Advanced Search (OLGA)

Gene: Adss1 (adenylosuccinate synthase 1) Rattus norvegicus

Analyze

Symbol:

Adss1

Name:

adenylosuccinate synthase 1

RGD ID:

1590342

Description:

Enables several functions, including actin filament binding activity; adenylosuccinate synthase activity; and identical protein binding activity. Involved in several processes, including IMP metabolic process; cellular response to electrical stimulus; and proteinogenic amino acid metabolic process. Predicted to be active in cytoplasm. Biomarker of sarcoma. Orthologous to human ADSS1 (adenylosuccinate synthase 1); PARTICIPATES IN Canavan disease pathway; de novo purine biosynthetic pathway; INTERACTS WITH (+)-schisandrin B; 17beta-estradiol; 2,3,7,8-tetrachlorodibenzodioxine.

Type:

protein-coding

RefSeq Status:

VALIDATED

Previously known as:

adenylosuccinate synthase like 1; adenylosuccinate synthetase isozyme 1; adenylosuccinate synthetase, muscle isozyme; AdSS 1; Adssl1; AMPSase 1; IMP--aspartate ligase 1; similar to Adenylosuccinate synthetase isozyme 1 ; similar to Adenylosuccinate synthetase isozyme 1 (Adenylosuccinate synthetase, muscle isozyme) (IMP--aspartate ligase 1) (AdSS 1) (AMPSase 1)

RGD Orthologs

Alliance Orthologs

More Info

more info ...

More Info

Species	Gene symbol and name	Data Source	Assertion derived from	less info ...
Orthologs ¹				less info ...
Homo sapiens (human):	ADSS1 (adenylosuccinate synthase 1)	RGD	RGD
Mus musculus (house mouse):	Adss1 (adenylosuccinate synthase 1)	RGD	RGD
Chinchilla lanigera (long-tailed chinchilla):	Adss1 (adenylosuccinate synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Pan paniscus (bonobo/pygmy chimpanzee):	ADSS1 (adenylosuccinate synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Canis lupus familiaris (dog):	ADSS1 (adenylosuccinate synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Ictidomys tridecemlineatus (thirteen-lined ground squirrel):	Adss1 (adenylosuccinate synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Sus scrofa (pig):	ADSS1 (adenylosuccinate synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Chlorocebus sabaeus (green monkey):	ADSS1 (adenylosuccinate synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Heterocephalus glaber (naked mole-rat):	Adss1 (adenylosuccinate synthase 1)	Transitive Ortholog Pipeline	Transitive Ortholog Pipeline
Other homologs ²
Homo sapiens (human):	ADSS2 (adenylosuccinate synthase 2)	HGNC	OrthoDB
Alliance orthologs ³
Homo sapiens (human):	ADSS1 (adenylosuccinate synthase 1)	Alliance	DIOPT (HGNC\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Mus musculus (house mouse):	Adss1 (adenylosuccinate synthase 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Danio rerio (zebrafish):	adssl1 (adenylosuccinate synthase like 1)	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Saccharomyces cerevisiae (baker's yeast):	ADE12	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Drosophila melanogaster (fruit fly):	AdSS	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Caenorhabditis elegans (roundworm):	adss-1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)
Xenopus tropicalis (tropical clawed frog):	adss1	Alliance	DIOPT (Ensembl Compara\|Hieranoid\|InParanoid\|OMA\|OrthoFinder\|OrthoInspector\|PANTHER\|PhylomeDB\|SonicParanoid)

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	137,500,549 - 137,523,087 (+)	NCBI		GRCr8
mRatBN7.2	6	131,679,795 - 131,702,012 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	131,679,701 - 131,701,998 (+)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	6	137,184,818 - 137,206,694 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	137,184,820 - 137,206,693 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	146,191,525 - 146,213,871 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	6	129,227,958 - 129,249,670 (+)	NCBI		Celera
Cytogenetic Map	6	q32	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Model

Annotation Click to see Annotation Detail View

Disease Annotations Click to see Annotation Detail View

Charcot-Marie-Tooth disease axonal type 2O (ISO)

Distal Myopathy 5 (ISO)

Experimental Diabetes Mellitus (IEP)

fetal akinesia deformation sequence syndrome 1 (ISO)

focal segmental glomerulosclerosis 5 (ISO)

genetic disease (ISO)

immunodeficiency 132A (ISO)

sarcoma (IEP)

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

(+)-schisandrin B (EXP)

(1->4)-beta-D-glucan (ISO)

17beta-estradiol (EXP,ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP)

2,4,6-tribromophenol (ISO)

3,3',4,4'-tetrachlorobiphenyl (ISO)

3,3',5,5'-tetrabromobisphenol A (ISO)

4,4'-sulfonyldiphenol (ISO)

4-hydroxyphenyl retinamide (ISO)

6-propyl-2-thiouracil (EXP)

acrylamide (EXP)

aflatoxin B1 (ISO)

all-trans-retinoic acid (ISO)

alpha-Zearalanol (EXP)

antirheumatic drug (ISO)

arsane (ISO)

arsenic atom (ISO)

atrazine (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

cadmium dichloride (EXP,ISO)

cantharidin (ISO)

carbamazepine (ISO)

carbon nanotube (ISO)

chlorpyrifos (ISO)

choline (ISO)

cisplatin (ISO)

cobalt dichloride (EXP)

copper(II) chloride (ISO)

copper(II) sulfate (ISO)

cyclosporin A (ISO)

cyproconazole (ISO)

decabromodiphenyl ether (ISO)

dexamethasone (ISO)

dioxygen (ISO)

dorsomorphin (ISO)

doxorubicin (ISO)

endosulfan (EXP)

entinostat (ISO)

epoxiconazole (ISO)

ethanol (ISO)

folic acid (ISO)

glafenine (EXP)

hydrogen peroxide (ISO)

inulin (ISO)

L-methionine (ISO)

lead diacetate (ISO)

methimazole (EXP)

Muraglitazar (EXP)

N-benzyloxycarbonyl-L-leucyl-L-leucyl-L-leucinal (ISO)

nickel atom (ISO)

oxaliplatin (EXP)

ozone (ISO)

paracetamol (EXP,ISO)

perfluorononanoic acid (ISO)

perfluorooctane-1-sulfonic acid (ISO)

perfluorooctanoic acid (EXP)

phenobarbital (ISO)

phenylmercury acetate (ISO)

PhIP (EXP)

propiconazole (ISO)

quercetin (ISO)

quinolin-8-ol (ISO)

rotenone (EXP)

SB 431542 (ISO)

silicon dioxide (ISO)

silver atom (ISO)

silver(0) (ISO)

sodium fluoride (ISO)

tamoxifen (ISO)

Tesaglitazar (EXP)

tetrachloromethane (EXP,ISO)

thalidomide (ISO)

thimerosal (ISO)

thioacetamide (EXP)

titanium dioxide (ISO)

topotecan (EXP)

trichloroethene (EXP)

triphenyl phosphate (EXP)

urethane (ISO)

valproic acid (EXP,ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

'de novo' AMP biosynthetic process (IBA,IEA)

AMP biosynthetic process (IEA,ISO)

AMP salvage (IEA,ISO)

aspartate metabolic process (IDA)

cellular response to electrical stimulus (IEP)

cellular response to xenobiotic stimulus (IEP)

glutamine metabolic process (IEP)

IMP metabolic process (IBA,IDA)

purine nucleotide biosynthetic process (IEA)

purine nucleotide metabolic process (IEA,ISO)

response to muscle activity (IEP)

response to starvation (IEP)

Cellular Component

cytoplasm (IBA,IEA,ISO)

Molecular Function

actin filament binding (IDA)

adenylosuccinate synthase activity (IBA,IDA,IEA,ISO)

GTP binding (IEA)

GTPase activity (IDA)

identical protein binding (IPI)

ligase activity (IEA)

magnesium ion binding (IEA)

metal ion binding (IEA)

nucleotide binding (IEA)

protein binding (ISO)

Molecular Pathway Annotations Click to see Annotation Detail View

Canavan disease pathway (ISO)

de novo purine biosynthetic pathway (ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Changes in isozymes of adenylosuccinate synthetase.	Baugher BW, etal., Biochem Biophys Res Commun. 1980 May 14;94(1):123-9.
2.	Metabolism of threo-beta-fluoroaspartate by H4 cells. Inhibition of adenylosuccinate lyase by fluoro analogs of its substrates.	Casey PJ, etal., J Biol Chem. 1986 Oct 15;261(29):13637-42.
3.	Isotope exchange at equilibrium studies with rat muscle adenylosuccinate synthetase.	Cooper BF, etal., Biochemistry. 1986 Nov 18;25(23):7323-7.
4.	Importance of purine nucleotide cycle to energy production in skeletal muscle.	Flanagan WF, etal., Am J Physiol. 1986 Nov;251(5 Pt 1):C795-802.
5.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
6.	Adenylosuccinate synthetase: recent developments.	Honzatko RB, etal., Adv Enzymol Relat Areas Mol Biol. 1999;73:57-102, ix-x.
7.	Isozyme shift of adenylosuccinate synthase in rat and human neoplasms.	Ikegami T, etal., Adv Exp Med Biol. 1989;253A:417-21.
8.	Adenine nucleotide metabolism in hearts of diabetic rats. Comparison to diaphragm, liver, and kidney.	Jenkins RL, etal., Diabetes. 1988 May;37(5):629-36.
9.	Adenylosuccinate synthetase in rat liver: the existence of two types and their regulatory roles.	Matsuda Y, etal., Biochem Biophys Res Commun. 1977 Sep 23;78(2):766-71.
10.	Interaction of adenylosuccinate synthetase with F-actin.	Ogawa H, etal., Eur J Biochem. 1978 Apr 17;85(2):331-7.
11.	Purification, crystallization, and properties of adenylosuccinate synthetase from rat skeletal muscle.	Ogawa H, etal., J Biochem. 1977 Apr;81(4):859-69.
12.	SMPDB Annotation Import Pipeline	Pipeline to import SMPDB annotations from SMPDB into RGD
13.	GOA pipeline	RGD automated data pipeline
14.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions
15.	Electrical stimulation of neonatal cardiac myocytes activates the NFAT3 and GATA4 pathways and up-regulates the adenylosuccinate synthetase 1 gene.	Xia Y, etal., J Biol Chem. 2000 Jan 21;275(3):1855-63.
16.	Mammalian target of rapamycin and protein kinase A signaling mediate the cardiac transcriptional response to glutamine.	Xia Y, etal., J Biol Chem. 2003 Apr 11;278(15):13143-50. Epub 2003 Jan 9.

Additional References at PubMed

PMID:1592113	PMID:1939273	PMID:11560929	PMID:12482871	PMID:15786719	PMID:26506222	PMID:31505169

Genomics

Comparative Map Data

Adss1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	6	137,500,549 - 137,523,087 (+)	NCBI		GRCr8
mRatBN7.2	6	131,679,795 - 131,702,012 (+)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	6	131,679,701 - 131,701,998 (+)	Ensembl		mRatBN7.2 Ensembl
Rnor_6.0	6	137,184,818 - 137,206,694 (+)	NCBI	Rnor6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	6	137,184,820 - 137,206,693 (+)	Ensembl	Rnor6.0		rn6	Rnor6.0
Rnor_5.0	6	146,191,525 - 146,213,871 (+)	NCBI	Rnor5.0	Rnor_5.0	rn5	Rnor5.0
Celera	6	129,227,958 - 129,249,670 (+)	NCBI		Celera
Cytogenetic Map	6	q32	NCBI

ADSS1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	14	104,724,229 - 104,747,325 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	14	104,724,174 - 104,747,325 (+)	Ensembl	GRCh38		hg38	GRCh38
GRCh37	14	105,190,566 - 105,213,662 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	14	104,261,579 - 104,284,692 (+)	NCBI	NCBI36	Build 36	hg18	NCBI36
Build 34	14	104,267,272 - 104,284,690	NCBI
Celera	14	85,245,724 - 85,268,719 (+)	NCBI		Celera
Cytogenetic Map	14	q32.33	NCBI
HuRef	14	85,387,628 - 85,410,637 (+)	NCBI		HuRef
CHM1_1	14	105,128,295 - 105,151,263 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	14	98,967,108 - 98,990,211 (+)	NCBI		T2T-CHM13v2.0

Adss1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	12	112,586,481 - 112,607,789 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	12	112,586,479 - 112,607,794 (+)	Ensembl		GRCm39 Ensembl
GRCm38	12	112,620,047 - 112,641,355 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	12	112,620,045 - 112,641,360 (+)	Ensembl	GRCm38		mm10	GRCm38
MGSCv37	12	113,858,258 - 113,879,566 (+)	NCBI	GRCm37	MGSCv37	mm9	NCBIm37
MGSCv36	12	113,067,897 - 113,089,148 (+)	NCBI		MGSCv36	mm8
Celera	12	113,833,723 - 113,854,981 (+)	NCBI		Celera
Cytogenetic Map	12	F1	NCBI
cM Map	12	61.2	NCBI

Adss1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955538	3,179,299 - 3,196,251 (+)	Ensembl	ChiLan1.0
ChiLan1.0	NW_004955538	3,179,299 - 3,196,251 (+)	NCBI	ChiLan1.0	ChiLan1.0

ADSS1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	15	105,906,601 - 105,929,460 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	14	105,123,110 - 105,145,977 (+)	NCBI		NHGRI_mPanPan1
PanPan1.1 Ensembl	14	105,169,769 - 105,190,333 (+)	Ensembl	panpan1.1		panPan2

ADSS1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	8	72,288,246 - 72,305,479 (+)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	8	72,288,323 - 72,305,479 (+)	Ensembl	CanFam3.1		canFam3	CanFam3.1
Dog10K_Boxer_Tasha	8	71,794,530 - 71,811,245 (+)	NCBI		Dog10K_Boxer_Tasha
ROS_Cfam_1.0	8	72,563,724 - 72,580,480 (+)	NCBI		ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	8	72,563,747 - 72,580,480 (+)	Ensembl		ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	8	72,246,454 - 72,263,107 (+)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	8	72,289,706 - 72,306,363 (+)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	8	72,689,260 - 72,705,927 (+)	NCBI		UU_Cfam_GSD_1.0

Adss1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024408640	1,826,047 - 1,840,007 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936621	655,008 - 664,762 (-)	Ensembl	SpeTri2.0	SpeTri2.0 Ensembl
SpeTri2.0	NW_004936621	655,004 - 667,608 (-)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

ADSS1
(Sus scrofa - pig)

No map positions available.

ADSS1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	24	82,662,232 - 82,684,690 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	24	82,662,319 - 82,684,874 (+)	Ensembl	ChlSab1.1	ChlSab1.1 Ensembl	chlSab2
Vero_WHO_p1.0	NW_023666053	70,083,482 - 70,105,939 (+)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Adss1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624734	535,101 - 552,535 (-)	Ensembl	HetGla_female_1.0	HetGla_female_1.0 Ensembl	hetGla2
HetGla 1.0	NW_004624734	536,109 - 552,406 (-)	NCBI	HetGla_female_1.0	HetGla 1.0	hetGla2

Variants

Variants in Adss1
85 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	156
Count of miRNA genes:	72
Interacting mature miRNAs:	72
Transcripts:	ENSRNOT00000073073, ENSRNOT00000073796
Prediction methods:	Microtar, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
12801411	Schws8	Schwannoma susceptibility QTL 8			nervous system integrity trait (VT:0010566)	percentage of study population developing trigeminal nerve neurilemmomas during a period of time (CMO:0002017)	6	94968928	139968928	Rat
4145118	Mcs26	Mammary carcinoma susceptibility QTL 26		0.0001	mammary gland integrity trait (VT:0010552)	post-insult time to mammary tumor formation (CMO:0000345)	6	106752656	132339866	Rat
1641917	Colcr5	Colorectal carcinoma resistance QTL 5	3.18	0.0009	intestine integrity trait (VT:0010554)	benign colorectal tumor number (CMO:0001795)	6	122549046	137801795	Rat
61414	Pia3	Pristane induced arthritis QTL 3	4.5		joint integrity trait (VT:0010548)	post-insult time to onset of experimental arthritis (CMO:0001450)	6	94968928	137848904	Rat
71111	Iddm8	Insulin dependent diabetes mellitus QTL 8	1.9	0.002	blood glucose amount (VT:0000188)	plasma glucose level (CMO:0000042)	6	105156861	140994061	Rat
1358355	Srcrt4	Stress Responsive Cort QTL 4	6.39		blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	6	100364669	140994061	Rat
724513	Uae14	Urinary albumin excretion QTL 14	6.5		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	85311061	133478515	Rat
2303624	Vencon5	Ventilatory control QTL 5	4.45		respiration trait (VT:0001943)	minute ventilation (CMO:0000132)	6	88047916	133047916	Rat
731173	Uae22	Urinary albumin excretion QTL 22	10.1		urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
61329	Eae9	Experimental allergic encephalomyelitis QTL 9	3.7		body mass (VT:0001259)	change in body weight (CMO:0002045)	6	122549046	140994061	Rat
737976	Pia24	Pristane induced arthritis QTL 24			joint integrity trait (VT:0010548)	joint inflammation composite score (CMO:0000919)	6	112636280	140994061	Rat
2312560	Pur20	Proteinuria QTL 20	2.1	0.005	urine total protein amount (VT:0000032)	urine total protein excretion rate (CMO:0000756)	6	125628133	137801795	Rat
2313399	Anxrr28	Anxiety related response QTL 28			aggression-related behavior trait (VT:0015014)	tameness/aggressiveness composite score (CMO:0002136)	6	100671796	132340886	Rat
2290393	Uae37	Urinary albumin excretion QTL 37		0.0001	urine albumin amount (VT:0002871)	urine albumin excretion rate (CMO:0000757)	6	65531555	140994061	Rat
8552796	Vie3	Viral induced encephalitis QTL 3	2.6		brain integrity trait (VT:0010579)	encephalitis incidence/prevalence measurement (CMO:0002361)	6	96833997	140994061	Rat
1300076	Glom8	Glomerulus QTL 8	7	9e-09	kidney glomerulus morphology trait (VT:0005325)	count of superficial glomeruli directly contacting the kidney surface (CMO:0001001)	6	86894788	131894788	Rat
2293085	Iddm29	Insulin dependent diabetes mellitus QTL 29	7.66		blood glucose amount (VT:0000188)	blood glucose level (CMO:0000046)	6	122549046	140286318	Rat

Markers in Region

BF406314

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	6	131,698,788 - 131,698,939 (+)	MAPPER	mRatBN7.2
Rnor_6.0	6	137,203,471 - 137,203,621	NCBI	Rnor6.0
Rnor_5.0	6	146,210,648 - 146,210,798	UniSTS	Rnor5.0
Celera	6	129,246,447 - 129,246,597	UniSTS
RH 3.4 Map	6	781.0	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	nervous system	renal system	reproductive system	respiratory system
9	11	49	113	91	90	59	25	59	6	218	97	93	45	60	31

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001432142	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	NM_001432143	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_001072867	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_003750237	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	XM_039113409	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	CH474034	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000006	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000073796 ⟹ ENSRNOP00000064866

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	131,680,147 - 131,701,998 (+)	Ensembl
Rnor_6.0 Ensembl	6	137,184,820 - 137,206,693 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000095637 ⟹ ENSRNOP00000088257

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	131,679,701 - 131,701,998 (+)	Ensembl

Ensembl Acc Id:

ENSRNOT00000112639 ⟹ ENSRNOP00000082793

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
mRatBN7.2 Ensembl	6	131,680,147 - 131,701,537 (+)	Ensembl

RefSeq Acc Id:

XM_003750237 ⟹ XP_003750285

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	137,500,934 - 137,523,087 (+)	NCBI
mRatBN7.2	6	131,680,278 - 131,702,012 (+)	NCBI
Rnor_6.0	6	137,184,818 - 137,206,694 (+)	NCBI
Rnor_5.0	6	146,191,525 - 146,213,871 (+)	NCBI

Sequence:

show sequence

AGGCGTCCGCATTTAATGGAGCGAGAGCTCTGGAGGCGGCGGGCTCTCGCTTGGCCCAGAACAG
CGGAGGAGCTAAGCCAGCATGTCCGGGACCCGAGCCTCCAACGACCGGCCCCCCGGCACAGGCG
GAGTCAAGAGGGGGCGGCTGCAGCAGGAGGCGGCGGCGACAGGCTCCCGCGTGACCGTGGTGCT
GGGCGCGCAGTGGGGGGACGAGGGCAAAGGCAAGGTGGTGGACCTGCTGGCCACGGACGCCGAC
ATCGTCAGTCGCTGCCAGGGGGGCAACAATGCCGGGCACACAGTTGTGGTGGATGGCAAGGAAT
ATGACTTCCACCTGTTACCCAGCGGCATCATCAACACCAAGGCCGTGTCGTTCATTGGCAATGG
TGTGGTCATCCACTTGCCAGGCTTGTTTGAAGAGGCAGAGAAGAACGAGAAGAAAGGGCTGAAG
GACTGGGAGAAGCGGCTCATCATCTCTGACCGGGCTCACCTTGTGTTCGACTTCCACCAGGCAG
TGGACGGGCTGCAGGAAGTGCAACGGCAAGCACAAGAGGGGAAGAATATCGGCACCACCAAGAA
GGGAATCGGACCAACTTACTCCTCCAAGGCTGCCCGGACGGGCCTCCGCATCTGTGACCTCCTG
TCGGATTTTGATGAGTTTTCTGCCAGATTCAAGAACCTGGCCCACCAGCACCAGTCTATGTTCC
CCACCCTGGAAATAGATGTGGAAGGTCAACTCAAAAGGCTCAAGGGTTTTGCTGAGCGGATCAG
ACCCATGGTTCGGGACGGTGTCTACTTCATGTATGAGGCACTCCATGGTCCCCCCAAGAAGATC
CTGGTGGAAGGCGCCAACGCCGCCCTGCTTGACATTGACTTCGGGACCTACCCTTTTGTGACTT
CTTCCAACTGCACTGTGGGTGGCGTGTGCACAGGCCTGGGCATCCCGCCCCAGAACATAGGTGA
TGTGTACGGTGTGGTAAAAGCCTACACCACCCGCGTGGGCATTGGTGCCTTCCCCACGGAACAG
ATTAACGAAATTGGAGATCTGCTGCAGAACCGTGGCCATGAGTGGGGCGTGACCACGGGCAGGA
AGAGGCGCTGTGGCTGGCTGGACCTGATGATCCTCCGATACGCTCACATGGTCAACGGCTTCAC
TGCGCTGGCGTTGACCAAGTTGGACATACTGGATGTCCTGAGCGAGATTAAAGTTGGTATCTCC
TACAAGCTCAACGGGAAGAGGATCCCCTACTTCCCTGCTAACCAGGAGATATTGCAGAAGGTGG
AGGTGGAGTATGAAACACTCCCTGGATGGAAGGCTGACACCACGGGGGCCAGGAAGTGGGAGGA
CCTGCCCCCGCAGGCCCAGAGCTATGTGCGGTTCGTGGAGAATCACTTGGGTGTTGCAGTCAAA
TGGGTTGGCGTTGGAAAGTCCAGAGAGTCCATGATCCAGTTGTTTTAGAGGCCAAGCAGAAGCC
AGCAGGCCACACCGCGGTGTACCACCATGAGTGAGAGCCGCAGCCAAGACCCTCAGCAGTGCCA
CCAACGTCTCCAACAAAACAACCTGAAATTATTTTCTATACCTTTATTTTTCTATGTACGTTTT
CAGCTTGGCCCTCTGAATTCTACAACAATTTTAGATGGGTGAAATCAACACTGGGTACATTTTT
AAAAATTCTGCTTTTGAAATGAGCCCAAGTGCTCAAAATGGAGGCCTTCAATGACTGACTGTCC
CGTGGTGTGTGTTCAGTTGGAGCCATGACGCAATAAACATCCAGGAGTCAGTGAGCCACAGAGA
GGTCATTA

hide sequence

RefSeq Acc Id:

XM_039113409 ⟹ XP_038969337

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	6	137,500,549 - 137,523,087 (+)	NCBI
mRatBN7.2	6	131,679,795 - 131,702,012 (+)	NCBI

Protein Sequences


Protein RefSeqs	NP_001419071	(Get FASTA)	NCBI Sequence Viewer
	NP_001419072	(Get FASTA)	NCBI Sequence Viewer
	XP_003750285	(Get FASTA)	NCBI Sequence Viewer
	XP_038969337	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL97426	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000064866
	ENSRNOP00000064866.1
	ENSRNOP00000082793.1
	ENSRNOP00000088257.1

RefSeq Acc Id:

XP_003750285 ⟸ XM_003750237

- Peptide Label:

isoform X1

- Sequence:

show sequence

MSGTRASNDRPPGTGGVKRGRLQQEAAATGSRVTVVLGAQWGDEGKGKVVDLLATDADIVSRCQ
GGNNAGHTVVVDGKEYDFHLLPSGIINTKAVSFIGNGVVIHLPGLFEEAEKNEKKGLKDWEKRL
IISDRAHLVFDFHQAVDGLQEVQRQAQEGKNIGTTKKGIGPTYSSKAARTGLRICDLLSDFDEF
SARFKNLAHQHQSMFPTLEIDVEGQLKRLKGFAERIRPMVRDGVYFMYEALHGPPKKILVEGAN
AALLDIDFGTYPFVTSSNCTVGGVCTGLGIPPQNIGDVYGVVKAYTTRVGIGAFPTEQINEIGD
LLQNRGHEWGVTTGRKRRCGWLDLMILRYAHMVNGFTALALTKLDILDVLSEIKVGISYKLNGK
RIPYFPANQEILQKVEVEYETLPGWKADTTGARKWEDLPPQAQSYVRFVENHLGVAVKWVGVGK
SRESMIQLF

hide sequence

Ensembl Acc Id:

ENSRNOP00000064866 ⟸ ENSRNOT00000073796

RefSeq Acc Id:	XP_038969337 ⟸ XM_039113409
- Peptide Label:	isoform X2

Ensembl Acc Id:

ENSRNOP00000082793 ⟸ ENSRNOT00000112639

Ensembl Acc Id:

ENSRNOP00000088257 ⟸ ENSRNOT00000095637

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-M0R629-F1-model_v2	AlphaFold	M0R629	1-457	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Promoters

RGD ID:

13694852

Promoter ID:

EPDNEW_R5374

Type:

initiation region

Name:

Adssl1_1

Description:

adenylosuccinate synthase like 1

SO ACC ID:

SO:0000170

Source:

EPDNEW (Eukaryotic Promoter Database, http://epd.vital-it.ch/)

Experiment Methods:

Single-end sequencing.

Position:

Rat Assembly	Chr	Position (strand)	Source
Rnor_6.0	6	137,184,818 - 137,184,878	EPDNEW

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1590342	AgrOrtholog
BioCyc Gene	G2FUF-35783	BioCyc
BioCyc Pathway	PWY-7219 [adenosine ribonucleotides de novo biosynthesis]	BioCyc
BioCyc Pathway Image	PWY-7219	BioCyc
Ensembl Genes	ENSRNOG00000046763	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000073796	ENTREZGENE
	ENSRNOT00000073796.3	UniProtKB/TrEMBL
	ENSRNOT00000095637.1	UniProtKB/TrEMBL
	ENSRNOT00000112639.1	UniProtKB/TrEMBL
Gene3D-CATH	1.10.300.10	UniProtKB/TrEMBL
	3.40.440.10	UniProtKB/TrEMBL
	3.90.170.10	UniProtKB/TrEMBL
InterPro	Adenylosuccin_syn_Lys_AS	UniProtKB/TrEMBL
	Adenylosuccinate_synth_dom1	UniProtKB/TrEMBL
	Adenylosuccinate_synth_dom2	UniProtKB/TrEMBL
	Adenylosuccinate_synth_dom3	UniProtKB/TrEMBL
	Adenylosuccinate_synthase_AS	UniProtKB/TrEMBL
	Adenylosuccinate_synthetase	UniProtKB/TrEMBL
	AdSS_1_vert	UniProtKB/TrEMBL
	P-loop_NTPase	UniProtKB/TrEMBL
KEGG Report	rno:684425	UniProtKB/TrEMBL
NCBI Gene	684425	ENTREZGENE
PANTHER	ADENYLOSUCCINATE SYNTHETASE ISOZYME 1	UniProtKB/TrEMBL
	PTHR11846	UniProtKB/TrEMBL
Pfam	Adenylsucc_synt	UniProtKB/TrEMBL
PhenoGen	Adss1	PhenoGen
PROSITE	ADENYLOSUCCIN_SYN_1	UniProtKB/TrEMBL
	ADENYLOSUCCIN_SYN_2	UniProtKB/TrEMBL
RatGTEx	ENSRNOG00000046763	RatGTEx
SMART	Adenylsucc_synt	UniProtKB/TrEMBL
Superfamily-SCOP	SSF52540	UniProtKB/TrEMBL
UniProt	A0A8I6A7H6	ENTREZGENE, UniProtKB/TrEMBL
	A0A8I6G9X7	ENTREZGENE, UniProtKB/TrEMBL
	A6KBV5	ENTREZGENE, UniProtKB/TrEMBL
	M0R629	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2021-09-14	Adss1	adenylosuccinate synthase 1	Adssl1	adenylosuccinate synthase like 1	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-20	LOC684425	similar to Adenylosuccinate synthetase isozyme 1 (Adenylosuccinate synthetase, muscle isozyme) (IMP--aspartate ligase 1) (AdSS 1) (AMPSase 1)			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

BioCyc Pathways

Send us a Message

Imported Disease Annotations - ClinVar

Imported Disease Annotations - OMIM

RGD Manual Annotations

Imported Annotations - SMPDB

BioCyc Pathways