Pfdn2 (prefoldin subunit 2) - Rat Genome Database

Name: Pfdn2
Creator: Rat Genome Database
License: Creative Commons CC BY 4.0
Keywords: Rat Gene RGD Genome

Advanced Search (OLGA)

Gene: Pfdn2 (prefoldin subunit 2) Rattus norvegicus

Analyze

Symbol:

Pfdn2

Name:

prefoldin subunit 2

RGD ID:

1591406

Description:

Predicted to enable amyloid-beta binding activity; protein folding chaperone; and unfolded protein binding activity. Predicted to be involved in negative regulation of amyloid fibril formation; positive regulation of cytoskeleton organization; and protein folding. Predicted to be located in cytosol; mitochondrion; and nucleus. Predicted to be part of RPAP3/R2TP/prefoldin-like complex and prefoldin complex. Predicted to be active in cytoplasm. Orthologous to human PFDN2 (prefoldin subunit 2); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; bis(2-ethylhexyl) phthalate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

LOC685607; prefoldin 2; similar to Prefoldin subunit 2

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	PFDN2 (prefoldin subunit 2)	HGNC	EggNOG, Ensembl, HomoloGene, Inparanoid, NCBI, OMA, OrthoDB, OrthoMCL, Panther, PhylomeDB, Treefam
Mus musculus (house mouse):	Pfdn2 (prefoldin 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	Pfdn2 (prefoldin subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	PFDN2 (prefoldin subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	PFDN2 (prefoldin subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Pfdn2 (prefoldin subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	PFDN2 (prefoldin subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	PFDN2 (prefoldin subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Pfdn2 (prefoldin subunit 2)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Alliance orthologs ³
Homo sapiens (human):	PFDN2 (prefoldin subunit 2)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Pfdn2 (prefoldin 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	pfdn2 (prefoldin subunit 2)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	GIM4	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	Pfdn2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	pfd-2	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB)
Xenopus tropicalis (tropical clawed frog):	pfdn2	Alliance	DIOPT (Ensembl Compara\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	86,305,037 - 86,323,008 (+)	NCBI		GRCr8
mRatBN7.2	13	83,772,301 - 83,791,367 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	83,753,877 - 83,790,504 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	86,279,144 - 86,296,329 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	87,677,355 - 87,694,540 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	84,913,445 - 84,930,319 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	89,725,113 - 89,743,849 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	89,725,869 - 89,743,848 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	94,352,458 - 94,371,424 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	87,246,113 - 87,263,293 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	13	83,404,065 - 83,421,027 (+)	NCBI		Celera
Cytogenetic Map	13	q24	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

autoimmune interstitial lung, joint, and kidney disease (ISO)

gastrointestinal stromal tumor (ISO)

parathyroid carcinoma (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(1->4)-beta-D-glucan (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2-hydroxypropanoic acid (ISO)

3-isobutyl-1-methyl-7H-xanthine (ISO)

4,4'-diaminodiphenylmethane (ISO)

aflatoxin B1 (ISO)

arsane (ISO)

arsenic atom (ISO)

arsenite(3-) (ISO)

atrazine (ISO)

benzene (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (EXP)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

cadmium dichloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

dexamethasone (ISO)

dinophysistoxin 1 (ISO)

ethanol (ISO)

folic acid (ISO)

gentamycin (EXP)

hydrogen peroxide (ISO)

indometacin (ISO)

irinotecan (ISO)

ivermectin (ISO)

leflunomide (ISO)

methylparaben (ISO)

okadaic acid (ISO)

paracetamol (ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenobarbital (ISO)

rac-lactic acid (ISO)

SB 431542 (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

sodium fluoride (ISO)

sunitinib (ISO)

tetrachloromethane (ISO)

thapsigargin (EXP)

titanium dioxide (ISO)

trichloroethene (ISO)

valdecoxib (EXP)

valproic acid (EXP,ISO)

vitamin E (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

negative regulation of amyloid fibril formation (ISO)

positive regulation of cytoskeleton organization (ISO)

protein folding (IBA,IEA,ISO)

Cellular Component

cytoplasm (IBA,ISO)

cytosol (ISO)

mitochondrion (ISO)

nucleus (ISO)

prefoldin complex (IEA,ISO)

RPAP3/R2TP/prefoldin-like complex (ISO)

Molecular Function

amyloid-beta binding (ISO)

protein binding (ISO)

protein folding chaperone (IBA,ISO)

unfolded protein binding (IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:9630229	PMID:12477932	PMID:16876117	PMID:17936702	PMID:23376485	PMID:31904090

Genomics

Comparative Map Data

Pfdn2
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	13	86,305,037 - 86,323,008 (+)	NCBI		GRCr8
mRatBN7.2	13	83,772,301 - 83,791,367 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	13	83,753,877 - 83,790,504 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	13	86,279,144 - 86,296,329 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	13	87,677,355 - 87,694,540 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	13	84,913,445 - 84,930,319 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	13	89,725,113 - 89,743,849 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	13	89,725,869 - 89,743,848 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	13	94,352,458 - 94,371,424 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	13	87,246,113 - 87,263,293 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	13	83,404,065 - 83,421,027 (+)	NCBI		Celera
Cytogenetic Map	13	q24	NCBI

PFDN2
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	1	161,100,561 - 161,118,037 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	1	161,100,556 - 161,118,055 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	1	161,070,351 - 161,087,827 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	1	159,336,970 - 159,354,490 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	1	157,883,419 - 157,900,908	NCBI
Celera	1	134,137,521 - 134,155,028 (-)	NCBI		Celera
Cytogenetic Map	1	q23.3	NCBI
HuRef	1	132,427,757 - 132,445,264 (-)	NCBI		HuRef
CHM1_1	1	162,466,585 - 162,484,107 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	1	160,238,042 - 160,255,506 (-)	NCBI		T2T-CHM13v2.0

Pfdn2
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	1	171,172,522 - 171,186,822 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	1	171,173,238 - 171,186,822 (+)	Ensembl		GRCm39 Ensembl
GRCm38	1	171,344,954 - 171,359,254 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	1	171,345,670 - 171,359,254 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	1	173,275,830 - 173,288,301 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	1	173,182,374 - 173,194,845 (+)	NCBI		MGSCv36	mm8
Celera	1	173,797,189 - 173,809,573 (+)	NCBI		Celera
Cytogenetic Map	1	H3	NCBI
cM Map	1	79.35	NCBI

Pfdn2
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955468	12,866,216 - 12,882,903 (-)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955468	12,868,582 - 12,882,884 (-)	NCBI	ChiLan1.0	ChiLan1.0

PFDN2
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	1	88,733,917 - 88,751,458 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	1	88,424,271 - 88,441,791 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	1	136,512,982 - 136,530,524 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	1	140,426,205 - 140,443,773 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	1	140,426,205 - 140,443,773 (-)	Ensembl	panpan1.1		panPan2

PFDN2
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	38	21,355,622 - 21,367,623 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	38	21,355,678 - 21,367,619 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	38	21,429,654 - 21,441,700 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	38	21,473,147 - 21,485,201 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	38	21,473,208 - 21,485,197 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	38	21,361,301 - 21,373,529 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	38	21,775,330 - 21,787,369 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	38	22,184,560 - 22,196,824 (+)	NCBI		UU_Cfam_GSD_1.0

Pfdn2
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405058	7,204,946 - 7,223,919 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936903	413,604 - 432,566 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936903	413,604 - 432,561 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

PFDN2
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	4	89,326,798 - 89,342,325 (+)	Ensembl	Sscrofa11.1		susScr11	Sscrofa11.1
Sscrofa11.1	4	89,326,781 - 89,341,608 (+)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1
Sscrofa10.2	4	97,183,746 - 97,198,386 (+)	NCBI	Sscrofa10.2	Sscrofa10.2	susScr3

PFDN2
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	20	2,862,695 - 2,880,540 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	20	2,862,738 - 2,880,534 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666038	1,909,920 - 1,928,131 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Pfdn2
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624794	257,822 - 270,546 (+)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624794	257,740 - 270,776 (+)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Pfdn2
77 total Variants

miRNA Target Status

Predicted Target Of

	Summary Value
Count of predictions:	175
Count of miRNA genes:	129
Interacting mature miRNAs:	156
Transcripts:	ENSRNOT00000005346
Prediction methods:	Miranda, Targetscan
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
7207885	Glom27	Glomerulus QTL 27	3.9		kidney glomerulus integrity trait (VT:0010546)	kidney crescentic glomeruli count to kidney normal glomeruli count ratio (CMO:0002139)	13	20605871	101339738	Rat
738027	Lnnr6	Liver neoplastic nodule remodeling QTL 6	3.3		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	74862117	85581182	Rat
1298066	Bp159	Blood pressure QTL 159		0.004	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	46088046	91088046	Rat
738026	Lnnr5	Liver neoplastic nodule remodeling QTL 5	3.29		liver integrity trait (VT:0010547)	liver remodeling tumorous lesion number (CMO:0001461)	13	59874408	85581182	Rat
70181	BpQTLcluster11	Blood pressure QTL cluster 11	6.922		arterial blood pressure trait (VT:2000000)	absolute change in mean arterial blood pressure (CMO:0000533)	13	31241331	93395974	Rat
2293702	Bss34	Bone structure and strength QTL 34	4.61	0.0001	femur strength trait (VT:0010010)	femur midshaft polar moment of inertia (CMO:0001669)	13	65103704	106807694	Rat
1354621	Rf47	Renal function QTL 47	3.7		kidney renin amount (VT:0010559)	kidney renin level (CMO:0002166)	13	30395351	101056920	Rat
12879471	Bp398	Blood pressure QTL 398			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45514719	90514719	Rat
1354655	Bp241	Blood pressure QTL 241	3.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	56056920	101056920	Rat
4889606	Gluco63	Glucose level QTL 63	2.86	0.003	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	13	80753256	106807694	Rat
8655945	Rf61	Renal function QTL 61	3.6		blood creatinine amount (VT:0005328)	creatinine clearance (CMO:0000765)	13	69060519	86800898	Rat
71119	Thym2	Thymus enlargement QTL 2	3.8		thymus mass (VT:0004954)	thymus weight to body weight ratio (CMO:0000612)	13	46197976	84753113	Rat
12879444	Bp397	Blood pressure QTL 397			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45049404	90049404	Rat
1331783	Bp221	Blood pressure QTL 221	3.72886		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	69060519	86800898	Rat
8655959	Pur32	Proteinuria QTL 32	8.4		urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	13	74023918	97213863	Rat
1641901	Alcrsp6	Alcohol response QTL 6			response to alcohol trait (VT:0010489)	duration of loss of righting reflex (CMO:0002289)	13	52362171	97362171	Rat
12879441	Bp396	Blood pressure QTL 396			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	45699983	90699983	Rat
2293687	Bss26	Bone structure and strength QTL 26	4.6	0.0001	femur morphology trait (VT:0000559)	femur cross-sectional area (CMO:0001661)	13	65103704	106807694	Rat
1300166	Kidm6	Kidney mass QTL 6	3.93		kidney mass (VT:0002707)	single kidney wet weight to body weight ratio (CMO:0000622)	13	69060519	86800898	Rat
619615	Bp80	Blood pressure QTL 80		0.0354	arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	39754544	84754544	Rat
12879475	Bp400	Blood pressure QTL 400			arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	13	61825626	106807694	Rat
1581570	Eae17	Experimental allergic encephalomyelitis QTL 17	4.1		nervous system integrity trait (VT:0010566)	experimental autoimmune encephalomyelitis incidence/prevalence measurement (CMO:0001046)	13	8897350	101631289	Rat
1354666	Bp244	Blood pressure QTL 244	4.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	13	1	101056920	Rat
2293341	Glom15	Glomerulus QTL 15	9.1		kidney glomerulus integrity trait (VT:0010546)	kidney sclerotic glomeruli count to total glomeruli count ratio (CMO:0001269)	13	74862117	101339893	Rat

Markers in Region

BE118958

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	83,784,433 - 83,784,635 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	89,736,915 - 89,737,116	NCBI	Rnor6.0
Rnor_5.0	13	94,364,490 - 94,364,691	UniSTS	Rnor5.0
RGSC_v3.4	13	87,257,164 - 87,257,365	UniSTS	RGSC3.4
Celera	13	83,414,898 - 83,415,099	UniSTS
RH 3.4 Map	13	554.9	UniSTS
Cytogenetic Map	13	q24	UniSTS

RH128828

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	83,791,099 - 83,791,302 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	89,743,581 - 89,743,783	NCBI	Rnor6.0
Rnor_5.0	13	94,371,156 - 94,371,358	UniSTS	Rnor5.0
RGSC_v3.4	13	87,263,830 - 87,264,032	UniSTS	RGSC3.4
Celera	13	83,421,564 - 83,421,766	UniSTS
RH 3.4 Map	13	551.9	UniSTS
Cytogenetic Map	13	q24	UniSTS

BF387362

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	83,772,326 - 83,772,511 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	89,724,809 - 89,724,993	NCBI	Rnor6.0
Rnor_5.0	13	94,352,142 - 94,352,326	UniSTS	Rnor5.0
RGSC_v3.4	13	87,245,058 - 87,245,242	UniSTS	RGSC3.4
Celera	13	83,403,010 - 83,403,194	UniSTS
RH 3.4 Map	13	554.6	UniSTS
Cytogenetic Map	13	q24	UniSTS

W57327

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	83,772,072 - 83,772,649 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	89,724,555 - 89,725,131	NCBI	Rnor6.0
Rnor_5.0	13	94,351,888 - 94,352,464	UniSTS	Rnor5.0
RGSC_v3.4	13	87,244,804 - 87,245,380	UniSTS	RGSC3.4
Celera	13	83,402,756 - 83,403,332	UniSTS
Cytogenetic Map	13	q24	UniSTS

D1S2071E

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	83,790,087 - 83,790,214 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	89,742,569 - 89,742,695	NCBI	Rnor6.0
Rnor_5.0	13	94,370,144 - 94,370,270	UniSTS	Rnor5.0
RGSC_v3.4	13	87,262,818 - 87,262,944	UniSTS	RGSC3.4
Celera	13	83,420,552 - 83,420,678	UniSTS
Cytogenetic Map	13	q24	UniSTS

PMC21147P2

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	13	83,772,584 - 83,772,678 (+)	MAPPER	mRatBN7.2
Rnor_6.0	13	89,725,067 - 89,725,160	NCBI	Rnor6.0
Rnor_5.0	13	94,352,400 - 94,352,493	UniSTS	Rnor5.0
RGSC_v3.4	13	87,245,316 - 87,245,409	UniSTS	RGSC3.4
Celera	13	83,403,268 - 83,403,361	UniSTS
Cytogenetic Map	13	q24	UniSTS

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109476	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_017598937	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272606	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_063272607	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC099236	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	AC125857	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	BC158649	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH473985	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000013	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000005346 ⟹ ENSRNOP00000005346

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	83,773,381 - 83,790,504 (+)	Ensembl
Rnor_6.0 Ensembl	13	89,725,869 - 89,743,848 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103078 ⟹ ENSRNOP00000089716

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	83,787,606 - 83,790,504 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000103808 ⟹ ENSRNOP00000090419

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	13	83,753,877 - 83,790,504 (+)	Ensembl

RefSeq Acc Id:

NM_001109476 ⟹ NP_001102946

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	86,305,828 - 86,323,008 (+)	NCBI
mRatBN7.2	13	83,773,382 - 83,790,563 (+)	NCBI
Rnor_6.0	13	89,725,864 - 89,743,044 (+)	NCBI
Rnor_5.0	13	94,352,458 - 94,371,424 (+)	NCBI
RGSC_v3.4	13	87,246,113 - 87,263,293 (+)	RGD
Celera	13	83,404,065 - 83,421,027 (+)	RGD

Sequence:

show sequence

GGTGGGGAAGATGGCGGACAGCAGCGGTCGTGTGGGCAAGAGCGGCGGGAGTGGCACGGGGAAG
GGGGCGGTGTCGGCGGAACAGGTAATTGCTGGCTTTAATCGCCTTCGGCAGGAACAGAGGGGCT
TGGCCTCCAAAGCAGCTGAGCTGGAGATGGAACTGAATGAGCATAGCCTGGTGATCGATACGCT
GAAGGAAGTGGATGAGACCCGCAAGTGCTACCGCATGGTTGGCGGTGTGCTGGTAGAGCGGACG
GTCAAGGAGGTGCTGCCTGCCTTGGAGGGTAACAAGGAGCAGATACAAAAGATCATTGAGACAC
TGTCACAGCAGCTTCAGGCAAAGGGAAAAGAACTCAATGAATTCCGGGAAAAGCACAACATTCG
TCTTATGGGAGAAGATGAGAAGCCAGCAGCCAAGGAAAACTCAGAAGGAGCTGGGGCTAAGTCC
AGCTCAGCAGGGGTGCTGGTCTCTTAGGGACTAAGGCCTCTGCATTCTATTTTACCCTGATTCC
CACTTCTAATTTCTTTTTATTGTTATTATTATTTTTCTGCTATTGTAATTTTTTTGTTGTTGTT
AATTAAATGTTTTGGTCAAATACTTAACTGTAGCCTGAAACTCTCTTACTTAGGGCTACACTGA
CAGCATACAGCTGGGCATGGTGGCAGACATATCTTAGTGCTGGGGACACAACAGGAGGCAGATC
TCTGAGTTCCAGGCCAGCCCAGTGTACAAAGCGAGTCCGCAGTCATCCAAGGCTATATAGTGAG
ACCCTGCCTCAAACAAAACAGAAAGATAACTTGGTTTTGTTCTTTCTACCAGGTTAATGGCTCA
CACTGTCAGAAAGGAGCCACAGTTTGCCTTTCCCTT

hide sequence

RefSeq Acc Id:

XM_063272606 ⟹ XP_063128676

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	86,305,037 - 86,322,743 (+)	NCBI

RefSeq Acc Id:

XM_063272607 ⟹ XP_063128677

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	13	86,305,801 - 86,322,743 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001102946	(Get FASTA)	NCBI Sequence Viewer
	XP_063128676	(Get FASTA)	NCBI Sequence Viewer
	XP_063128677	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	AAI58650	(Get FASTA)	NCBI Sequence Viewer
	B0BN18	(Get FASTA)	NCBI Sequence Viewer
	EDL94642	(Get FASTA)	NCBI Sequence Viewer
	EDL94643	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000005346.3
	ENSRNOP00000089716.1
	ENSRNOP00000090419.1

RefSeq Acc Id:	NP_001102946 ⟸ NM_001109476
- UniProtKB:	B0BN18 (UniProtKB/Swiss-Prot), A6JFY7 (UniProtKB/TrEMBL), A0A8I6A7V9 (UniProtKB/TrEMBL)
- Sequence:	show sequence MADSSGRVGKSGGSGTGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEV DETRKCYRMVGGVLVERTVKEVLPALEGNKEQIQKIIETLSQQLQAKGKELNEFREKHNIRLMG EDEKPAAKENSEGAGAKSSSAGVLVS hide sequence

Ensembl Acc Id:

ENSRNOP00000005346 ⟸ ENSRNOT00000005346

Ensembl Acc Id:

ENSRNOP00000090419 ⟸ ENSRNOT00000103808

Ensembl Acc Id:

ENSRNOP00000089716 ⟸ ENSRNOT00000103078

RefSeq Acc Id:	XP_063128676 ⟸ XM_063272606
- Peptide Label:	isoform X1
- UniProtKB:	A0A8I6A7V9 (UniProtKB/TrEMBL), A0A8I6AN20 (UniProtKB/TrEMBL), A6JFY6 (UniProtKB/TrEMBL)

RefSeq Acc Id:	XP_063128677 ⟸ XM_063272607
- Peptide Label:	isoform X2

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-B0BN18-F1-model_v2	AlphaFold	B0BN18	1-154	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13699007

Promoter ID:

EPDNEW_R9530

Type:

multiple initiation site

Name:

Pfdn2_1

Description:

prefoldin subunit 2

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	13	89,725,861 - 89,725,921	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1591406	AgrOrtholog
BioCyc Gene	G2FUF-17372	BioCyc
Ensembl Genes	ENSRNOG00000003983	Ensembl
	ENSRNOG00000066932	Ensembl, UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000005346.5	UniProtKB/Swiss-Prot
	ENSRNOT00000103078.1	UniProtKB/TrEMBL
	ENSRNOT00000103808.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.287.370	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
IMAGE_CLONE	IMAGE:8367459	IMAGE-MGC_LOAD
InterPro	PFD2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PFD_beta-like	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	Prefoldin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
KEGG Report	rno:685607	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
MGC_CLONE	MGC:187626	IMAGE-MGC_LOAD
NCBI Gene	685607	ENTREZGENE
PANTHER	PREFOLDIN SUBUNIT 2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
	PTHR13303	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
Pfam	Prefoldin_2	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
PhenoGen	Pfdn2	PhenoGen
RatGTEx	ENSRNOG00000003983	RatGTEx
	ENSRNOG00000066932	RatGTEx
Superfamily-SCOP	Prefoldin	UniProtKB/Swiss-Prot, UniProtKB/TrEMBL
UniProt	A0A8I6A7V9	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6AN20	ENTREZGENE, UniProtKB/TrEMBL
	A6JFY6	ENTREZGENE, UniProtKB/TrEMBL
	A6JFY7	ENTREZGENE, UniProtKB/TrEMBL
	B0BN18	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2009-02-26	Pfdn2	prefoldin subunit 2	Pfdn2	prefoldin 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-07-08	Pfdn2	prefoldin 2	LOC678975	similar to Prefoldin subunit 2	Data merged from RGD:1594256	1643240	APPROVED
2008-03-11	Pfdn2	prefoldin 2	Pfdn2	prefoldin subunit 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-05	Pfdn2	prefoldin subunit 2	LOC685607	similar to Prefoldin subunit 2	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC685607	similar to Prefoldin subunit 2			Symbol and Name status set to provisional	70820	PROVISIONAL
2006-11-20	LOC678975	similar to Prefoldin subunit 2			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar