Advanced Search (OLGA)

Gene: Tpgs1 (tubulin polyglutamylase complex subunit 1) Rattus norvegicus

Analyze

Symbol:

Tpgs1

Name:

tubulin polyglutamylase complex subunit 1

RGD ID:

1588613

Description:

Predicted to enable microtubule binding activity and tubulin-glutamic acid ligase activity. Predicted to be involved in sperm axoneme assembly. Predicted to act upstream of or within several processes, including cilium disassembly; microtubule polymerization; and protein polyglutamylation. Predicted to be located in centrosome. Predicted to be active in microtubule organizing center. Orthologous to human TPGS1 (tubulin polyglutamylase complex subunit 1); INTERACTS WITH 2,3,7,8-tetrachlorodibenzodioxine; bisphenol A; fenvalerate.

Type:

protein-coding

RefSeq Status:

PROVISIONAL

Previously known as:

gene trap ROSA b-geo 22; Gtrgeo22; LOC691093; PGs1; similar to gene trap ROSA b-geo 22

RGD Orthologs

Alliance Orthologs

More Info

more info ...

Latest Assembly:

GRCr8 - GRCr8 Assembly

Position:

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	10,680,461 - 10,686,383 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	10,680,473 - 10,686,383 (-)	Ensembl				GRCr8
mRatBN7.2	7	10,029,842 - 10,035,764 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	10,029,854 - 10,035,764 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	12,910,831 - 12,916,733 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	14,788,910 - 14,794,812 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	12,648,201 - 12,654,116 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	12,912,251 - 12,918,173 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	12,912,263 - 12,918,173 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	13,080,966 - 13,086,888 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	11,546,760 - 11,552,682 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	8,203,089 - 8,209,005 (-)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

JBrowse:

View Region in Genome Browser (JBrowse)

Annotation Click to see Annotation Detail View

Gene-Chemical Interaction Annotations Click to see Annotation Detail View

1,2,4-trichloro-5-(2,5-dichlorophenyl)benzene (ISO)

17beta-estradiol (ISO)

2,2',4,4',5,5'-hexachlorobiphenyl (ISO)

2,2',4,4'-Tetrabromodiphenyl ether (ISO)

2,2',5,5'-tetrachlorobiphenyl (ISO)

2,3',4,4',5-Pentachlorobiphenyl (ISO)

2,3,7,8-tetrachlorodibenzodioxine (EXP,ISO)

2,4,4'-trichlorobiphenyl (ISO)

4,4'-sulfonyldiphenol (ISO)

aristolochic acid A (ISO)

arsane (ISO)

arsenic atom (ISO)

benzo[a]pyrene (ISO)

bis(2-ethylhexyl) phthalate (ISO)

bisphenol A (EXP,ISO)

bisphenol F (ISO)

chlorpyrifos (ISO)

cisplatin (ISO)

dicrotophos (ISO)

fenthion (ISO)

fenvalerate (EXP)

hexadecanoic acid (ISO)

hydrogen cyanide (ISO)

methidathion (ISO)

paracetamol (EXP)

PCB138 (ISO)

pirinixic acid (ISO)

potassium cyanide (ISO)

silicon dioxide (ISO)

sodium arsenite (ISO)

tetrachloroethene (ISO)

trichloroethene (EXP)

triphenyl phosphate (ISO)

valproic acid (ISO)

Gene Ontology Annotations Click to see Annotation Detail View

Biological Process

adult behavior (IEA,ISO)

chemical synaptic transmission (IEA,ISO)

cilium disassembly (ISO)

microtubule cytoskeleton organization (ISO)

microtubule polymerization (ISO)

protein polyglutamylation (ISO)

sperm axoneme assembly (IBA,IEA,ISO)

vesicle localization (IEA,ISO)

Cellular Component

centrosome (IEA,ISO)

microtubule organizing center (IBA)

synapse (IEA)

Molecular Function

microtubule binding (IBA,IEA,ISO)

protein binding (ISO)

tubulin binding (IEA,ISO)

tubulin-glutamic acid ligase activity (IBA,IEA,ISO)

References

References - curated

#	Reference Title	Reference Citation
1.	Phylogenetic-based propagation of functional annotations within the Gene Ontology consortium.	Gaudet P, etal., Brief Bioinform. 2011 Sep;12(5):449-62. doi: 10.1093/bib/bbr042. Epub 2011 Aug 27.
2.	Data Import for Chemical-Gene Interactions	RGD automated import pipeline for gene-chemical interactions

Additional References at PubMed

PMID:12242242	PMID:12972506	PMID:17360631	PMID:21399614

Genomics

Comparative Map Data

Tpgs1
(Rattus norvegicus - Norway rat)

Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCr8	7	10,680,461 - 10,686,383 (-)	NCBI	GRCr8	GRCr8		GRCr8
GRCr8 Ensembl	7	10,680,473 - 10,686,383 (-)	Ensembl				GRCr8
mRatBN7.2	7	10,029,842 - 10,035,764 (-)	NCBI	mRatBN7.2	mRatBN7.2
mRatBN7.2 Ensembl	7	10,029,854 - 10,035,764 (-)	Ensembl				mRatBN7.2
UTH_Rnor_SHR_Utx	7	12,910,831 - 12,916,733 (-)	NCBI	UTH_Rnor_SHR_Utx	UTH_Rnor_SHR_Utx
UTH_Rnor_SHRSP_BbbUtx_1.0	7	14,788,910 - 14,794,812 (-)	NCBI	UTH_Rnor_SHRSP_BbbUtx_1.0	UTH_Rnor_SHRSP_BbbUtx_1.0
UTH_Rnor_WKY_Bbb_1.0	7	12,648,201 - 12,654,116 (-)	NCBI	UTH_Rnor_WKY_Bbb_1.0	UTH_Rnor_WKY_Bbb_1.0
Rnor_6.0	7	12,912,251 - 12,918,173 (-)	NCBI	Rnor_6.0	Rnor_6.0	rn6	Rnor6.0
Rnor_6.0 Ensembl	7	12,912,263 - 12,918,173 (-)	Ensembl			rn6	Rnor6.0
Rnor_5.0	7	13,080,966 - 13,086,888 (-)	NCBI	Rnor_5.0	Rnor_5.0	rn5
RGSC_v3.4	7	11,546,760 - 11,552,682 (-)	NCBI	RGSC_v3.4	RGSC_v3.4	rn4
Celera	7	8,203,089 - 8,209,005 (-)	NCBI		Celera
Cytogenetic Map	7	q11	NCBI

TPGS1
(Homo sapiens - human)

Human Assembly	Chr	Position (strand)	Source	Genome Browsers
Human Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCh38	19	507,497 - 519,654 (+)	NCBI	GRCh38	GRCh38	hg38	GRCh38
GRCh38.p14 Ensembl	19	507,497 - 519,654 (+)	Ensembl			hg38	GRCh38
GRCh37	19	507,497 - 519,654 (+)	NCBI	GRCh37	GRCh37	hg19	GRCh37
Build 36	19	458,497 - 470,654 (+)	NCBI	Build 36	Build 36	hg18	NCBI36
Celera	19	297,964 - 310,121 (-)	NCBI		Celera
Cytogenetic Map	19	p13.3	NCBI
HuRef	19	277,653 - 289,928 (+)	NCBI		HuRef
CHM1_1	19	507,000 - 518,651 (+)	NCBI		CHM1_1
T2T-CHM13v2.0	19	460,069 - 472,226 (+)	NCBI		T2T-CHM13v2.0

Tpgs1
(Mus musculus - house mouse)

Mouse Assembly	Chr	Position (strand)	Source	Genome Browsers
Mouse Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
GRCm39	10	79,505,273 - 79,511,961 (+)	NCBI	GRCm39	GRCm39	mm39
GRCm39 Ensembl	10	79,505,203 - 79,511,961 (+)	Ensembl		GRCm39 Ensembl		GRCm39
GRCm38	10	79,669,439 - 79,676,127 (+)	NCBI	GRCm38	GRCm38	mm10	GRCm38
GRCm38.p6 Ensembl	10	79,669,369 - 79,676,127 (+)	Ensembl			mm10	GRCm38
MGSCv37	10	79,132,155 - 79,138,871 (+)	NCBI	MGSCv37	MGSCv37	mm9	NCBIm37
MGSCv36	10	79,072,539 - 79,079,066 (+)	NCBI		MGSCv36	mm8
Celera	10	80,683,145 - 80,689,861 (+)	NCBI		Celera
Cytogenetic Map	10	C1	NCBI
cM Map	10	39.72	NCBI

Tpgs1
(Chinchilla lanigera - long-tailed chinchilla)

Chinchilla Assembly	Chr	Position (strand)	Source	Genome Browsers
Chinchilla Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChiLan1.0 Ensembl	NW_004955495	7,181,907 - 7,189,726 (-)	Ensembl
ChiLan1.0	NW_004955495	7,181,907 - 7,189,726 (-)	NCBI	ChiLan1.0	ChiLan1.0

TPGS1
(Pan paniscus - bonobo/pygmy chimpanzee)

Bonobo Assembly	Chr	Position (strand)	Source	Genome Browsers
Bonobo Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
NHGRI_mPanPan1-v2	20	4,836,574 - 4,847,852 (+)	NCBI		NHGRI_mPanPan1-v2
NHGRI_mPanPan1	19	4,075,184 - 4,087,405 (+)	NCBI		NHGRI_mPanPan1
Mhudiblu_PPA_v0	19	614,279 - 625,715 (-)	NCBI	Mhudiblu_PPA_v0	Mhudiblu_PPA_v0	panPan3

TPGS1
(Canis lupus familiaris - dog)

Dog Assembly	Chr	Position (strand)	Source	Genome Browsers
Dog Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
CanFam3.1	20	57,971,465 - 57,977,525 (-)	NCBI	CanFam3.1	CanFam3.1	canFam3	CanFam3.1
CanFam3.1 Ensembl	20	57,971,704 - 57,977,486 (-)	Ensembl			canFam3	CanFam3.1
Dog10K_Boxer_Tasha	20	57,774,240 - 57,780,320 (-)	NCBI	Dog10K_Boxer_Tasha	Dog10K_Boxer_Tasha
ROS_Cfam_1.0	20	58,715,047 - 58,721,138 (-)	NCBI	ROS_Cfam_1.0	ROS_Cfam_1.0
ROS_Cfam_1.0 Ensembl	20	58,712,782 - 58,721,073 (-)	Ensembl				ROS_Cfam_1.0 Ensembl
UMICH_Zoey_3.1	20	57,768,615 - 57,774,692 (-)	NCBI		UMICH_Zoey_3.1
UNSW_CanFamBas_1.0	20	58,248,466 - 58,254,560 (-)	NCBI		UNSW_CanFamBas_1.0
UU_Cfam_GSD_1.0	20	58,451,731 - 58,457,810 (-)	NCBI	UU_Cfam_GSD_1.0	UU_Cfam_GSD_1.0

Tpgs1
(Ictidomys tridecemlineatus - thirteen-lined ground squirrel)

Squirrel Assembly	Chr	Position (strand)	Source	Genome Browsers
Squirrel Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HiC_Itri_2	NW_024405118	217,679,298 - 217,684,505 (-)	NCBI		HiC_Itri_2
SpeTri2.0 Ensembl	NW_004936588	150,486 - 156,519 (+)	Ensembl		SpeTri2.0 Ensembl
SpeTri2.0	NW_004936588	150,465 - 155,485 (+)	NCBI	SpeTri2.0	SpeTri2.0		SpeTri2.0

TPGS1
(Sus scrofa - pig)

Pig Assembly	Chr	Position (strand)	Source	Genome Browsers
Pig Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
Sscrofa11.1 Ensembl	2	77,776,277 - 77,783,416 (-)	Ensembl			susScr11	Sscrofa11.1
Sscrofa11.1	2	77,776,269 - 77,783,434 (-)	NCBI	Sscrofa11.1	Sscrofa11.1	susScr11	Sscrofa11.1

TPGS1
(Chlorocebus sabaeus - green monkey)

Green Monkey Assembly	Chr	Position (strand)	Source	Genome Browsers
Green Monkey Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
ChlSab1.1	6	236,753 - 248,531 (+)	NCBI	ChlSab1.1	ChlSab1.1	chlSab2
ChlSab1.1 Ensembl	6	237,462 - 248,526 (+)	Ensembl		ChlSab1.1 Ensembl	chlSab2	Vervet-AGM
Vero_WHO_p1.0	NW_023666081	8,843,203 - 8,888,590 (-)	NCBI	Vero_WHO_p1.0	Vero_WHO_p1.0

Tpgs1
(Heterocephalus glaber - naked mole-rat)

Naked Mole-Rat Assembly	Chr	Position (strand)	Source	Genome Browsers
Naked Mole-Rat Assembly	Chr	Position (strand)	Source	JBrowse	NCBI	UCSC	Ensembl
HetGla_female_1.0 Ensembl	NW_004624828	7,946,301 - 7,953,653 (-)	Ensembl		HetGla_female_1.0 Ensembl	hetGla2	HetGla_female_1.0 Ensembl
HetGla 1.0	NW_004624828	7,946,158 - 7,953,633 (-)	NCBI	HetGla 1.0	HetGla 1.0	hetGla2

Variants

Variants in Tpgs1
13 total Variants

miRNA Target Status (No longer updated)

Predicted Target Of

	Summary Value
Count of predictions:	105
Count of miRNA genes:	86
Interacting mature miRNAs:	91
Transcripts:	ENSRNOT00000011010
Prediction methods:	Microtar, Miranda, Rnahybrid
Result types:	miRGate_prediction

The detailed report is available here: Full Report CSV TAB Printer

miRNA Target Status data imported from miRGate (http://mirgate.bioinfo.cnio.es/).
For more information about miRGate, see PMID:25858286 or access the full paper here.

QTLs in Region (GRCr8)

The following QTLs overlap with this region.

RGD ID	Symbol	Name	LOD	P Value	Trait	Sub Trait	Chr	Start	Stop	Species
61410	Bw19	Body weight QTL 19	6.2	0.001	body mass (VT:0001259)	body weight (CMO:0000012)	7	1	44782185	Rat
1300176	Hrtrt10	Heart rate QTL 10	3.19		heart pumping trait (VT:2000009)	heart rate (CMO:0000002)	7	664270	26029351	Rat
1578652	Bmd15	Bone mineral density QTL 15	5.2		femur mineral mass (VT:0010011)	trabecular volumetric bone mineral density (CMO:0001729)	7	9866467	60460686	Rat
9590102	Sffal5	Serum free fatty acids level QTL 5	8.62	0.001	blood free fatty acid amount (VT:0001553)	plasma free fatty acids level (CMO:0000546)	7	5329019	50329019	Rat
1643004	Pain2	Pain QTL 2	1		mechanical nociception trait (VT:0002734)	self mutilation severity score (CMO:0002145)	7	9462246	98011544	Rat
631503	Bp102	Blood pressure QTL 102	1.9		arterial blood pressure trait (VT:2000000)	systolic blood pressure (CMO:0000004)	7	1	44822433	Rat
634336	Anxrr17	Anxiety related response QTL 17	3.66		locomotor behavior trait (VT:0001392)	number of entries into a discrete space in an experimental apparatus (CMO:0000960)	7	924703	115097879	Rat
10755438	Coatc9	Coat color QTL 9		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	3529280	48529280	Rat
9590142	Scort5	Serum corticosterone level QTL 5	24.4	0.001	blood corticosterone amount (VT:0005345)	plasma corticosterone level (CMO:0001173)	7	1	31962314	Rat
2298547	Neuinf5	Neuroinflammation QTL 5	3.7		nervous system integrity trait (VT:0010566)	spinal cord Cd74 protein level (CMO:0002131)	7	9462246	58265113	Rat
10059592	Kidm45	Kidney mass QTL 45	3.95	0.025	kidney mass (VT:0002707)	both kidneys wet weight to body weight ratio (CMO:0000340)	7	7573985	52573985	Rat
2317047	Wbc4	White blood cell count QTL 4		0.01	leukocyte quantity (VT:0000217)	white blood cell count (CMO:0000027)	7	1	35342956	Rat
10755440	Coatc10	Coat color QTL 10		0	coat/hair pigmentation trait (VT:0010463)	pigmented ventral coat/hair area to total ventral coat/hair area ratio (CMO:0001812)	7	7496499	52496499	Rat
2298550	Neuinf6	Neuroinflammation QTL 6	3.3		nervous system integrity trait (VT:0010566)	spinal cord RT1-B protein level (CMO:0002132)	7	1	27829089	Rat
724560	Plsm3	Polydactyly-luxate syndrome (PLS) morphotypes QTL 3		0.0003	tibia length (VT:0004357)	tibia length (CMO:0000450)	7	1	34000259	Rat
7411566	Bw136	Body weight QTL 136	10.4	0.001	body mass (VT:0001259)	body weight gain (CMO:0000420)	7	1	31962314	Rat

Markers in Region

AV005629

Rat Assembly	Chr	Position (strand)	Source	JBrowse
mRatBN7.2	7	10,029,950 - 10,030,076 (+)	MAPPER	mRatBN7.2
Rnor_6.0	7	12,912,360 - 12,912,485	NCBI	Rnor6.0
Rnor_5.0	7	13,081,075 - 13,081,200	UniSTS	Rnor5.0
RGSC_v3.4	7	11,546,869 - 11,546,994	UniSTS	RGSC3.4
Celera	7	8,203,198 - 8,203,323	UniSTS
Cytogenetic Map	7	q11	UniSTS

Expression

RNA-SEQ Expression

Click on a value in the shaded box below the category label to view a detailed expression data table for that system.

Download All Expressed Objects for this Gene

alimentary part of gastrointestinal system	appendage	circulatory system	ectoderm	endocrine system	endoderm	exocrine system	hemolymphoid system	hepatobiliary system	integumental system	mesenchyme	mesoderm	musculoskeletal system	nervous system	renal system	reproductive system	respiratory system	sensory system	visual system
16	12	67	160	91	90	59	92	59	6	356	192	11	139	81	92	31	17	17

Sequence

Nucleotide Sequences


RefSeq Transcripts	NM_001109621	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
GenBank Nucleotide	AC097878	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	CH474029	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	FQ212876	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles
	JAXUCZ010000007	(Get FASTA)	NCBI Sequence Viewer	Search GEO for Microarray Profiles

Ensembl Acc Id:

ENSRNOT00000011010 ⟹ ENSRNOP00000011010

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8 Ensembl	7	10,680,473 - 10,686,383 (-)	Ensembl
mRatBN7.2 Ensembl	7	10,029,854 - 10,035,764 (-)	Ensembl
Rnor_6.0 Ensembl	7	12,912,263 - 12,918,173 (-)	Ensembl

RefSeq Acc Id:

NM_001109621 ⟹ NP_001103091

RefSeq Status:

PROVISIONAL

Type:

CODING

Position:

Rat Assembly	Chr	Position (strand)	Source
GRCr8	7	10,680,461 - 10,686,383 (-)	NCBI
mRatBN7.2	7	10,029,842 - 10,035,764 (-)	NCBI
Rnor_6.0	7	12,912,251 - 12,918,173 (-)	NCBI
Rnor_5.0	7	13,080,966 - 13,086,888 (-)	NCBI
RGSC_v3.4	7	11,546,760 - 11,552,682 (-)	RGD
Celera	7	8,203,089 - 8,209,005 (-)	RGD

Sequence:

show sequence

ACAAAGTGAGGCCAAAAGCCCGGGAGAGCCCAGGCCGAGTCTAAGAGCAAACACAGAAAACGGT
CTGAACCCCGCTCTTAGCCCTAGATTCCCGGTGGGCTTTCTGGGGTTTCTCTGGTACCCAGGGT
GCCTGGTTGCTAGGAGACCATGCTTAGGAAGATTTGCCCACTACCAAGATGGCAAGGTGTCGCG
CTTCAAGCCAGAAACCAAGTCCTTCCTGGGGGACCATTTTGAAGTCTGGCAAGCTCACGATTCC
TGACTGAAGCTAGAAGATGCAGTCATGGAGTAGCAGGAGAGATGCAAACAGAAAACGCCAGTTA
GGGTATAAGGGGAAAGGAAGCCTGCGCTTGTCACTATCGAGACTCTCAGAAAGGGCGCAGCTGC
CTCTGCCCTTAACAAAAATGGCCGTTCTCGGAGGGTGCCTCGTCGCGCCGTGAATTATGGCGGC
GCTTCCGGTCCCGCTGCCCCCAGCAAAGATGGCGGCAGTGGAGAAACGACGGCCGGCAGTAGCA
CCAGCGGCCAATTTCCCAGACAGTGGCCGGACGTCGGTGTCTCAGGCGGTGGCGGCGGCTGAGA
GCGAGGAGGATTTCCTACGGCAGGTTGGCGTGACGGAGATGCTGCGCGCAGCCCTCCTGAAGGT
GCTGGAGACCCGGCCCGAAGAGCCCATCGCCTTCTTGGCGCATTACTTCGAGAACATGGGTTTG
CGCTCGCCGGCCAACGGAGGCGCCGGGGAGCCCCCGGGCCAGCTCCTCCTGCAGCAACAGCGCC
TGGGTCGCGCGCTGTGGCACCTTCGCCTGGCTCACCACTCGCAGAGGACGGCCTTCAACAACAA
CGTGAGCGTGGCCTATGAGTGCCTGAGTGCGAGCGGCCGCAAGAAGAAGCCAGGCCTGGATGGG
CGCACATACAGCGAGCTGCTGAAGCGAGTTTGCAGGGACGGCGGGGCGCCTGAGGAAGTGGTGG
CACCGCTGCTGCGCAAGATCCAGTGCCGAGACCATGAGGCTGTGCCTCTGGGCATCTTCAGAAC
CGGCATGCTGTCCTGCTTTGTGCTGCTGGAATTCGTGGCGCGCGCCAGCGCCCTCTTCCAGCTG
CTGGAGGACCCTGGCCTAGCGGTGGCTGATCGGCGTGTGGGTCAGGCTGTGCTGGACACGCTCG
AGGGTGCGCTGAGCGCAGGAGACCTGGCAACGGCGCCCACGCACTACCTGGAGGCCGGTTCCCG
CCTGGGCCCCGACAACCTGGCGCGTGCCCTGGACAGGGCAGCAGCCGGGCGACGACCCAGTGCA
CCCATGGCCCGCGAGGAGTTCTTGGAGAAGGCTGCAGCCCTCTTCATTGCCAAGGTCAAGCCAG
TGGGCTAAACCCACAATGCACCCACACCCTGTCACCTGCCCAGGAAGGCGTGAACTTGGGACCT
GCAAACCGATGTCCCGGCATCCTGCACAGGGTCATCAACCAGGAAGGGGGAGCCACTTGGACCC
TGCAGGACAAGCACCTGCAGATCAATCCCCTCTGTACTGGCCTGCCTACCCCACTCACAGAAAT
AAAATCTAAAAAGATCCGG

hide sequence

Protein Sequences


Protein RefSeqs	NP_001103091	(Get FASTA)	NCBI Sequence Viewer
GenBank Protein	EDL89412	(Get FASTA)	NCBI Sequence Viewer
Ensembl Protein	ENSRNOP00000011010
	ENSRNOP00000011010.4

RefSeq Acc Id:

NP_001103091 ⟸ NM_001109621

- UniProtKB:

D4A463 (UniProtKB/TrEMBL), A6K8Z2 (UniProtKB/TrEMBL)

- Sequence:

show sequence

MAALPVPLPPAKMAAVEKRRPAVAPAANFPDSGRTSVSQAVAAAESEEDFLRQVGVTEMLRAAL
LKVLETRPEEPIAFLAHYFENMGLRSPANGGAGEPPGQLLLQQQRLGRALWHLRLAHHSQRTAF
NNNVSVAYECLSASGRKKKPGLDGRTYSELLKRVCRDGGAPEEVVAPLLRKIQCRDHEAVPLGI
FRTGMLSCFVLLEFVARASALFQLLEDPGLAVADRRVGQAVLDTLEGALSAGDLATAPTHYLEA
GSRLGPDNLARALDRAAAGRRPSAPMAREEFLEKAAALFIAKVKPVG

hide sequence

Ensembl Acc Id:

ENSRNOP00000011010 ⟸ ENSRNOT00000011010

Protein Structures

Name	Modeler	Protein Id	AA Range	Protein Structure
AF-D4A463-F1-model_v2	AlphaFold	D4A463	1-303	view protein structure

Transcriptome

eQTL		View at Phenogen
WGCNA		View at Phenogen
Tissue/Strain Expression		View at Phenogen

Additional Information

External Database Links

Database	Acc Id	Source(s)
AGR Gene	RGD:1588613	AgrOrtholog
BioCyc Gene	G2FUF-34880	BioCyc
Ensembl Genes	ENSRNOG00000008296	Ensembl, ENTREZGENE, UniProtKB/TrEMBL
Ensembl Transcript	ENSRNOT00000011010	ENTREZGENE
	ENSRNOT00000011010.8	UniProtKB/TrEMBL
Gene3D-CATH	cAMP-dependent protein kinase regulatory subunit, dimerization-anchoring domain	UniProtKB/TrEMBL
InterPro	DD_TPGS1	UniProtKB/TrEMBL
	TPGS1	UniProtKB/TrEMBL
KEGG Report	rno:691093	UniProtKB/TrEMBL
NCBI Gene	691093	ENTREZGENE
PANTHER	PTHR31932	UniProtKB/TrEMBL
	TUBULIN POLYGLUTAMYLASE COMPLEX SUBUNIT 1	UniProtKB/TrEMBL
Pfam	TPGS1_C	UniProtKB/TrEMBL
PhenoGen	Tpgs1	PhenoGen
RatGTEx	ENSRNOG00000008296	RatGTEx
Superfamily-SCOP	Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit	UniProtKB/TrEMBL
UniProt	A6K8Z2	ENTREZGENE, UniProtKB/TrEMBL
	D4A463	ENTREZGENE, UniProtKB/TrEMBL

Nomenclature History

Date	Current Symbol	Current Name	Previous Symbol	Previous Name	Description	Reference	Status
2011-12-06	Tpgs1	tubulin polyglutamylase complex subunit 1	Gtrgeo22	gene trap ROSA b-geo 22	Nomenclature updated to reflect human and mouse nomenclature	1299863	APPROVED
2006-11-19	LOC691093	similar to gene trap ROSA b-geo 22			Symbol and Name status set to provisional	70820	PROVISIONAL

Gene Annotator (Functional Annotation) unavailable	Gene Annotator (Annotation Distribution) unavailable	Variant Visualizer (Genomic Variants) unavailble Variant Visualizer (Genomic Variants) unavailable
Gene Annotator (Functional Annotation)	Gene Annotator (Annotation Distribution)	Variant Visualizer (Genomic Variants)

InterViewer (Protein-Protein Interactions) unavailable	Gviewer (Genome Viewer) unavailable	Variant Visualizer (Damaging Variants) unavailble Variant Visualizer (Damaging Variants) unavailable
InterViewer (Protein-Protein Interactions)	GViewer (Genome Viewer)	Variant Visualizer (Damaging Variants)

Gene Annotator (Annotation Comparison) unavailable	OLGA (Gene List Generator) unavailable
Gene Annotator (Annotation Comparison)	OLGA (Gene List Generator)	Excel (Download)

MOET (Multi-Ontology Enrichement) unavailable	GOLF (Gene-Ortholog Location Finder) unavailable
MOET (Multi-Ontology Enrichement)	GOLF (Gene-Ortholog Location Finder)

Send us a Message