Isoc2a (isochorismatase domain containing 2A)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) RatMine GViewer (Genome Viewer) Overgo Probe Designer Aging & Age-Related Disease Cancer Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models PhenoMiner (Quantitative Phenotypes) Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Poster Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: Isoc2a (isochorismatase domain containing 2A) Rattus norvegicus

Analyze

No known orthologs.

Symbol:

Isoc2a

Name:

isochorismatase domain containing 2A (Ensembl:similar to isochorismatase domain containing 2)

RGD ID:

1592677

Description:

Predicted to be involved in protein destabilization. Predicted to be located in nucleus. Predicted to be active in cytoplasm. Orthologous to human ISOC2 (isochorismatase domain containing 2); INTERACTS WITH 4,4'-sulfonyldiphenol (ortholog); chromium(6+) (ortholog); fenthion (ortholog).

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

isochorismatase domain-containing protein 2; isochorismatase domain-containing protein 2A; LOC684270; similar to isochorismatase domain containing 2; uncharacterized protein LOC684270

RGD Orthologs

Alliance Genes

More Info

homologs ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Other homologs ²				less info ...
Homo sapiens (human):	ISOC2 (isochorismatase domain containing 2)	HGNC	Ensembl, HomoloGene, OMA, OrthoDB, Panther
Alliance orthologs ³
Homo sapiens (human):	ISOC2 (isochorismatase domain containing 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Isoc2a (isochorismatase domain containing 2a)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	isoc2 (isochorismatase domain containing 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	marb-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	1	68,940,177 - 68,957,225 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	1	68,937,759 - 68,957,179 (-)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	1	72,491,667 - 72,509,433 (-)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	1	72,491,780 - 72,509,431 (-)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	1	76,027,564 - 76,044,837 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	1	68,165,460 - 68,182,583 (+)	NCBI		Celera
Cytogenetic Map	1	q12	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

4,4'-sulfonyldiphenol (ISO)

chromium(6+) (ISO)

fenthion (ISO)

paracetamol (ISO)

parathion (ISO)

sodium fluoride (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

protein destabilization (ISO)

Cellular Component

cytoplasm (IBA,ISO)

nucleus (ISO)

Molecular Function

protein binding (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Genomics

Variants

Variants in Isoc2a
70 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	78
Count of miRNA genes:	71
Interacting mature miRNAs:	75
Transcripts:	ENSRNOT00000071971
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1554320	Bmd1	Bone mineral density QTL 1	12.2	0.0001	femur mineral mass (VT:0010011)	volumetric bone mineral density (CMO:0001553)	1	509108	86060548	Rat
631688	Hcas2	Hepatocarcinoma susceptibility QTL 2	3	0.0001	liver integrity trait (VT:0010547)	liver tumorous lesion number (CMO:0001068)	1	5925874	115540829	Rat
1300167	Hrtrt2	Heart rate QTL 2	4.35		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	11481312	75088344	Rat
2313062	Bmd73	Bone mineral density QTL 73	3.9	0.0001	tibia mineral mass (VT:1000283)	cortical volumetric bone mineral density (CMO:0001730)	1	11481312	82174945	Rat
2313065	Bss67	Bone structure and strength QTL 67	3.1	0.0001	tibia area (VT:1000281)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313069	Bss68	Bone structure and strength QTL 68	2.9	0.0001	tibia size trait (VT:0100001)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
2313075	Bss66	Bone structure and strength QTL 66	3.4	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	11481312	82174945	Rat
2313077	Bss69	Bone structure and strength QTL 69	3.5	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	11481312	82174945	Rat
2313092	Bmd72	Bone mineral density QTL 72	2.5	0.0001	tibia mineral mass (VT:1000283)	total volumetric bone mineral density (CMO:0001728)	1	11481312	82174945	Rat
2313097	Bss70	Bone structure and strength QTL 70	3.5	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	11481312	82174945	Rat
631495	Bp96	Blood pressure QTL 96	4.52		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	22340647	102268831	Rat
1331785	Rf27	Renal function QTL 27	4.643		urine sodium amount (VT:0006274)	urine sodium level (CMO:0000129)	1	28879780	78430678	Rat
1358359	Sradr1	Stress Responsive Adrenal Weight QTL 1	4.74		adrenal gland mass (VT:0010420)	both adrenal glands wet weight (CMO:0000164)	1	30882023	123479925	Rat
70225	Bp58	Blood pressure QTL 58	3.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32356093	162846471	Rat
1300172	Bp172	Blood pressure QTL 172	3.56		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	1	32737273	90665040	Rat
10059597	Bp377	Blood pressure QTL 377	3.42	0.025	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	32737458	199368955	Rat
1354599	Bw29	Body weight QTL 29	3.46	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	1	33449848	78449848	Rat
1354643	Foco2	Food consumption QTL 2	7.17	0.0001	eating behavior trait (VT:0001431)	food intake rate (CMO:0000427)	1	33449848	78449848	Rat
8552900	Pigfal1	Plasma insulin-like growth factor 1 level QTL 1	7.4		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
8552948	Pigfal11	Plasma insulin-like growth factor 1 level QTL 11	4.7		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	1	34836858	79836858	Rat
9589820	Insglur3	Insulin/glucose ratio QTL 3	10.75	0.001	blood insulin amount (VT:0001560)	calculated plasma insulin level (CMO:0002170)	1	34836858	79836858	Rat
1331732	Srn4	Serum renin concentration QTL 4	4.467		renin activity (VT:0005581)	plasma renin activity level (CMO:0000116)	1	35239598	78430678	Rat
1331792	Rf29	Renal function QTL 29	4.589		urine potassium amount (VT:0010539)	urine potassium level (CMO:0000128)	1	35239598	78430678	Rat
2313051	Bss57	Bone structure and strength QTL 57	3.7	0.0001	tibia strength trait (VT:1000284)	bone polar moment of inertia (CMO:0001558)	1	43284731	118944897	Rat
2313059	Bss55	Bone structure and strength QTL 55	3.2	0.0001	tibia size trait (VT:0100001)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313072	Bss53	Bone structure and strength QTL 53	4.3	0.0001	tibia length (VT:0004357)	tibia length (CMO:0000450)	1	43284731	118944897	Rat
2313078	Bss54	Bone structure and strength QTL 54	3.5	0.0001	tibia area (VT:1000281)	tibia midshaft cross-sectional area (CMO:0001717)	1	43284731	118944897	Rat
2313094	Bss58	Bone structure and strength QTL 58	3.7	0.0001	tibia strength trait (VT:1000284)	tibia total energy absorbed before break (CMO:0001736)	1	43284731	118944897	Rat
2313098	Bmd70	Bone mineral density QTL 70	3.6	0.0001	tibia mineral mass (VT:1000283)	cortical volumetric bone mineral density (CMO:0001730)	1	43284731	118944897	Rat
2313099	Bss56	Bone structure and strength QTL 56	2.4	0.0001	tibia size trait (VT:0100001)	tibia midshaft endosteal cross-sectional area (CMO:0001716)	1	43284731	118944897	Rat
2302059	Pia36	Pristane induced arthritis QTL 36	3.8	0.001	blood immunoglobulin amount (VT:0002460)	serum immunoglobulin G1 level (CMO:0002115)	1	43333002	88333002	Rat
1331778	Rf28	Renal function QTL 28	4.66		urine potassium amount (VT:0010539)	urine potassium excretion rate (CMO:0000761)	1	45803140	78430678	Rat
2313402	Anxrr24	Anxiety related response QTL 24			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	1	48963584	144267916	Rat
4889962	Bss94	Bone structure and strength QTL 94	3.8		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	49361465	82174945	Rat
1578649	Bmd8	Bone mineral density QTL 8	4.9		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	1	49393172	94393172	Rat
1578654	Bss10	Bone structure and strength QTL 10	4		femur morphology trait (VT:0000559)	femoral neck cortical cross-sectional area (CMO:0001702)	1	49393172	159356837	Rat
634314	Niddm44	Non-insulin dependent diabetes mellitus QTL 44			blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	1	49393289	199050459	Rat
6903308	Scl36	Serum cholesterol QTL 36	2	0.0125	blood cholesterol amount (VT:0000180)	plasma total cholesterol level (CMO:0000585)	1	53863041	90532583	Rat
4889919	Bss86	Bone structure and strength QTL 86	4.1		tibia area (VT:1000281)	tibia midshaft total cross-sectional area (CMO:0001715)	1	53895117	82174945	Rat
4889929	Bss87	Bone structure and strength QTL 87	6.7		tibia area (VT:1000281)	tibia-fibula cortical bone endosteal cross-sectional area (CMO:0001722)	1	53895117	82174945	Rat
61342	Bp27	Blood pressure QTL 27	3.4	0.0006	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	1	56732668	98773277	Rat
2300164	Bmd44	Bone mineral density QTL 44	5.4	0.0001	lumbar vertebra mineral mass (VT:0010511)	volumetric bone mineral density (CMO:0001553)	1	56949932	101949932	Rat
2298545	Neuinf8	Neuroinflammation QTL 8	4.6		nervous system integrity trait (VT:0010566)	spinal cord beta-2 microglobulin mRNA level (CMO:0002125)	1	57336763	151090257	Rat
1300121	Hrtrt1	Heart rate QTL 1	3.7		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	1	65789093	115540829	Rat
7421628	Bp361	Blood pressure QTL 361		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	1	66023617	118608521	Rat

Markers in Region

M81342

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	68,954,651 - 68,954,790 (+)	MAPPER	mRatBN7.2
mRatBN7.2	14	76,987,337 - 76,987,476 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	82,272,415 - 82,272,553	NCBI	Rnor6.0
Rnor_6.0	1	72,506,586 - 72,506,724	NCBI	Rnor6.0
Rnor_5.0	14	82,961,971 - 82,962,109	UniSTS	Rnor5.0
Rnor_5.0	1	76,029,780 - 76,029,918	UniSTS	Rnor5.0
RGSC_v3.4	14	82,388,771 - 82,388,909	UniSTS	RGSC3.4
RGSC_v3.4	14	82,682,536 - 82,682,674	UniSTS	RGSC3.4
Celera	14	75,910,689 - 75,910,827	UniSTS
Celera	1	68,168,300 - 68,168,438	UniSTS
Cytogenetic Map	14	q21	UniSTS

RH129229

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	68,940,249 - 68,940,444 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	72,491,740 - 72,491,934	NCBI	Rnor6.0
Rnor_5.0	1	76,044,570 - 76,044,764	UniSTS	Rnor5.0
Celera	1	68,182,316 - 68,182,510	UniSTS

RH127661

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	1	68,940,283 - 68,940,492 (+)	MAPPER	mRatBN7.2
Rnor_6.0	1	72,491,774 - 72,491,982	NCBI	Rnor6.0
Rnor_5.0	1	76,044,522 - 76,044,730	UniSTS	Rnor5.0
Celera	1	68,182,268 - 68,182,476	UniSTS

RH132281

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	14	76,987,464 - 76,987,668 (+)	MAPPER	mRatBN7.2
mRatBN7.2	1	68,954,457 - 68,954,663 (+)	MAPPER	mRatBN7.2
Rnor_6.0	14	82,272,542 - 82,272,745	NCBI	Rnor6.0
Rnor_6.0	1	72,506,392 - 72,506,597	NCBI	Rnor6.0
Rnor_5.0	14	82,962,098 - 82,962,301	UniSTS	Rnor5.0
Rnor_5.0	1	76,029,907 - 76,030,112	UniSTS	Rnor5.0
RGSC_v3.4	14	82,682,663 - 82,682,866	UniSTS	RGSC3.4
Celera	14	75,910,816 - 75,911,019	UniSTS
Celera	1	68,168,427 - 68,168,632	UniSTS

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High
Medium	3	43	57	41	19	41	8	11	65	35	40	11	8
Low									9		1
Below cutoff

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001409142	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001409143	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_001059344	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_003748760	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039100618	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039100623	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474075	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000027	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Reference Sequences

RefSeq Acc Id:

ENSRNOT00000071971 ⟹ ENSRNOP00000066553

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0 Ensembl	1	72,491,780 - 72,509,431 (-)	Ensembl

RefSeq Acc Id:

ENSRNOT00000097188 ⟹ ENSRNOP00000094488

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	1	68,937,759 - 68,957,179 (-)	Ensembl

RefSeq Acc Id:

XM_003748760 ⟹ XP_003748808

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	68,940,177 - 68,957,225 (-)	NCBI
Rnor_6.0	1	72,491,667 - 72,509,433 (-)	NCBI
Rnor_5.0	1	76,027,564 - 76,044,837 (+)	NCBI

Sequence:

show sequence

GGCAGGCACGTAAGGGGAGCAGACCTCGTGACCAAAGCGGGCAAAACGGTGACCCAGCCCGGAA
CCAGTGACAGTCCAGTGGGCAAAGTGCCCTGAAGGGACCTAGTGGAGGGGCTGACTGGACTCGA
ACCTGGTATTGCTGGACAATGGCAGCAGCCAGGGCTAGCCTGGGCCGGATCCGCCCAGAGTCCT
CCATCCTGTTCCTATGTGACATGCAGGAGAAGTTTCGTCCCAGCATAGCCTACTTCCCACAGAT
TGTGTCAGTGGCTGCTCGAATGCTTAAGGTGGCCCGGCTGCTAGATGTCCCCATCTTGCTGACA
GAGCAGTACCCACAAGGCCTGGGCCCCACAGTTCCTGAGCTGGGCGCTCAGGGCATTAAGCCAG
TGAGCAAGACTTGCTTCAGCATGGTGCCCAGCTTACAGAAGGAGCTGGACAGGCGCTCCCAGCT
GCAGTCTGTGCTGCTCTGTGGCATCGAGACCCAAGCCTGCATCTTGAACACGGTTCTGGACCTC
CTTGACCGGGGACTGCAGGTCCATGTGGTGGTGGACGCCTGCTCTTCTCGAAGCCAGATTGACC
GGCTGGTGGCACTGGGCCGTATGAGACAGAGTGGAGCTTTCCTGTCCACCAGCGAATCACTCAT
TCTGCAGCTTGTGAGGGATGCTGCCCACCCCCAGTTCAAGGAGATTCAGAAGATCATTAAGGAG
CCAGCCCCAGACAGCGGGCTGCTGGGTCTATTCCAAGGTCAGAACCCCCTCTTGCTGAACTCCA
GGCCCTGACTGAGATGAGAGTGTTACTCTGTCATTGGTGGAAGCGGCTGCCCTGTGGGAGGGGA
GGGGTGTAATGCCTCCTGGTGCAAGAGCTGGTCCTGGAAAAGCAAAAGAGACTCCTGGGTGCTG
GAAGGGGTTGGGGACAGGAGGTTGACTGAAGAGGGGTGGAGGGGGAACTCTGCTTAGGTCTACC
TCACGAGCAGAGGGCAAAGAAGTGTCACAGACTAGGACTCATACTCTGAATAAACATTGATGTG
GCTGTGGACTGAAA

hide sequence

RefSeq Acc Id:

XM_039100618 ⟹ XP_038956546

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	68,940,177 - 68,957,178 (-)	NCBI

RefSeq Acc Id:

XM_039100623 ⟹ XP_038956551

RefSeq Status:

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	1	68,940,177 - 68,957,198 (-)	NCBI

Protein Sequences


Protein RefSeqs	NP_001396071	(Get FASTA)	NCBI Sequence Viewer
	NP_001396072	(Get FASTA)	NCBI Sequence Viewer
	XP_003748808	(Get FASTA)	NCBI Sequence Viewer
	XP_038956546	(Get FASTA)	NCBI Sequence Viewer
	XP_038956551	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL75869	(Get FASTA)	NCBI Sequence Viewer

Reference Sequences

RefSeq Acc Id:	XP_003748808 ⟸ XM_003748760
- Peptide Label:	isoform X1
- UniProtKB:	M0RAK2 (UniProtKB/TrEMBL)
- Sequence:	show sequence MAAARASLGRIRPESSILFLCDMQEKFRPSIAYFPQIVSVAARMLKVARLLDVPILLTEQYPQG LGPTVPELGAQGIKPVSKTCFSMVPSLQKELDRRSQLQSVLLCGIETQACILNTVLDLLDRGLQ VHVVVDACSSRSQIDRLVALGRMRQSGAFLSTSESLILQLVRDAAHPQFKEIQKIIKEPAPDSG LLGLFQGQNPLLLNSRP hide sequence

RefSeq Acc Id:

ENSRNOP00000066553 ⟸ ENSRNOT00000071971

RefSeq Acc Id:	XP_038956551 ⟸ XM_039100623
- Peptide Label:	isoform X2

RefSeq Acc Id:	XP_038956546 ⟸ XM_039100618
- Peptide Label:	isoform X1

RefSeq Acc Id:

ENSRNOP00000094488 ⟸ ENSRNOT00000097188

Protein Domains

Isochorismatase

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-M0RAK2-F1-model_v2	AlphaFold	M0RAK2	1-209	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13689709

Promoter ID:

EPDNEW_R217

Type:

initiation region

Name:

LOC684270_1

Description:

similar to isochorismatase domain containing 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	1	72,509,364 - 72,509,424	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1592677	AgrOrtholog
BioCyc Gene	G2FUF-60867	BioCyc
Ensembl Genes	ENSRNOG00000016829	UniProtKB/TrEMBL
	ENSRNOG00000050348	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Protein	ENSRNOP00000066553.3	UniProtKB/TrEMBL
	ENSRNOP00000094488	ENTREZGENE
	ENSRNOP00000094488.1	UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000071971.3	UniProtKB/TrEMBL
	ENSRNOT00000097188	ENTREZGENE
	ENSRNOT00000097188.1	UniProtKB/TrEMBL
Gene3D-CATH	3.40.50.850	UniProtKB/TrEMBL
InterPro	ISOC2	UniProtKB/TrEMBL
	Isochorismatase-like	UniProtKB/TrEMBL
	Isochorismatase-like_sf	UniProtKB/TrEMBL
KEGG Report	rno:684270	UniProtKB/TrEMBL
NCBI Gene	684270	ENTREZGENE
PANTHER	PTHR14119:SF4	UniProtKB/TrEMBL
Pfam	Isochorismatase	UniProtKB/TrEMBL
PhenoGen	Isoc2a	PhenoGen
Superfamily-SCOP	SSF52499	UniProtKB/TrEMBL
UniProt	A0A8I6GL72_RAT	UniProtKB/TrEMBL
	M0RAK2	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2022-10-27	Isoc2a	isochorismatase domain containing 2A	Isoc2a	isochorismatase domain containing 2a	Name changed	629549	APPROVED
2022-10-27	Isoc2a	isochorismatase domain containing 2a	LOC684270	similar to isochorismatase domain containing 2	Name and Symbol changed	629549	APPROVED
2006-11-20	LOC684270	similar to isochorismatase domain containing 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message