H1f5 (H1.5 linker histone, cluster member)

	Submit Data \| Help \| Video Tutorials \| News \| Publications \| Download \| REST API \| Citing RGD \| Contact
	Search RGD Grant Resources Citing RGD About Us Contact Us Genes QTLs Strains Markers Community Projects Genome Information Ontologies Cell Lines References Download Submit Data OntoMate (Literature Search) JBrowse (Genome Browser) Synteny Browser (VCMap) (beta) Variant Visualizer Multi-Ontology Enrichment (MOET) Gene-Ortholog Location Finder (GOLF) InterViewer (Protein-Protein Interactions) PhenoMiner (Quatitative Phenotypes) Gene Annotator OLGA (Gene List Generator) AllianceMine GViewer (Genome Viewer) Aging & Age-Related Disease Cancer & Neoplastic Disease Cardiovascular Disease COVID-19 Developmental Disease Diabetes Hematologic Disease Immune & Inflammatory Disease Infectious Disease Liver Disease Neurological Disease Obesity & Metabolic Syndrome Renal Disease Respiratory Disease Sensory Organ Disease Find Models new Genetic Models Autism Models Rat PhenoMiner (Quantitative Phenotypes) Chinchilla PhenoMiner Expected Ranges (Quantitative Phenotype) PhenoMiner Term Comparison Hybrid Rat Diversity Panel Phenotypes GERRC (Gene Editing Rat Resource Center) Phenotypes in Other Animal Models Animal Husbandry Strain Medical Records Phylogenetics Strain Availability Calendar Rats 101 Submissions Photo Archive Pathways Rat Community Forum Directory of Rat Laboratories Video Tutorials News RGD Publications RGD Presentations Archive Nomenclature Guidelines Resource Links Laboratory Resources Employment Resources
	Advanced Search (OLGA)

Gene: H1f5 (H1.5 linker histone, cluster member) Rattus norvegicus

Analyze

Symbol:

H1f5

Name:

H1.5 linker histone, cluster member

RGD ID:

1590638

Description:

Predicted to enable double-stranded DNA binding activity; histone deacetylase binding activity; and nucleosomal DNA binding activity. Predicted to be involved in several processes, including establishment of protein localization to chromatin; negative regulation of nucleobase-containing compound metabolic process; and protein stabilization. Predicted to act upstream of or within muscle organ development. Predicted to be located in chromosome; nucleolus; and nucleoplasm. Predicted to be part of heterochromatin. Predicted to be active in nucleus. Orthologous to human H1-5 (H1.5 linker histone, cluster member); INTERACTS WITH 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine; 3-chloropropane-1,2-diol.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

H1-5; Hist1h1b; histone cluster 1 H1 family member b; histone cluster 1, H1b; histone H1.5; LOC680522; similar to Histone H1.5 (H1 VAR.5) (H1b)

RGD Orthologs

Alliance Genes

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	H1-5 (H1.5 linker histone, cluster member)	HGNC	Ensembl, Inparanoid, NCBI, Panther
Mus musculus (house mouse):	H1f5 (H1.5 linker histone, cluster member)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chinchilla lanigera (long-tailed chinchilla):	H1-5 (H1.5 linker histone, cluster member)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	H1-5 (H1.5 linker histone, cluster member)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	H1-5 (H1.5 linker histone, cluster member)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	H1-5 (H1.5 linker histone, cluster member)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	H1-5 (H1.5 linker histone, cluster member)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	H1-5 (H1.5 linker histone, cluster member)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	H1-1 (H1.1 linker histone, cluster member)	HGNC	OrthoDB
Homo sapiens (human):	H1-3 (H1.3 linker histone, cluster member)	HGNC	OrthoDB
Homo sapiens (human):	H1-2 (H1.2 linker histone, cluster member)	HGNC	OrthoDB
Homo sapiens (human):	H1-4 (H1.4 linker histone, cluster member)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	H1-5 (H1.5 linker histone, cluster member)	Alliance	DIOPT (Ensembl Compara\|HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	H1f5 (H1.5 linker histone, cluster member)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	si:ch73-368j24.12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|SonicParanoid)
Danio rerio (zebrafish):	zgc:153405	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	HHO1	Alliance	DIOPT (Hieranoid\|InParanoid\|PANTHER)
Drosophila melanogaster (fruit fly):	His1:CG33825	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Caenorhabditis elegans (roundworm):	hil-2	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA)
Caenorhabditis elegans (roundworm):	hil-3	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA)
Caenorhabditis elegans (roundworm):	hil-4	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA)
Caenorhabditis elegans (roundworm):	hil-5	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA)
Caenorhabditis elegans (roundworm):	hil-6	Alliance	DIOPT (Ensembl Compara\|InParanoid\|OMA)
Drosophila melanogaster (fruit fly):	His1:CG33801	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33807	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33834	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33861	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33813	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33864	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33846	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33819	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33849	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33810	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33837	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33831	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33822	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33858	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33840	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33855	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33843	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33816	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33852	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG31617	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33804	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Drosophila melanogaster (fruit fly):	His1:CG33828	Alliance	DIOPT (InParanoid\|OrthoFinder\|PANTHER\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	XB5900552 [provisional]	Alliance	DIOPT (Hieranoid\|InParanoid\|OMA\|OrthoFinder\|PANTHER\|SonicParanoid)

Latest Assembly:

mRatBN7.2 - mRatBN7.2 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	17	42,726,132 - 42,727,162 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	42,726,127 - 42,769,160 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	44,775,821 - 44,776,489 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	49,534,913 - 49,535,581 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	44,025,883 - 44,026,551 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	44,766,313 - 44,766,981 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	44,766,313 - 44,766,981 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	58,699,738 - 58,700,406 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	50,360,616 - 50,361,284 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	17	53,734,625 - 53,735,293 (-)	NCBI		Celera
Cytogenetic Map	17	p11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

genetic disease (ISO)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(-)-epigallocatechin 3-gallate (ISO)

1,2-dimethylhydrazine (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

3,3',5-triiodo-L-thyronine (ISO)

3-chloropropane-1,2-diol (EXP)

4,4'-diaminodiphenylmethane (ISO)

6-propyl-2-thiouracil (EXP)

acetamide (EXP)

acrylamide (EXP)

aflatoxin B1 (EXP)

all-trans-retinoic acid (ISO)

benzo[a]pyrene (ISO)

benzo[b]fluoranthene (ISO)

bisphenol A (EXP,ISO)

Bisphenol B (ISO)

bisphenol F (ISO)

caffeine (ISO)

calcitriol (ISO)

cannabidiol (ISO)

carbon nanotube (ISO)

chlormequat chloride (EXP)

cisplatin (ISO)

cobalt dichloride (ISO)

copper atom (ISO)

copper(0) (ISO)

copper(II) sulfate (ISO)

coumarin (ISO)

Cuprizon (EXP)

deoxynivalenol (ISO)

dibenz[a,h]anthracene (ISO)

dichloroacetic acid (ISO)

dimethylarsinous acid (ISO)

dioxygen (ISO)

dopamine (ISO)

doxorubicin (ISO)

folic acid (ISO)

fulvestrant (ISO)

genistein (ISO)

glycidol (EXP)

hydrogen peroxide (ISO)

hydroquinone (ISO)

lipopolysaccharide (ISO)

lucanthone (ISO)

menadione (ISO)

methotrexate (ISO)

methylisothiazolinone (ISO)

N-methyl-4-phenylpyridinium (ISO)

N-Nitrosopyrrolidine (ISO)

nobiletin (EXP,ISO)

phenobarbital (ISO)

picene (ISO)

potassium chromate (ISO)

progesterone (ISO)

quercetin (ISO)

rotenone (EXP)

S-(1,2-dichlorovinyl)-L-cysteine (ISO)

silicon dioxide (ISO)

silver(1+) nitrate (ISO)

sodium arsenite (ISO)

sunitinib (ISO)

testosterone (ISO)

titanium dioxide (EXP,ISO)

trichloroethene (ISO)

trimellitic anhydride (ISO)

triptonide (ISO)

trovafloxacin (ISO)

versicolorin A (ISO)

vinclozolin (EXP)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

chromatin organization (ISO)

chromosome condensation (IBA)

establishment of protein localization to chromatin (ISO)

muscle organ development (ISO)

negative regulation of DNA recombination (IBA)

negative regulation of transcription by RNA polymerase II (ISO)

nucleosome assembly (IEA)

protein stabilization (ISO)

Cellular Component

chromatin (ISO)

chromosome (ISO)

heterochromatin (ISO)

nucleolus (ISO)

nucleoplasm (ISO)

nucleosome (IEA)

nucleus (IBA,ISO)

Molecular Function

chromatin DNA binding (ISO)

DNA binding (ISO)

double-stranded DNA binding (IBA)

histone deacetylase binding (ISO)

nucleosomal DNA binding (IBA)

protein binding (ISO)

structural constituent of chromatin (IEA)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	GOA pipeline	RGD automated data pipeline
3.	ClinVar Automated Import and Annotation Pipeline	RGD automated import pipeline for ClinVar variants, variant-to-disease annotations and gene-to-disease annotations
4.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:9182532	PMID:15192231	PMID:15562002	PMID:15911621	PMID:16854843	PMID:19882353	PMID:21383955	PMID:22658674	PMID:22956909	PMID:23106098	PMID:23376485	PMID:25931508
PMID:30053369

Genomics

Comparative Map Data

H1f5
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
mRatBN7.2	17	42,726,132 - 42,727,162 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	17	42,726,127 - 42,769,160 (+)	Ensembl		mRatBN7.2 Ensembl
UTH_Rnor_SHR_Utx	17	44,775,821 - 44,776,489 (+)	NCBI	Rnor_SHR	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	17	49,534,913 - 49,535,581 (+)	NCBI	Rnor_SHRSP	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	17	44,025,883 - 44,026,551 (+)	NCBI	Rnor_WKY	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	17	44,766,313 - 44,766,981 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	17	44,766,313 - 44,766,981 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	17	58,699,738 - 58,700,406 (-)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
RGSC_v3.4	17	50,360,616 - 50,361,284 (+)	NCBI	RGSC3.4	RGSC_v3.4	rn4	RGSC3.4
Celera	17	53,734,625 - 53,735,293 (-)	NCBI		Celera
Cytogenetic Map	17	p11	NCBI

H1-5
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	6	27,866,792 - 27,867,588 (-)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	6	27,866,792 - 27,867,588 (-)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	6	27,834,570 - 27,835,366 (-)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	6	27,942,549 - 27,943,404 (-)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	6	27,942,548 - 27,943,338	NCBI
Celera	6	29,440,606 - 29,441,461 (-)	NCBI		Celera
Cytogenetic Map	6	p22.1	NCBI
HuRef	6	27,642,254 - 27,643,043 (-)	NCBI		HuRef
CHM1_1	6	27,836,746 - 27,837,535 (-)	NCBI		CHM1_1
T2T-CHM13v2.0	6	27,736,463 - 27,737,259 (-)	NCBI		T2T-CHM13v2.0

H1f5
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	13	21,964,002 - 21,964,795 (-)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	13	21,964,053 - 21,964,795 (-)	Ensembl		GRCm39 Ensembl
GRCm38	13	21,779,832 - 21,780,625 (-)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	13	21,779,883 - 21,780,625 (-)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	13	21,871,752 - 21,872,423 (-)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	13	21,787,348 - 21,788,019 (-)	NCBI		MGSCv36	mm8
Celera	13	22,050,751 - 22,051,422 (-)	NCBI		Celera
Cytogenetic Map	13	A3.1	NCBI
cM Map	13	7.97	NCBI

H1-5
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955465	13,391,201 - 13,391,881 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955465	13,390,856 - 13,391,994 (+)	NCBI	ChiLan1.0	ChiLan1.0

H1-5
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1	6	38,511,446 - 38,512,242 (-)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	6	27,697,071 - 27,697,949 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3
PanPan1.1	6	28,368,652 - 28,372,137 (-)	NCBI	panpan1.1	PanPan1.1	panPan2
PanPan1.1 Ensembl	6	28,371,430 - 28,372,110 (-)	Ensembl	panpan1.1		panPan2

H1-5
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	35	25,045,883 - 25,046,775 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	35	25,046,023 - 25,046,703 (-)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	35	24,901,373 - 24,902,210 (-)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	35	25,234,318 - 25,235,941 (-)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	35	25,235,215 - 25,235,895 (-)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	35	25,009,364 - 25,010,914 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	35	25,062,515 - 25,064,067 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	35	26,526,424 - 26,528,052 (-)	NCBI		UU_Cfam_GSD_1.0

H1-5
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024404946	457,032 - 457,757 (+)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936671	3,163,825 - 3,164,505 (-)	Ensembl	SpeTri2.0
SpeTri2.0	NW_004936671	3,163,792 - 3,164,532 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

H1-5
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1	7	21,621,863 - 21,622,646 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

H1-5
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	17	44,663,976 - 44,664,753 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	17	44,664,042 - 44,664,719 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666044	27,552,570 - 27,553,519 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Variants

Variants in H1f5
2 total Variants

QTLs in Region (mRatBN7.2)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
1354658	Spl8	Serum phospholipid level QTL 8	3.8		blood VLDL phospholipid amount (VT:0010507)	blood very low density lipoprotein phospholipid level (CMO:0001571)	17	1	60781592	Rat
1354581	Bp247	Blood pressure QTL 247	4.5		arterial blood pressure trait (VT:2000000)	pulse pressure (CMO:0000292)	17	1	69599340	Rat
1354662	Rf49	Renal function QTL 49	2.9		blood creatinine amount (VT:0005328)	plasma creatinine level (CMO:0000537)	17	1	69599340	Rat
1354596	Bw32	Body weight QTL 32	4.5		body mass (VT:0001259)	body weight (CMO:0000012)	17	4299130	60781592	Rat
1354630	Cm34	Cardiac mass QTL 34	8.7		heart left ventricle mass (VT:0007031)	heart left ventricle wet weight (CMO:0000071)	17	4299130	69599340	Rat
1354638	Insul1	Insulin level QTL 1	4.8		blood insulin amount (VT:0001560)	plasma insulin level (CMO:0000342)	17	4299130	69599340	Rat
1354651	Lmblg2	Limb length QTL 2	6		tibia length (VT:0004357)	tibia length (CMO:0000450)	17	4299130	69599340	Rat
2303627	Vencon8	Ventilatory control QTL 8		0.001	respiration trait (VT:0001943)	tidal volume (CMO:0000222)	17	4528038	49528038	Rat
10054088	Scort28	Serum corticosterone level QTL 28	2.04	0.0102	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	17	4528038	49528038	Rat
2303561	Bw91	Body weight QTL 91	2		body mass (VT:0001259)	body weight (CMO:0000012)	17	8868462	53868462	Rat
1331765	Hrtrt15	Heart rate QTL 15	4.094		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	17	15330613	55836425	Rat
1354640	Scl32	Serum cholesterol level QTL 32	5.4		blood HDL cholesterol amount (VT:0000184)	blood high density lipoprotein cholesterol level (CMO:0000052)	17	15781592	60781592	Rat
1354659	Scl68	Serum cholesterol level QTL 68	3.9		blood VLDL cholesterol amount (VT:0005144)	blood very low density lipoprotein cholesterol level (CMO:0000648)	17	15781592	60781592	Rat
7394837	Memor18	Memory QTL 18			exploratory behavior trait (VT:0010471)	measurement of voluntary locomotion into, out of or within a discrete space in an experimental apparatus (CMO:0000957)	17	18640182	63640182	Rat
1354628	Stl13	Serum triglyceride level QTL 13	3.8		blood triglyceride amount (VT:0002644)	blood triglyceride level (CMO:0000118)	17	21293039	60781592	Rat
70157	Niddm32	Non-insulin dependent diabetes mellitus QTL 32	4.34		blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	22454924	50909196	Rat
61394	Bp8	Blood pressure QTL 8	2.2		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	23080567	59555013	Rat
7488966	Bp370	Blood pressure QTL 370		0.001	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	57246843	Rat
12903978	Cm118	Cardiac mass QTL 118		0.001	heart mass (VT:0007028)	heart wet weight to body weight ratio (CMO:0002408)	17	23653184	68653184	Rat
12903979	Cm119	Cardiac mass QTL 119		0.001	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	23653184	68653184	Rat
12903980	Cm120	Cardiac mass QTL 120		0.002	heart right ventricle mass (VT:0007033)	heart right ventricle weight to body weight ratio (CMO:0000914)	17	23653184	68653184	Rat
12903981	Am17	Aortic mass QTL 17		0.001	aorta mass (VT:0002845)	aorta weight to aorta length to body weight ratio (CMO:0002722)	17	23653184	68653184	Rat
1559055	Bp278	Blood pressure QTL 278		0.04	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	23653184	68653184	Rat
12903982	Kidm70	Kidney mass QTL 70		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	23653184	70974005	Rat
1354619	Bp242	Blood pressure QTL 242	6.3		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	24599340	69599340	Rat
1581512	Cm55	Cardiac mass QTL 55	2.8	0.05	heart left ventricle mass (VT:0007031)	heart left ventricle weight to body weight ratio (CMO:0000530)	17	27027949	56836890	Rat
4889955	Bss93	Bone structure and strength QTL 93	4.4		tibia size trait (VT:0100001)	tibia cortical bone volume to tibia total bone volume ratio (CMO:0001727)	17	27027949	60463643	Rat
2302377	Scl61	Serum cholesterol level QTL 61	4.36		blood HDL cholesterol amount (VT:0000184)	serum high density lipoprotein cholesterol level (CMO:0000361)	17	27389946	53481766	Rat
8552928	Pigfal9	Plasma insulin-like growth factor 1 level QTL 9	9		blood insulin-like growth factor amount (VT:0010479)	plasma insulin-like growth factor 1 level (CMO:0001299)	17	28409147	73409147	Rat
9590107	Sffal7	Serum free fatty acids level QTL 7	4.81	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	17	28409147	73409147	Rat
10450503	Bp386	Blood pressure QTL 386		0.28	arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	31368391	62109574	Rat
2324621	Coatc5	Coat color QTL 5			coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	17	31368391	73951021	Rat
2313854	Bp343	Blood pressure QTL 343	3.9		life span trait (VT:0005372)	age at time of death (CMO:0001193)	17	31990784	50909196	Rat
724549	Niddm56	Non-insulin dependent diabetes mellitus QTL 56		0.03	blood glucose amount (VT:0000188)	blood glucose level area under curve (AUC) (CMO:0000350)	17	31990784	76990784	Rat
1354663	Bvd5	Brain ventricular dilatation QTL 5	3.51	0.001	brain ventricle morphology trait (VT:0000822)	hydrocephalus severity score (CMO:0001881)	17	31990784	81292925	Rat
1300148	Bp192	Blood pressure QTL 192	3.47		arterial blood pressure trait (VT:2000000)	blood pressure time series experimental set point of the baroreceptor response (CMO:0002593)	17	34550843	73951021	Rat
724528	Uae4	Urinary albumin excretion QTL 4	4.9	0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	17	35837085	69599340	Rat
2301412	Kidm40	Kidney mass QTL 40		0.001	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	17	37479847	82479847	Rat
2317054	Aia12	Adjuvant induced arthritis QTL 12	4.24		joint integrity trait (VT:0010548)	left rear ankle joint diameter (CMO:0002149)	17	38281509	83281509	Rat
2317060	Aia26	Adjuvant induced arthritis QTL 26	3.22		joint integrity trait (VT:0010548)	right rear ankle joint diameter (CMO:0002150)	17	38281509	83281509	Rat
1598871	Memor5	Memory QTL 5	5.3		exploratory behavior trait (VT:0010471)	total horizontal distance resulting from voluntary locomotion in an experimental apparatus (CMO:0001443)	17	40540041	80387013	Rat
1358295	Aocep1	Aortic cell protein QTL 1	6.1	0.00000071	thoracic aorta cellular protein amount (VT:0010598)	aortic cell percentage	17	40990005	85990005	Rat
631497	Bp98	Blood pressure QTL 98	3.66		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	17	41354651	60463643	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	diastolic blood pressure (CMO:0000005)	17	42073160	69599340	Rat
1354635	Bp245	Blood pressure QTL 245	6		arterial blood pressure trait (VT:2000000)	mean arterial blood pressure (CMO:0000009)	17	42073160	69599340	Rat

Expression

RNA-SEQ Expression

High: > 1000 TPM value Medium: Between 11 and 1000 TPM
Low: Between 0.5 and 10 TPM Below Cutoff: < 0.5 TPM

	alimentary part of gastrointestinal system	circulatory system	endocrine system	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	appendage
High			6		8
Medium		4	11	5	8	5	4	4	7	2	5	8	4
Low	3	36	29	25	3	25	4	6	49	26	29	3	4
Below cutoff		3	9	9		9		1	15	5	6

View RNA-SEQ Expression Data

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109417	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474072	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JACYVU010000292	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

RefSeq Acc Id:

ENSRNOT00000091688 ⟹ ENSRNOP00000074300

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	17	42,726,127 - 42,769,160 (+)	Ensembl
Rnor_6.0 Ensembl	17	44,766,313 - 44,766,981 (+)	Ensembl

RefSeq Acc Id:

NM_001109417 ⟹ NP_001102887

RefSeq Status:

VALIDATED

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2	17	42,726,132 - 42,727,162 (+)	NCBI
Rnor_6.0	17	44,766,313 - 44,766,981 (+)	NCBI
Rnor_5.0	17	58,699,738 - 58,700,406 (-)	NCBI
RGSC_v3.4	17	50,360,616 - 50,361,284 (+)	RGD
Celera	17	53,734,625 - 53,735,293 (-)	RGD

Sequence:

show sequence

ATGTCTGAAACTGCTCCCGCCGAGACTACGGCTCCCGCTCCTGTAGAGAAGTCTCCCGCCAAGA
AGAAGACAAAAAAAGCTGGCGCGGCAAAGCGCAAGGCCACTGGCCCCCCGGTATCTGAGCTCAT
AACTAAGGCTGTTTCTGCCTCTAAAGAGCGCGGCGGCGTGTCCCTGCCTGCTCTGAAGAAGGCA
TTGGCTGCTGGTGGCTACGATGTGGAGAAGAACAACAGCCGCATCAAGCTTGGGCTCAAGAGTT
TGGTGAGCAAAGGTACCCTGGTGCAAACAAAAGGTACTGGCGCCTCTGGTTCCTTCAAGCTTAA
CAAAAAGGTGGCTTCCGGCGAAGCCAAGCCCAAGGCTAAGAAGACTGGGGCTGCCAAGGCCAAG
AAACCTACAGGTGCCACCCCGAAGAAGCCCAAGAAGACTGCCGGGGCCAAGAAGACCGTGAAGA
AAACTCCAAAGAAAGCAAAGAAGCCTGCAGCGGCTGGAGTAAAGAAAGTTACCAAGAGCCCTAA
GAAGGCCAAGGCTGCTGCCAAGCCTAAAAAGGCGACTAAGAGCCCGGCAAGGCCCAAGGCGGTG
AAATCTAAGGCGTCCAAGCCTAAAGTTACCAAGCCCAAGGCAGCTAAGCCTAAGGCTGCCAAGG
TAAAGAAGGCTGTTTCCAAGAAGAAGTAA

hide sequence

Protein Sequences


Protein RefSeqs	NP_001102887	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	D3ZBN0	(Get FASTA)	NCBI Sequence Viewer
	EDL84565	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000074300

RefSeq Acc Id:

NP_001102887 ⟸ NM_001109417

- UniProtKB:

D3ZBN0 (UniProtKB/Swiss-Prot)

- Sequence:

show sequence

MSETAPAETTAPAPVEKSPAKKKTKKAGAAKRKATGPPVSELITKAVSASKERGGVSLPALKKA
LAAGGYDVEKNNSRIKLGLKSLVSKGTLVQTKGTGASGSFKLNKKVASGEAKPKAKKTGAAKAK
KPTGATPKKPKKTAGAKKTVKKTPKKAKKPAAAGVKKVTKSPKKAKAAAKPKKATKSPARPKAV
KSKASKPKVTKPKAAKPKAAKVKKAVSKKK

hide sequence

RefSeq Acc Id:

ENSRNOP00000074300 ⟸ ENSRNOT00000091688

Protein Domains

H15

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D3ZBN0-F1-model_v2	AlphaFold	D3ZBN0	1-222	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13700486

Promoter ID:

EPDNEW_R11009

Type:

single initiation site

Name:

Hist1h1b_1

Description:

histone cluster 1 H1 family member b

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	17	44,766,256 - 44,766,316	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1590638	AgrOrtholog
BioCyc Gene	G2FUF-9247	BioCyc
Ensembl Genes	ENSRNOG00000060355	Ensembl, ENTREZGENE, UniProtKB/Swiss-Prot
Ensembl Transcript	ENSRNOT00000091688	ENTREZGENE, UniProtKB/Swiss-Prot
Gene3D-CATH	1.10.10.10	UniProtKB/Swiss-Prot
InterPro	Histone_H1/H5_H15	UniProtKB/Swiss-Prot
	Histone_H5	UniProtKB/Swiss-Prot
	WH-like_DNA-bd_sf	UniProtKB/Swiss-Prot
	WH_DNA-bd_sf	UniProtKB/Swiss-Prot
KEGG Report	rno:680522	UniProtKB/Swiss-Prot
NCBI Gene	680522	ENTREZGENE
Pfam	Linker_histone	UniProtKB/Swiss-Prot
PhenoGen	H1f5	PhenoGen
PRINTS	HISTONEH5	UniProtKB/Swiss-Prot
PROSITE	H15	UniProtKB/Swiss-Prot
RatGTEx	ENSRNOG00000060355	RatGTEx
SMART	H15	UniProtKB/Swiss-Prot
Superfamily-SCOP	SSF46785	UniProtKB/Swiss-Prot
UniProt	D3ZBN0	ENTREZGENE, UniProtKB/Swiss-Prot

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2019-09-13	H1f5	H1.5 linker histone, cluster member	H1f5	H1.5 linker histone, cluster member	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2019-09-13	H1f5	H1.5 linker histone, cluster member	Hist1h1b	histone cluster 1 H1 family member b	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2016-10-12	Hist1h1b	histone cluster 1 H1 family member b	Hist1h1b	histone cluster 1, H1b	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2008-03-05	Hist1h1b	histone cluster 1, H1b	LOC680522	similar to Histone H1.5 (H1 VAR.5) (H1b)	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC680522	similar to Histone H1.5 (H1 VAR.5) (H1b)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message

Imported Disease Annotations - ClinVar