Ensembl	5	98,387,291 - 98,406,083 (+)	Ensembl

RefSeq Acc Id:

NM_001106664 ⟹ NP_001100134

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	5	95,280,982 - 95,299,516 (+)	NCBI
Rnor_6.0	5	98,387,291 - 98,406,083 (+)	NCBI
Rnor_5.0	5	102,430,674 - 102,449,645 (+)	NCBI
RGSC_v3.4	5	99,518,306 - 99,537,289 (+)	RGD
Celera	5	93,854,189 - 93,872,732 (+)	RGD

Sequence:

show sequence

GAAGAGAGGACCAGCCCCTGCCAGCGTGAGTGATCTGGCTTGGGATTTGCTGTCTGGCAGAAAA
CCACATGCAATTAACAGCTGGCATCAGGGGAAAAGCGGACATCCAACACTAGCTCTGAAGGAGA
TCAGCCGAGAAACCTTCCAGGAGTTCATGGTACTGCTGTATTTTCATCTCAGTACCCCTCTTCT
CCAGCAAAGAGCAGCATACTAGACCTGTGTCCTGCACTCTTGATTCTACAGGAATGAAATCTTA
CAACGTCCTCCTCCTAGCCTCTCTCTTCCTTTCCCTGATGCTGCTTTGTCCTGTCTGGGCTCAG
TTTCCACGAGAATGCGCCAATATTGAGGCTCTGAGAAGTGGGGTGTGTTGCCCAGACCTGTTTC
CTTCCTCTGGACCAGGGACTGACCCCTGTGGCTCATCATCAGGAAGGGGCAGGTGTGTGGCTGT
GACCGCAGACTCCCGACCCCACAGCCGCCATTATCCCCATGATGGTAGAGATGACCGGGAAGGC
TGGCCTCTGAGGTTCTTCAATAGGACATGTCAGTGCAATGGTAATTTCTCAGGACACAACTGTG
GGGCTTGTCGTCCTGGGTGGAGAGGAGCTGCATGCAACCAGAAAATTCTCACAGTCAGGAGAAA
TCTTCTTGACTTAAGTACAGAAGAAAAAAGCCACTTCGTCAGGGCCTTGGATATGGCGAAGCGC
ACAACTCACCCTCAATTTGTCATTGCCACAAGGAGGTCAGAAGACATGCTGGGACCAGATGGCA
GCACACCACAATTTGAGAACATTTCCATTTACAACTACTTTGTTTGGACACACTATTATTCAGT
CAAAAAAACCTTCCTTGGGGCAGGACAGGAGAGCTTTGGCGATGTGGATTTCTCTCACGAAGGA
CCAGCTTTCCTCACATGGCACAGGTACCATCTGCTGCAGCTGGAGCGAGACATTCAGGAGATGC
TGCAGGAGCCTTCTTTCTCCCTTCCTTACTGGAATTTTGCAACTGGGAAAAACATCTGTGATAT
CTGCACTGATGACTTGATGGGATCCAGAAGCAACTTCGATTCTACTCTTATAAGCCCCAACTCT
GTCTTTTCACAATGGAGAGTGGTCTGTGAATCCTTAGAAGAGTACGATACCCTGGGAACACTTT
GCAACAGCACTGAGGGTGGTCCAATCAGGAGAAACCCAGCCGGAAATGTAGGGAGACCAGCAGT
ACAGCGTCTTCCTGCGCCACAGGATGTTACTCGATGCCTGGAGGTTCGTGTGTTTGACACGCCT
CCTTTTTATTCCAATTCTACAAACAGTTTTCGAAACACAGTGGAAGGTTACAGCGATCCCACGG
GGAAATATGACCCTGCTGTTCGAAGCCTTCATAACCTGGCCCACCTCTTCCTGAATGGGACAGG
AGGACAAACCCATCTGTCTCCCAATGATCCTATTTTTGTCCTCCTGCATACTTTCACTGATGCA
GTCTTTGATGAATGGCTAAGGAGATACAATGCCGATATTTCTACCTTCCCATTGGAAAATGCTC
CTATTGGACATAACAGGCAATATAACATGGTACCATTCTGGCCTCCAGTTACCAACACAGAAAT
GTTTGTTACTGCTCCAGACAACCTGGGATATGCTTATGAACTTCAATGGCCAGGTCAGGAATTT
ACTGTATCTGAAATCATTACCATTGCTGTAATAGCTGGGCTGTTACTTGTAGCTGCCATTTTTG
GGAGTGCTTCTTGTCTGATCCGCTCTAGAAGCACCAAGAATGAAGCCAACCAGCCTCTCCTCAC
CGATCACTACCAACGCTATGCTGAGGAATATGAAGAACTCCCAAATCCTAATCAAACCATGGTC
TGACACCTGCCTGCCTGGCCTCTCATGCAACAGGTTGGGAAGCAACCTGATTGAAACACAGCCG
TCAACCGCGTTTCCTTTTGCTACCTTCTTTTCTTTTTACTATAGATGTGGTTTGGAATTAAAGC
ATCGCTTTCCTTTTCAGAGATGCAGATTCACAATCTTTTCAATGGGTTTTAATTATTAGTTCTA
TTGAAGATGACATATTGTACCAGCCTCATGATATCCGAGAGGGTAACGTGATTCTTTGTGCTAT
GCTGTGAAGAAGTGATGCTTTGTGTACACAGGAAAATAAGTGGTGTAAAATCTACACTTCAAAT
ATATGATTGGCCAATCTTATAGAGTGAACATGGGATTGCATTGCCATTGCTGCTACTAATCAAA
AGATTTAAAAGCAGCCAGGTTGACTGGTTAAAATAAATTACATAACACTATGAACCAATAGAAC
CCTGATTATCTTTCTGAAACTGGTCTCATTATTTTGCTGTCAGTATATTATTTGGCCTTAGGTG
CAAGACCACAACAAAGTCACAGTCCTTGTCACACTTTGTAAAGATGAAAGCTTCGTTTACTGGA
ACACAGCTGCTACTCTATATTTGCTACTGTGTTCCCAGCTCAGTTCTCTGGATGGGAAACTGCC
CCTGCCACAGTTCACCTCCTAATTCTAATGTCTTAGAGGCCTACAAGGAAGGTATAATTCAGAG
GACACAGTGTTCTGTGCATCTTATCAAACGTTGTGTTTCATTATTATTATAACAGCATTATTTC
ACCACTTATCAGCCGTCTGTGTATTTCAAAATAAATATAATAAAATCTTGTTTCATTGGTC

hide sequence

Protein Sequences


Protein RefSeqs	NP_001100134	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDM10478	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000041764
	ENSRNOP00000041764.3

RefSeq Acc Id:	NP_001100134 ⟸ NM_001106664
- Peptide Label:	precursor
- UniProtKB:	A6J829 (UniProtKB/TrEMBL), D3ZH71 (UniProtKB/TrEMBL)
- Sequence:	show sequence MKSYNVLLLASLFLSLMLLCPVWAQFPRECANIEALRSGVCCPDLFPSSGPGTDPCGSSSGRGR CVAVTADSRPHSRHYPHDGRDDREGWPLRFFNRTCQCNGNFSGHNCGACRPGWRGAACNQKILT VRRNLLDLSTEEKSHFVRALDMAKRTTHPQFVIATRRSEDMLGPDGSTPQFENISIYNYFVWTH YYSVKKTFLGAGQESFGDVDFSHEGPAFLTWHRYHLLQLERDIQEMLQEPSFSLPYWNFATGKN ICDICTDDLMGSRSNFDSTLISPNSVFSQWRVVCESLEEYDTLGTLCNSTEGGPIRRNPAGNVG RPAVQRLPAPQDVTRCLEVRVFDTPPFYSNSTNSFRNTVEGYSDPTGKYDPAVRSLHNLAHLFL NGTGGQTHLSPNDPIFVLLHTFTDAVFDEWLRRYNADISTFPLENAPIGHNRQYNMVPFWPPVT NTEMFVTAPDNLGYAYELQWPGQEFTVSEIITIAVIAGLLLVAAIFGSASCLIRSRSTKNEANQ PLLTDHYQRYAEEYEELPNPNQTMV hide sequence

RefSeq Acc Id:

ENSRNOP00000041764 ⟸ ENSRNOT00000046503

Protein Domains

Tyrosinase copper-binding

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZH71-F1-model_v2	AlphaFold	D3ZH71	1-537	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1593266	AgrOrtholog
BioCyc Gene	G2FUF-40919	BioCyc
Ensembl Genes	ENSRNOG00000029318	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000046503	ENTREZGENE
	ENSRNOT00000046503.4	UniProtKB/TrEMBL
Gene3D-CATH	1.10.1280.10	UniProtKB/TrEMBL
InterPro	Di-copper_centre	UniProtKB/TrEMBL
	Tyrosinase	UniProtKB/TrEMBL
NCBI Gene	298182	ENTREZGENE
PANTHER	5,6-DIHYDROXYINDOLE-2-CARBOXYLIC ACID OXIDASE	UniProtKB/TrEMBL
	TYROSINASE FAMILY MEMBER	UniProtKB/TrEMBL
Pfam	Tyrosinase	UniProtKB/TrEMBL
PhenoGen	Tyrp1	PhenoGen
PRINTS	TYROSINASE	UniProtKB/TrEMBL
PROSITE	TYROSINASE_1	UniProtKB/TrEMBL
	TYROSINASE_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000029318	RatGTEx
Superfamily-SCOP	Di-copper_centre	UniProtKB/TrEMBL
UniProt	A6J829	ENTREZGENE, UniProtKB/TrEMBL
	D3ZH71	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2007-04-13		tyrosinase-related protein 1	Tyrp1	tyrosinase-related protein 1 (mapped)	Name updated	737654	APPROVED
2007-02-12	Tyrp1	tyrosinase-related protein 1 (mapped)	Tyrp1_mapped	tyrosinase-related protein 1 (mapped)	Data merged from RGD:3924	737654	PROVISIONAL
2006-11-20	Tyrp1	tyrosinase-related protein 1 (mapped)			Symbol and Name status set to provisional	70820	PROVISIONAL
2005-11-17	Tyrp1_mapped	tyrosinase-related protein 1 (mapped)	Tyrp1	tyrosinase-related protein 1	Symbol and Name updated	1556543	APPROVED
2002-06-10	Tyrp1	Tyrosine phosphatase 1			Symbol and Name status set to approved	70586	APPROVED

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - CTD

Imported Disease Annotations - OMIM

Imported Annotations - KEGG (archival)